Metagenome Family F056421

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F056421
Family Type	Metagenome
Number of Sequences	137
Average Sequence Length	39 residues
Representative Sequence	MKDDEVENLFAYGWLDTAVAIVLALLALVALFFMAGYLT
Number of Associated Samples	74
Number of Associated Scaffolds	136

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	94.16 %
% of genes near scaffold ends (potentially truncated)	8.03 %
% of genes from short scaffolds (< 2000 bps)	64.96 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (59.124 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (32.847 % of family members)
Environment Ontology (ENVO)	Unclassified (70.073 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (59.854 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 136 Family Scaffolds
PF00271	Helicase_C	2.94
PF11753	DUF3310	2.94
PF00959	Phage_lysozyme	2.21
PF00476	DNA_pol_A	2.21
PF13481	AAA_25	1.47
PF13662	Toprim_4	1.47
PF10926	DUF2800	1.47
PF03237	Terminase_6N	1.47
PF04404	ERF	1.47
PF15943	YdaS_antitoxin	1.47
PF05866	RusA	0.74
PF13203	DUF2201_N	0.74
PF00383	dCMP_cyt_deam_1	0.74
PF07486	Hydrolase_2	0.74
PF03819	MazG	0.74
PF01227	GTP_cyclohydroI	0.74
PF11351	GTA_holin_3TM	0.74
PF01612	DNA_pol_A_exo1	0.74
PF13229	Beta_helix	0.74
PF08291	Peptidase_M15_3	0.74
PF13479	AAA_24	0.74
PF05037	DUF669	0.74

COG ID	Name	Functional Category	% Frequency in 136 Family Scaffolds
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	2.21
COG3773	Cell wall hydrolase CwlJ, involved in spore germination	Cell cycle control, cell division, chromosome partitioning [D]	0.74
COG4570	Holliday junction resolvase RusA (prophage-encoded endonuclease)	Replication, recombination and repair [L]	0.74

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	83.21 %
Unclassified	root	N/A	16.79 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	75.18 %
Unclassified	root	N/A	16.79 %
cellular organisms	root	All Organisms → cellular organisms	8.03 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	59.12 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	8.03 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	59.12 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	4.38 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.73 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.73 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	59.12 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.46 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.73 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.73 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.73 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.73 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	59.12 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.46 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.73 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.73 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	58.39 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	0.73 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.73 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.73 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	58.39 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.73 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.73 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.73 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.73 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.73 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	58.39 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
unclassified Methylocystis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis	0.73 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.73 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.73 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.73 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.73 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	58.39 %
Unclassified	root	N/A	16.79 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	16.06 %
Methylocystis sp. WRRC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. WRRC1	0.73 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.73 %
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	0.73 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.73 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_108880038	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	531	Open in IMG/M
3300002408\|B570J29032_109246494	All Organisms → cellular organisms → Bacteria → Proteobacteria	653	Open in IMG/M
3300002408\|B570J29032_109866587	All Organisms → cellular organisms → Bacteria	1780	Open in IMG/M
3300002408\|B570J29032_109955899	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7706	Open in IMG/M
3300002835\|B570J40625_100003299	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	30219	Open in IMG/M
3300002835\|B570J40625_100170799	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2427	Open in IMG/M
3300002835\|B570J40625_100289352	All Organisms → Viruses → Predicted Viral	1670	Open in IMG/M
3300004481\|Ga0069718_14543430	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	794	Open in IMG/M
3300005581\|Ga0049081_10016412	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2799	Open in IMG/M
3300006037\|Ga0075465_10018492	All Organisms → Viruses → Predicted Viral	1358	Open in IMG/M
3300006805\|Ga0075464_10029269	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2923	Open in IMG/M
3300006805\|Ga0075464_10068561	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1994	Open in IMG/M
3300006805\|Ga0075464_10078324	All Organisms → Viruses → Predicted Viral	1872	Open in IMG/M
3300006805\|Ga0075464_10113698	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1566	Open in IMG/M
3300006805\|Ga0075464_10119528	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1529	Open in IMG/M
3300006805\|Ga0075464_10301835	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	964	Open in IMG/M
3300006920\|Ga0070748_1044470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1780	Open in IMG/M
3300006920\|Ga0070748_1345088	All Organisms → cellular organisms → Bacteria	526	Open in IMG/M
3300007544\|Ga0102861_1099318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	777	Open in IMG/M
3300007708\|Ga0102859_1196461	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	599	Open in IMG/M
3300007974\|Ga0105747_1066694	Not Available	1084	Open in IMG/M
3300009039\|Ga0105152_10116280	Not Available	1089	Open in IMG/M
3300009039\|Ga0105152_10331609	Not Available	636	Open in IMG/M
3300009151\|Ga0114962_10000693	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	29552	Open in IMG/M
3300009151\|Ga0114962_10055127	All Organisms → Viruses → Predicted Viral	2602	Open in IMG/M
3300009151\|Ga0114962_10070499	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2241	Open in IMG/M
3300009151\|Ga0114962_10095075	All Organisms → Viruses → Predicted Viral	1865	Open in IMG/M
3300009158\|Ga0114977_10022294	All Organisms → Viruses → Predicted Viral	3972	Open in IMG/M
3300009158\|Ga0114977_10022939	All Organisms → Viruses → Predicted Viral	3911	Open in IMG/M
3300009158\|Ga0114977_10224483	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1093	Open in IMG/M
3300009159\|Ga0114978_10068555	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2391	Open in IMG/M
3300009159\|Ga0114978_10299024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	986	Open in IMG/M
3300009160\|Ga0114981_10571858	All Organisms → cellular organisms → Bacteria → Proteobacteria	601	Open in IMG/M
3300009161\|Ga0114966_10010762	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7267	Open in IMG/M
3300009161\|Ga0114966_10490905	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	701	Open in IMG/M
3300009164\|Ga0114975_10015275	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4713	Open in IMG/M
3300009164\|Ga0114975_10068519	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2071	Open in IMG/M
3300009164\|Ga0114975_10269554	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	948	Open in IMG/M
3300009164\|Ga0114975_10273622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. WRRC1	940	Open in IMG/M
3300009180\|Ga0114979_10037084	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3080	Open in IMG/M
3300009183\|Ga0114974_10051962	All Organisms → Viruses → Predicted Viral	2746	Open in IMG/M
3300010885\|Ga0133913_11363733	Not Available	1806	Open in IMG/M
3300010885\|Ga0133913_11397759	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1780	Open in IMG/M
3300011114\|Ga0151515_10077	Not Available	38942	Open in IMG/M
3300011335\|Ga0153698_1041	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	55456	Open in IMG/M
3300011335\|Ga0153698_1041	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	55456	Open in IMG/M
3300011335\|Ga0153698_1766	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12068	Open in IMG/M
3300011336\|Ga0153703_1160	Not Available	24657	Open in IMG/M
3300011336\|Ga0153703_1744	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10117	Open in IMG/M
3300011337\|Ga0153702_1602	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11758	Open in IMG/M
3300011339\|Ga0153700_10151	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	34525	Open in IMG/M
3300013004\|Ga0164293_10013686	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6823	Open in IMG/M
3300013004\|Ga0164293_10078445	All Organisms → Viruses → Predicted Viral	2582	Open in IMG/M
3300013004\|Ga0164293_10272441	Not Available	1185	Open in IMG/M
3300013004\|Ga0164293_10288458	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1142	Open in IMG/M
3300013004\|Ga0164293_10413630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	905	Open in IMG/M
3300013004\|Ga0164293_10530683	Not Available	773	Open in IMG/M
3300013004\|Ga0164293_10569336	Not Available	739	Open in IMG/M
3300013005\|Ga0164292_10017246	Not Available	5910	Open in IMG/M
3300017707\|Ga0181363_1057730	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686	Open in IMG/M
3300017747\|Ga0181352_1018200	All Organisms → Viruses → Predicted Viral	2194	Open in IMG/M
3300017747\|Ga0181352_1110669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	747	Open in IMG/M
3300017747\|Ga0181352_1174074	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	561	Open in IMG/M
3300017754\|Ga0181344_1025136	All Organisms → Viruses → Predicted Viral	1833	Open in IMG/M
3300017754\|Ga0181344_1126270	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	736	Open in IMG/M
3300017754\|Ga0181344_1143191	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	683	Open in IMG/M
3300017766\|Ga0181343_1023161	All Organisms → Viruses → Predicted Viral	1908	Open in IMG/M
3300018416\|Ga0181553_10412398	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	732	Open in IMG/M
3300018420\|Ga0181563_10570721	Not Available	631	Open in IMG/M
3300019784\|Ga0181359_1088878	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1148	Open in IMG/M
3300020161\|Ga0211726_10379198	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5212	Open in IMG/M
3300020506\|Ga0208091_1018618	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300020530\|Ga0208235_1017654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	883	Open in IMG/M
3300020549\|Ga0207942_1003596	All Organisms → Viruses → Predicted Viral	2390	Open in IMG/M
3300020549\|Ga0207942_1018873	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	885	Open in IMG/M
3300020549\|Ga0207942_1051553	Not Available	505	Open in IMG/M
3300020550\|Ga0208600_1064532	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	532	Open in IMG/M
3300022179\|Ga0181353_1057663	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1007	Open in IMG/M
3300022179\|Ga0181353_1068825	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	907	Open in IMG/M
3300022179\|Ga0181353_1071497	Not Available	886	Open in IMG/M
3300023184\|Ga0214919_10000479	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	68272	Open in IMG/M
3300023184\|Ga0214919_10007591	Not Available	14571	Open in IMG/M
3300023184\|Ga0214919_10653658	Not Available	607	Open in IMG/M
3300024348\|Ga0244776_10229420	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1303	Open in IMG/M
3300025075\|Ga0209615_100902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2329	Open in IMG/M
3300025451\|Ga0208426_1006924	All Organisms → Viruses → Predicted Viral	1610	Open in IMG/M
3300025896\|Ga0208916_10133684	All Organisms → Viruses → Predicted Viral	1061	Open in IMG/M
3300025896\|Ga0208916_10297921	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	702	Open in IMG/M
3300027734\|Ga0209087_1157896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	905	Open in IMG/M
3300027734\|Ga0209087_1313799	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	554	Open in IMG/M
3300027741\|Ga0209085_1190620	Not Available	839	Open in IMG/M
3300027749\|Ga0209084_1000514	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	36414	Open in IMG/M
3300027749\|Ga0209084_1104655	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1241	Open in IMG/M
3300027754\|Ga0209596_1279274	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	672	Open in IMG/M
3300027754\|Ga0209596_1284008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	664	Open in IMG/M
3300027759\|Ga0209296_1005358	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8223	Open in IMG/M
3300027759\|Ga0209296_1098180	All Organisms → Viruses → Predicted Viral	1404	Open in IMG/M
3300027759\|Ga0209296_1276953	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	677	Open in IMG/M
3300027764\|Ga0209134_10081636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1096	Open in IMG/M
3300027805\|Ga0209229_10006331	Not Available	4943	Open in IMG/M
3300027899\|Ga0209668_10132933	All Organisms → Viruses → Predicted Viral	1490	Open in IMG/M
3300027969\|Ga0209191_1144523	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	975	Open in IMG/M
3300028025\|Ga0247723_1122846	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	632	Open in IMG/M
3300033992\|Ga0334992_0064991	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2029	Open in IMG/M
3300033992\|Ga0334992_0093384	Not Available	1621	Open in IMG/M
3300033992\|Ga0334992_0281263	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	788	Open in IMG/M
3300033993\|Ga0334994_0002899	Not Available	12411	Open in IMG/M
3300033993\|Ga0334994_0111423	All Organisms → Viruses → Predicted Viral	1591	Open in IMG/M
3300033993\|Ga0334994_0422442	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	638	Open in IMG/M
3300033995\|Ga0335003_0015886	Not Available	4015	Open in IMG/M
3300033995\|Ga0335003_0461056	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	531	Open in IMG/M
3300033996\|Ga0334979_0008964	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6937	Open in IMG/M
3300033996\|Ga0334979_0033748	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3391	Open in IMG/M
3300033996\|Ga0334979_0103011	Not Available	1774	Open in IMG/M
3300033996\|Ga0334979_0196436	All Organisms → Viruses → Predicted Viral	1192	Open in IMG/M
3300033996\|Ga0334979_0269928	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	976	Open in IMG/M
3300033996\|Ga0334979_0420238	Not Available	735	Open in IMG/M
3300034012\|Ga0334986_0024240	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	4078	Open in IMG/M
3300034022\|Ga0335005_0017272	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5091	Open in IMG/M
3300034060\|Ga0334983_0120698	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1675	Open in IMG/M
3300034068\|Ga0334990_0072893	All Organisms → Viruses → Predicted Viral	1846	Open in IMG/M
3300034082\|Ga0335020_0021558	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3637	Open in IMG/M
3300034082\|Ga0335020_0452957	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	613	Open in IMG/M
3300034093\|Ga0335012_0217116	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1006	Open in IMG/M
3300034093\|Ga0335012_0239316	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	945	Open in IMG/M
3300034093\|Ga0335012_0470935	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	601	Open in IMG/M
3300034095\|Ga0335022_0044558	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2925	Open in IMG/M
3300034095\|Ga0335022_0121500	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1645	Open in IMG/M
3300034104\|Ga0335031_0132736	All Organisms → Viruses → Predicted Viral	1733	Open in IMG/M
3300034104\|Ga0335031_0135267	All Organisms → cellular organisms → Bacteria	1714	Open in IMG/M
3300034107\|Ga0335037_0169176	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1196	Open in IMG/M
3300034117\|Ga0335033_0034861	Not Available	3171	Open in IMG/M
3300034167\|Ga0335017_0003249	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8447	Open in IMG/M
3300034200\|Ga0335065_0420718	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300034283\|Ga0335007_0182602	All Organisms → Viruses → Predicted Viral	1473	Open in IMG/M
3300034356\|Ga0335048_0443075	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	634	Open in IMG/M
3300034357\|Ga0335064_0024026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3244	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.27%
Terrestrial	Environmental → Terrestrial	0.73%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	86.13%
Marine	Environmental → Aquatic → Marine	13.14%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.73%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	58.39%
Lentic	Environmental → Aquatic → Freshwater → Lentic	21.17%
Coastal	Environmental → Aquatic → Marine → Coastal	9.49%
Lotic	Environmental → Aquatic → Freshwater → Lotic	5.11%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.65%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.73%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.73%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	56.93%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	13.87%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	9.49%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	6.57%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	5.11%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.19%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.46%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	1.46%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.73%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.73%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.73%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	32.85%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	22.63%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	9.49%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	8.76%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	6.57%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	5.11%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.92%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.19%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.46%
Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment	1.46%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	1.46%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.73%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	0.73%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.73%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.73%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.73%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.73%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.73%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300006037	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006920	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12	Environmental	Open in IMG/M
3300007544	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300009039	Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011114	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb	Environmental	Open in IMG/M
3300011335	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman	Environmental	Open in IMG/M
3300011336	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang	Environmental	Open in IMG/M
3300011337	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan	Environmental	Open in IMG/M
3300011339	Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017766	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D	Environmental	Open in IMG/M
3300018416	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)	Environmental	Open in IMG/M
3300018420	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020530	Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020549	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020550	Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300025075	Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025451	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300033995	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034012	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034060	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016	Environmental	Open in IMG/M
3300034068	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031	Environmental	Open in IMG/M
3300034082	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034107	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M
3300034356	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152	Environmental	Open in IMG/M
3300034357	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1088800382	3300002408	Freshwater	MKDDDVEDLFAYGWLDTSIAIVLALLALVALSFFAGYLL*
B570J29032_1092464942	3300002408	Freshwater	MKDDEVEDLFAYGWLDTSIAIVLALLAIAALFFMAGYLT*
B570J29032_1098665873	3300002408	Freshwater	MKDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLL*
B570J29032_10995589912	3300002408	Freshwater	MKDDEVENLFAYGWLDTALAIVLALLAIAALFFMAGYLS*
B570J40625_10000329931	3300002835	Freshwater	MKDDDVEDLFAYGWLDTGIAIVLALLAIAALSFFAGYLT*
B570J40625_1001707995	3300002835	Freshwater	MNDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLT*
B570J40625_1002893524	3300002835	Freshwater	MKDDEVEGLFAWGWFDLALAVILTLLAIAALFFAAGYLI*
Ga0069718_145434303	3300004481	Sediment	VKDDDEDQFLFAYGWLDTAIAIILALCTLAAVFFALGYLL*
Ga0049081_100164126	3300005581	Freshwater Lentic	DMKDDEVENLFKYGWLDTCIAIVLALLAVAALFFMAGYLT*
Ga0075465_100184926	3300006037	Aqueous	MKDDEVENLFAYGWIDAAVAIAIALLALVALFFMAGYLT*
Ga0075464_100292695	3300006805	Aqueous	MKDDEVENLFAYGWIDAAVAIAIALIALVALFFMAGYLI*
Ga0075464_100685618	3300006805	Aqueous	MKDDDVEDLFKYGWLDAAVAIAIALLAIVALFFMAGYLT*
Ga0075464_100783242	3300006805	Aqueous	MKDDEIENLFKYSWLDAALAIALALLALVSLFFLEGYLI*
Ga0075464_101136985	3300006805	Aqueous	MKDDEVENLFAYGWIDAAVAIVIALLALVALFFMAGYLT*
Ga0075464_101195284	3300006805	Aqueous	MKDDEVENLFAYSWLDAAVAIAIALLAIVALFFFARQLT*
Ga0075464_103018353	3300006805	Aqueous	MKDDEIENLFKYGWIDASIAIAIALLALVALFFFAGYLT*
Ga0070748_10444701	3300006920	Aqueous	MKDDEVENLFAYSWLDAAVAIAIALLAIVALFFFAGYLT*
Ga0070748_13450881	3300006920	Aqueous	MKDDEVENLFAYGWLDTCIAIVLALLAIAALFFVAGYLT*
Ga0102861_10993181	3300007544	Estuarine	MKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAGYLI*
Ga0102859_11964613	3300007708	Estuarine	MKDDEIENLFKYSWLDAALAIALALIAMVSLFFLAGYLT*
Ga0105747_10666941	3300007974	Estuary Water	MKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAG
Ga0105152_101162802	3300009039	Lake Sediment	MKDDDEDKFLFAYGWIDTALTIFLTLLALAALFFLAGYLI*
Ga0105152_103316093	3300009039	Lake Sediment	MKDDEEDQFLFAYGWIDTAIAIILALCTLAALFFLA
Ga0114962_1000069315	3300009151	Freshwater Lake	MNDDNEEGLFAYSWMDFALAIVLTLLALAALFFLAGYLI*
Ga0114962_100551275	3300009151	Freshwater Lake	MQLAITGESDMKDDEVENLFDYSWLDAAVAIVIALLALVALFFFARQLT*
Ga0114962_100704996	3300009151	Freshwater Lake	MKDDEVENLFAYGWLDAAISIAIALLAMVALFFFAGYLT*
Ga0114962_100950754	3300009151	Freshwater Lake	MKDDEVENLFAYGWLDAAISIAIALLALVALFFFARYLT*
Ga0114977_100222941	3300009158	Freshwater Lake	MKDDEIENLFAYGWLDAAISIAIALLAMVALFFFAGYLT*
Ga0114977_100229391	3300009158	Freshwater Lake	EGTEMKDDEVENLFAYGWLDAAVAIAIALLALVALFFFAGYLT*
Ga0114977_102244832	3300009158	Freshwater Lake	MKDDEVENLFAYGWIDAAVAIAIALLAIVALFFMAGYLT*
Ga0114978_100685555	3300009159	Freshwater Lake	MKDDEVEDLFKYGWIDASIAIVIALLALVALFFLAGYLT*
Ga0114978_102990244	3300009159	Freshwater Lake	MKDDEIEDLFKYGWIDASIAIAIALLALVALFFFARYLT*
Ga0114981_105718582	3300009160	Freshwater Lake	MKDDEVENLFAYGWLDAAVAIAIALLALVALFFFAGYLT*
Ga0114966_100107627	3300009161	Freshwater Lake	MKDDDVEDLFKYGWLDATVAIVIALLAIVALFFFAGYLT*
Ga0114966_104909052	3300009161	Freshwater Lake	MKDDEIENLFAYGWLDSGIAIVIALLAIVALFFFARYLT*
Ga0114975_100152755	3300009164	Freshwater Lake	MKDDEVENLFAYSWLDAAVAIAIALLAIAALFFFAGYLT*
Ga0114975_100685194	3300009164	Freshwater Lake	MKDDEVEDLFKYGWIDASIAIAIALLALVALFFLAGYLT*
Ga0114975_102695543	3300009164	Freshwater Lake	MKDDEVEDLFAWGWIKASIAIVIALLALVALFFAAGYLT*
Ga0114975_102736223	3300009164	Freshwater Lake	MKDDEIENLFKYGWLDAAVAIAIALLALVALFFAARYLT*
Ga0114979_100370844	3300009180	Freshwater Lake	MKDDEVEDLFKYGWIDASIAIVIALLALVALFFMAGYLT*
Ga0114974_100519623	3300009183	Freshwater Lake	MKDDEIENLFAYGWIDAAVAIAIALLALVALFFMAGYLT*
Ga0133913_113637335	3300010885	Freshwater Lake	MKDDNEEGLFAYGWMDCALAIVLTLLALAALFFLAGYLI*
Ga0133913_113977591	3300010885	Freshwater Lake	MKDDDVEDLFAYGWLDTALAIVLALLALVALFFMAGYLT*
Ga0151515_1007736	3300011114	Freshwater	MKDDEVEGLFAYGWLDLALAVILTLLAVAALFFAAGYLI*
Ga0153698_104115	3300011335	Freshwater	MKDDEIEDLFKYGWIDTAVAIVLALLALVALFFMVGYLT*
Ga0153698_104165	3300011335	Freshwater	MKDDEVENLFKYGWLDTSIAIAIALLAMVALFFFAGYLT*
Ga0153698_176612	3300011335	Freshwater	MKDDDVEDLFAYGWLDTALAIVLALVALVALSFFAGYLT*
Ga0153703_116015	3300011336	Freshwater	MKDDDENLFAYGWLDTAIAIILALCTLAALFFALGYLL*
Ga0153703_174415	3300011336	Freshwater	MKDDDEDKFLFAYGWLDTALAIVLTLLAMAALFFLAGYLL*
Ga0153702_160216	3300011337	Freshwater	MKDDEVENLFAYGWLDSAVAIVLALLALVALSFFAGYLT*
Ga0153700_101519	3300011339	Freshwater	MKDDEVENLFAYGWLDTAVAIALALLAIAALFFMAGYLT*
Ga0164293_1001368620	3300013004	Freshwater	MKDDDVEDLFAYGWLDTALAIVLALVALVALSFFAGYLI*
Ga0164293_100784459	3300013004	Freshwater	MKDDEIEDLFAYGWLDTALAIVLALLALVALSFFAGYLT*
Ga0164293_102724412	3300013004	Freshwater	MKDDEVENLFAYGWLDTGIAIVLALLALVSLFFLEGYLT*
Ga0164293_102884582	3300013004	Freshwater	MKDDEVENLFAYGWLDTAVAIVLALLALVALSFFAGYLI*
Ga0164293_104136301	3300013004	Freshwater	MKDDEVENLFAYGWLDTALAIVLALLALVALSFFAGYLT*
Ga0164293_105306832	3300013004	Freshwater	MKDDEIEDLFKYGWLDTGIAIVLALLALVSLFFLEGYLT*
Ga0164293_105693364	3300013004	Freshwater	MKDDDVEDLFAYGWLDTGIAIVLALAALVALSFFAGYLI*
Ga0164292_100172469	3300013005	Freshwater	MKDDEIEDLFAYGWIDTALAIVLALLALVALSFFAGYLI*
Ga0181363_10577301	3300017707	Freshwater Lake	DMKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAGYLT
Ga0181352_10182003	3300017747	Freshwater Lake	MKDDEVEDLFAYGWLDTAVAIILALLALVALSFFAGYLI
Ga0181352_11106691	3300017747	Freshwater Lake	MKDDDVEDLFAYGWLDTALAIVLALLALVALSFFAGYLI
Ga0181352_11740743	3300017747	Freshwater Lake	MKDDDVEDLFKYGWLDTAVAIAIALLAIAALFFMAGYLI
Ga0181344_10251363	3300017754	Freshwater Lake	MKDDEIEDLFKYGWLDTALAIVLALVALVALSFFAGYLT
Ga0181344_11262703	3300017754	Freshwater Lake	MKDDEIEDLFKYGWLDTAVAIAIALLAIAALFFMAGYLI
Ga0181344_11431913	3300017754	Freshwater Lake	MKDDEIEDLFEYGWLDTGIAIVLALLAIAALSFFAGYLS
Ga0181343_10231616	3300017766	Freshwater Lake	MKDDDVEDLFAYGWLDTAVAILLALLALVALSFFAGYLI
Ga0181553_104123983	3300018416	Salt Marsh	GMKDDEVENLFAYSWLDAAVAIAIALLAIVALFFMAGYLT
Ga0181563_105707213	3300018420	Salt Marsh	MKDDEVENLFAYSWLDAAVAIAIALLAIVALFFMAGYLT
Ga0181359_10888781	3300019784	Freshwater Lake	MKDDEIEDLFKYGWLDTSIAIVLALVALVALSFFAGYLT
Ga0211726_1037919814	3300020161	Freshwater	MKDDDENLFAYGWLDTAIAIILALCTLAAVFFALGYLL
Ga0208091_10186183	3300020506	Freshwater	MKDDDVEDLFAYGWLDTGIAIVLALLAIAALSFFAGYLT
Ga0208235_10176542	3300020530	Freshwater	MKDDEVENLFAYGWLDTALAIVLALLAIAALFFMAGYLS
Ga0207942_10035966	3300020549	Freshwater	MKDDEVEDLFAYGWLDTSIAIVLALLAIAALFFMAGYLT
Ga0207942_10188732	3300020549	Freshwater	MKDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLL
Ga0207942_10515531	3300020549	Freshwater	MKDDEVEGLFAWGWFDLALAVILTLLAIAALFFAAGYLI
Ga0208600_10645323	3300020550	Freshwater	MKDDEVENLFAYGWLDTALAIVLALLAIAALFFMAG
Ga0181353_10576633	3300022179	Freshwater Lake	MKDDDVEDLFKYGWLDTALAIVLALVALVALSFFAGYLT
Ga0181353_10688251	3300022179	Freshwater Lake	MKDDEIEDLFKYGWLDTAVAIVLALLAIAALFFMAGYLT
Ga0181353_10714971	3300022179	Freshwater Lake	MKDDEVENLFAYGWLDTSIAIVLALVALVALSFFAGYLT
Ga0214919_1000047951	3300023184	Freshwater	MKDDEVEDLFAYGWLDTAIAIVLALLAIAALFFFAGYLT
Ga0214919_1000759115	3300023184	Freshwater	MKDDEIENLFAYGWIDAAVAIAIALLALVALFFFAGYLT
Ga0214919_106536582	3300023184	Freshwater	MKDDEVENLFAYGWLDAAVAIVIALLAIVALFFMAGYLT
Ga0244776_102294203	3300024348	Estuarine	MKDDEIENLFKYSWLDAALAIALALIAMVSLFFLAGYLT
Ga0209615_10090210	3300025075	Freshwater	MKDDDEDLFKYGWLDTAISIILALCTLAAVFFALGYLL
Ga0208426_10069246	3300025451	Aqueous	MKDDEVENLFAYGWIDAAVAIAIALLALVALFFMAGYLT
Ga0208916_101336842	3300025896	Aqueous	MKDDEIENLFKYSWLDAALAIALALLALVSLFFLEGYLI
Ga0208916_102979212	3300025896	Aqueous	MKDDEIENLFKYGWIDASIAIAIALLALVALFFFAGYLT
Ga0209087_11578962	3300027734	Freshwater Lake	MKDDEVENLFAYSWLDAAVAIAIALLALVALFFMAGYLT
Ga0209087_13137991	3300027734	Freshwater Lake	MKDDEVEDLFKYGWIDASIAIAIALLALVALFFLAGYLT
Ga0209085_11906203	3300027741	Freshwater Lake	MKDDEVENLFAYGWLDAAISIAIALLALVALFFFARYLT
Ga0209084_100051415	3300027749	Freshwater Lake	MNDDNEEGLFAYSWMDFALAIVLTLLALAALFFLAGYLI
Ga0209084_11046552	3300027749	Freshwater Lake	MKDDEVENLFDYSWLDAAVAIVIALLALVALFFFARQLT
Ga0209596_12792743	3300027754	Freshwater Lake	MKDDDVEDLFKYGWLDATVAIVIALLAIVALFFFAGYLT
Ga0209596_12840083	3300027754	Freshwater Lake	MKDDEIENLFAYGWLDSGIAIVIALLAIVALFFFARYLT
Ga0209296_10053584	3300027759	Freshwater Lake	MKDDEVENLFAYSWLDAAVAIAIALLAIAALFFFAGYLT
Ga0209296_10981805	3300027759	Freshwater Lake	MKDDEIENLFKYGWLDAAVAIAIALLALVALFFAARYLT
Ga0209296_12769531	3300027759	Freshwater Lake	MKDDEVENLFAYGWIDAAVAIAIALLAIVALFFMAGYLT
Ga0209134_100816363	3300027764	Freshwater Lake	MKDDDVEDLFAYGWRDTGIAIVLALLAIAALFFMAGYLS
Ga0209229_100063316	3300027805	Freshwater And Sediment	MKDDEIEDLFKYGWLDTGIAIVLALLALVSLFFLEGYLT
Ga0209668_101329332	3300027899	Freshwater Lake Sediment	MKDDEVENLFAYGWLDTCIAIVLALLAIAALFFVAGYLT
Ga0209191_11445233	3300027969	Freshwater Lake	MKDDEVEDLFAWGWIKASIAIVIALLALVALFFAAGYLT
Ga0247723_11228462	3300028025	Deep Subsurface Sediment	MKDDDEDLFKYGWIDTALAIILTLLAMAALFFLAGYLI
Ga0334992_0064991_500_619	3300033992	Freshwater	MKDDDVEDLFAYGWIDTALAIVLALVALVALSFFAGYLT
Ga0334992_0093384_775_894	3300033992	Freshwater	MKDDEIEDLFKYGWIDASVAIGIALLAIVALFFAAGYLT
Ga0334992_0281263_581_700	3300033992	Freshwater	MKDDEVEDLFAYGWIDTSIAIVLALVALVALSFFAGYLI
Ga0334994_0002899_8350_8469	3300033993	Freshwater	MNDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLT
Ga0334994_0111423_1412_1531	3300033993	Freshwater	MKDDEVEGLFAWGWLDLALAVILTLLAIAALFFAAGYLT
Ga0334994_0422442_207_326	3300033993	Freshwater	MKDDDVEDLFAYGWLDTSIAIVLALLALVALSFFAGYLL
Ga0335003_0015886_1124_1243	3300033995	Freshwater	MKDDEVENLFAYGWLDTAVAIAIALLALVALFFMVGYLT
Ga0335003_0461056_329_448	3300033995	Freshwater	MKDDEIEDLFAYGWIDTALAIVLALLALVALSFFAGYLI
Ga0334979_0008964_6734_6853	3300033996	Freshwater	MKDDDVEDLFAYGWLDTALAIVLALVALVALSFFAGYLI
Ga0334979_0033748_3247_3366	3300033996	Freshwater	MKDDEVENLFAYGWLDTAVAIVLALLALVALSFFAGYLI
Ga0334979_0103011_662_781	3300033996	Freshwater	MKDDEVENLFAYGWLDTGIAIVLALLALVSLFFLEGYLT
Ga0334979_0196436_250_369	3300033996	Freshwater	MKDDEIEDLFAYGWLDTALAIVLALLALVALSFFAGYLT
Ga0334979_0269928_807_926	3300033996	Freshwater	MKDDEVENLFAYGWLDTALAIVLALLALVALSFFAGYLT
Ga0334979_0420238_532_651	3300033996	Freshwater	MKDDDVEDLFAYGWLDTGIAIVLALAALVALSFFAGYLI
Ga0334986_0024240_247_366	3300034012	Freshwater	MKDDEVENLFAYGWLDTAVAIVLALLALVALSFFAGYLT
Ga0335005_0017272_422_541	3300034022	Freshwater	MKDDEVENLFAYGWIDTALAIVLALLAIAAIFFMAGYLT
Ga0334983_0120698_1011_1130	3300034060	Freshwater	MKDDEVEDLFAYGWLDTALAIVLALLALVALSFFAGYLT
Ga0334990_0072893_1065_1184	3300034068	Freshwater	MKDDDVENLFKYGWLDTSIAIVLALLALVALFFMAGYLT
Ga0335020_0021558_2396_2515	3300034082	Freshwater	MKDDEVENLFAYGWLDTAIAIVLALLAIAALFFMAGYLT
Ga0335020_0452957_55_174	3300034082	Freshwater	MKDDDVEDLFAYGWIDTALAIVLALVALVALSFFAGYLI
Ga0335012_0217116_791_910	3300034093	Freshwater	MKDDEIEDLFKYGWLDTGIAIVLALVALVALSFFAGYLT
Ga0335012_0239316_536_655	3300034093	Freshwater	MKDDDVEDLFAYGWLDTAVAIVLALLALVALSFFAGYLI
Ga0335012_0470935_75_194	3300034093	Freshwater	MKDDEVENLFKYSWLDAALAIALALLAIAALFFMAGYLI
Ga0335022_0044558_871_990	3300034095	Freshwater	MKDDDVEDLFAYGWIDTAVAIVLALLALVALFFMAGYLT
Ga0335022_0121500_1537_1644	3300034095	Freshwater	DVEDLFAYGWLDTSIAIVLALLAIAALFFMAGYLT
Ga0335031_0132736_1445_1564	3300034104	Freshwater	MKDDEIEDLFAYGWLDTAVAIFLALLALVALFFMAGYLT
Ga0335031_0135267_125_241	3300034104	Freshwater	MKDDEVGLFAWGWLDLALAVILTLLAIAALFFAAGYLL
Ga0335037_0169176_259_378	3300034107	Freshwater	MKDDDVEDLFAYGWIDTSVAIAVALLALVALFFMVGYLT
Ga0335033_0034861_3065_3169	3300034117	Freshwater	MKDDEIEDLFKYGWIDASVAIGIALLAIVALFFAA
Ga0335017_0003249_5655_5774	3300034167	Freshwater	MKDDDVEDLFKYGWIDASIAIAIALLAIAAIFFMAGYLT
Ga0335065_0420718_701_814	3300034200	Freshwater	DDEVEDLFAYGWLDTALAIVLALLALVALSFFAGYLT
Ga0335007_0182602_228_347	3300034283	Freshwater	MKDDEIEDLFKYGWIDTALAIVLALVAIAAIFFMAGYLT
Ga0335048_0443075_117_236	3300034356	Freshwater	MKDDDVEDLFAYGWLDTAVAIVLALLAIAALFFMAGYLL
Ga0335064_0024026_3091_3210	3300034357	Freshwater	MKDDEVENLFAYGWLDTAVAIVLALLALVALFFMAGYLT

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F056421

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences