NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056426

Metagenome Family F056426

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056426
Family Type Metagenome
Number of Sequences 137
Average Sequence Length 48 residues
Representative Sequence PSREGMEQIVKSLQLLGQFTGRKVAFEEVADARIAREVAKELGYKVD
Number of Associated Samples 122
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.84 %
% of genes near scaffold ends (potentially truncated) 91.97 %
% of genes from short scaffolds (< 2000 bps) 91.24 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.350 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(9.489 % of family members)
Environment Ontology (ENVO) Unclassified
(30.657 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.226 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.00%    β-sheet: 0.00%    Coil/Unstructured: 64.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF09084NMT1 36.50
PF00291PALP 4.38
PF07883Cupin_2 2.92
PF03591AzlC 2.92
PF07331TctB 2.19
PF00753Lactamase_B 2.19
PF01494FAD_binding_3 1.46
PF01970TctA 1.46
PF03401TctC 0.73
PF00400WD40 0.73
PF01627Hpt 0.73
PF00535Glycos_transf_2 0.73
PF02615Ldh_2 0.73
PF02900LigB 0.73
PF01609DDE_Tnp_1 0.73
PF04909Amidohydro_2 0.73
PF07746LigA 0.73
PF13185GAF_2 0.73
PF05437AzlD 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 36.50
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 36.50
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 2.92
COG1296Predicted branched-chain amino acid permease (azaleucine resistance)Amino acid transport and metabolism [E] 2.92
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.46
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.46
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.46
COG1784TctA family transporterGeneral function prediction only [R] 1.46
COG3333TctA family transporterGeneral function prediction only [R] 1.46
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 0.73
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.73
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.73
COG3293TransposaseMobilome: prophages, transposons [X] 0.73
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.73
COG5421TransposaseMobilome: prophages, transposons [X] 0.73
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.73
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.35 %
UnclassifiedrootN/A3.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000655|AF_2010_repII_A100DRAFT_1101591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300000789|JGI1027J11758_12343464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium746Open in IMG/M
3300000891|JGI10214J12806_13190816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300000955|JGI1027J12803_104500277All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300000956|JGI10216J12902_100078282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300002123|C687J26634_10078397All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1202Open in IMG/M
3300003997|Ga0055466_10033111All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300003997|Ga0055466_10227499Not Available557Open in IMG/M
3300004019|Ga0055439_10059794All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300005174|Ga0066680_10641412All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300005178|Ga0066688_10622292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium693Open in IMG/M
3300005180|Ga0066685_10222244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1299Open in IMG/M
3300005332|Ga0066388_105732527Not Available628Open in IMG/M
3300005335|Ga0070666_10280432All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300005451|Ga0066681_10274486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1027Open in IMG/M
3300005467|Ga0070706_101152473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300005471|Ga0070698_101548114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300005535|Ga0070684_101021063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium776Open in IMG/M
3300005563|Ga0068855_100335443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1668Open in IMG/M
3300005713|Ga0066905_102065908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300006049|Ga0075417_10434349All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006804|Ga0079221_10032099All Organisms → cellular organisms → Bacteria → Proteobacteria2234Open in IMG/M
3300006845|Ga0075421_100901655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1009Open in IMG/M
3300006853|Ga0075420_101511432All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300006871|Ga0075434_100633127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1088Open in IMG/M
3300006880|Ga0075429_100736450All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300006904|Ga0075424_100344737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1587Open in IMG/M
3300006904|Ga0075424_102684981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300006969|Ga0075419_10836355All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300009094|Ga0111539_10102225All Organisms → cellular organisms → Bacteria3364Open in IMG/M
3300009100|Ga0075418_12410773All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009100|Ga0075418_12708741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300009157|Ga0105092_10016256All Organisms → cellular organisms → Bacteria3913Open in IMG/M
3300009157|Ga0105092_10297440All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300009162|Ga0075423_10198649All Organisms → cellular organisms → Bacteria2104Open in IMG/M
3300009167|Ga0113563_10607985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1212Open in IMG/M
3300009168|Ga0105104_10688253All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009610|Ga0105340_1456863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria571Open in IMG/M
3300009792|Ga0126374_10114122All Organisms → cellular organisms → Bacteria → Proteobacteria1564Open in IMG/M
3300009810|Ga0105088_1050911All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300010047|Ga0126382_10237104All Organisms → cellular organisms → Bacteria → Proteobacteria1326Open in IMG/M
3300010047|Ga0126382_11042336All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300010304|Ga0134088_10370700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300010359|Ga0126376_11219321All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300010359|Ga0126376_12575630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300010360|Ga0126372_12755986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300010362|Ga0126377_10836232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium981Open in IMG/M
3300010362|Ga0126377_12299125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300010375|Ga0105239_13417785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300010397|Ga0134124_10109800All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300010403|Ga0134123_12548725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300012022|Ga0120191_10047889All Organisms → cellular organisms → Bacteria → Proteobacteria734Open in IMG/M
3300012174|Ga0137338_1060306All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300012174|Ga0137338_1096162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300012203|Ga0137399_11317506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300012355|Ga0137369_11082323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300012361|Ga0137360_10867268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium778Open in IMG/M
3300012483|Ga0157337_1010163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium723Open in IMG/M
3300012519|Ga0157352_1025394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300012676|Ga0137341_1067014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium599Open in IMG/M
3300012685|Ga0137397_10709467All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300012918|Ga0137396_10089177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2185Open in IMG/M
3300012923|Ga0137359_10830789All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300012927|Ga0137416_10020377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4224Open in IMG/M
3300012930|Ga0137407_10589618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1043Open in IMG/M
3300012931|Ga0153915_11540871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium777Open in IMG/M
3300012971|Ga0126369_13518396All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300012977|Ga0134087_10413588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300012987|Ga0164307_11877102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300013105|Ga0157369_11641522Not Available653Open in IMG/M
3300014262|Ga0075301_1116342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300014268|Ga0075309_1076285All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300014296|Ga0075344_1021310All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300014320|Ga0075342_1198337All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300014870|Ga0180080_1089177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300014883|Ga0180086_1113753All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300015262|Ga0182007_10370612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300015371|Ga0132258_13815064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1026Open in IMG/M
3300015372|Ga0132256_101673790All Organisms → cellular organisms → Bacteria → Proteobacteria746Open in IMG/M
3300015372|Ga0132256_101987783All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300015373|Ga0132257_101746688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium798Open in IMG/M
3300015373|Ga0132257_102386220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300015374|Ga0132255_103047062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300016371|Ga0182034_10077117All Organisms → cellular organisms → Bacteria → Proteobacteria2309Open in IMG/M
3300018052|Ga0184638_1065274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1331Open in IMG/M
3300018071|Ga0184618_10190917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300018072|Ga0184635_10030047All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2036Open in IMG/M
3300018076|Ga0184609_10327481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium716Open in IMG/M
3300018076|Ga0184609_10390634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300018077|Ga0184633_10067593All Organisms → cellular organisms → Bacteria1830Open in IMG/M
3300018078|Ga0184612_10076915All Organisms → cellular organisms → Bacteria → Proteobacteria1741Open in IMG/M
3300018079|Ga0184627_10607199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300018084|Ga0184629_10006473All Organisms → cellular organisms → Bacteria → Proteobacteria4405Open in IMG/M
3300018084|Ga0184629_10085886All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300018422|Ga0190265_10415072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1446Open in IMG/M
3300018422|Ga0190265_13105097All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018433|Ga0066667_11310594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300018469|Ga0190270_11300933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium770Open in IMG/M
3300019377|Ga0190264_11625742All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300019881|Ga0193707_1157343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300019882|Ga0193713_1088172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium870Open in IMG/M
3300020006|Ga0193735_1047029All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1290Open in IMG/M
3300021178|Ga0210408_11164446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300025002|Ga0209001_1082848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300025164|Ga0209521_10377257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300025167|Ga0209642_10595490All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium602Open in IMG/M
3300025174|Ga0209324_10121973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1780Open in IMG/M
3300025289|Ga0209002_10667250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300025318|Ga0209519_10107445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1642Open in IMG/M
3300025326|Ga0209342_10276482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1467Open in IMG/M
3300025558|Ga0210139_1030635All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300025910|Ga0207684_10346793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1278Open in IMG/M
3300025910|Ga0207684_10921865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium734Open in IMG/M
3300025917|Ga0207660_11496186All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300025922|Ga0207646_10698965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium907Open in IMG/M
3300025923|Ga0207681_11074161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium676Open in IMG/M
3300025930|Ga0207701_10626147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium915Open in IMG/M
3300025937|Ga0207669_11310577Not Available615Open in IMG/M
3300026075|Ga0207708_11174123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300027163|Ga0209878_1051435All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300027511|Ga0209843_1012525All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300027787|Ga0209074_10122178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium906Open in IMG/M
3300027873|Ga0209814_10175760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium922Open in IMG/M
3300027876|Ga0209974_10164803Not Available806Open in IMG/M
3300028536|Ga0137415_10076474All Organisms → cellular organisms → Bacteria3207Open in IMG/M
3300028784|Ga0307282_10147090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1114Open in IMG/M
3300028807|Ga0307305_10184474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium961Open in IMG/M
3300030620|Ga0302046_11488885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300031170|Ga0307498_10074293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium987Open in IMG/M
3300031229|Ga0299913_10584232All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300031716|Ga0310813_10207259All Organisms → cellular organisms → Bacteria → Proteobacteria1611Open in IMG/M
3300031720|Ga0307469_10947244All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300031720|Ga0307469_11780585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300033433|Ga0326726_12364766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300033551|Ga0247830_11384921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300034164|Ga0364940_0027306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1470Open in IMG/M
3300034417|Ga0364941_003030All Organisms → cellular organisms → Bacteria → Proteobacteria2746Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.49%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.84%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.65%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.19%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.19%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.46%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.46%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.46%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.46%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.46%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.73%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.73%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.73%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.73%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.73%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.73%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.73%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.73%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002123Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012676Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300025002Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes)EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A100DRAFT_110159123300000655Forest SoilIKSLQMLGQFTGKKIAFDEVADPRIAREVARELGYKVD*
JGI1027J11758_1234346423300000789SoilIEQIVKSLQLLGQFGGRKIAFEDVADAQIAREVAKELGYKIE*
JGI10214J12806_1319081633300000891SoilIVKSLQLLGQFTGKKIPLEEIADVRIAREVAKELGYKID*
JGI1027J12803_10450027713300000955SoilSGSGVPKREGMEQIVKSLQLTGQFTGKKVGFEEIADARIAAEVAKELGYKVE*
JGI10216J12902_10007828233300000956SoilGSGVPSREGMEQIVKSLQMLGQFTGKKVAFEEIADARIAREVAKELGYKVD*
C687J26634_1007839733300002123SoilMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVAKELGYKID*
Ga0055466_1003311113300003997Natural And Restored WetlandsGMEQIIKSLQMLGQFTGKKIPMEEVADTKVAREVATELGYKVE*
Ga0055466_1022749913300003997Natural And Restored WetlandsRSAAGNGVPSRAGMEQIVKSLQMLGQFAGKKIPMEEVADTKVAREVAKELGYKVD*
Ga0055439_1005979423300004019Natural And Restored WetlandsMRPQAANAASASREGMEQIVKSLQLLGQFTGRKVAFEEIVDARIAREVAKELGYKVD*
Ga0066680_1064141213300005174SoilREGMEQIVKSLQMLGQFTGKKIAFEEVADARIAREVAKELGYKVD*
Ga0066688_1062229213300005178SoilVKSLQLLGQFVGRNVTFDEIADPRIAREVARELGYKVDL*
Ga0066685_1022224413300005180SoilYQKTVSGNGVPSREGVEQIVKSLQLLGSSAAGIAFEDVADARIAREVAKELGYKVE*
Ga0066388_10573252713300005332Tropical Forest SoilKTINGSGVPSREGIEQIIRSLQLLGQFPGRKVAFEEVADARIAREVAKELGYNVE*
Ga0070666_1028043223300005335Switchgrass RhizosphereEGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD*
Ga0066681_1027448613300005451SoilTVSGNGVPSRDGIEQIVKSLQLLGQFTGRKTAFEEVADARISREVAKELGYKVE*
Ga0070706_10115247323300005467Corn, Switchgrass And Miscanthus RhizosphereSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEIADARIAREVAKELGYKVD*
Ga0070698_10154811423300005471Corn, Switchgrass And Miscanthus RhizospherePSREGMEQIVKSLQMLGQFAGKKIPLEEIADTRIAREVAKELGYKID*
Ga0070684_10102106313300005535Corn RhizosphereAAAGNGVPSREGMEQIVKSLQMLGQFTGKKIPFEEIADARVSREVAKELGYKID*
Ga0068855_10033544313300005563Corn RhizosphereGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVD*
Ga0066905_10206590813300005713Tropical Forest SoilQLLGQFTGKKIAFEEVADPRIAREVARELGYKVD*
Ga0075417_1043434923300006049Populus RhizosphereNRRSASGNGVPSREGIEQIVKSLQMLGQFAGRKIPLEEIADTRIARDVAKELGYKVD*
Ga0079221_1003209933300006804Agricultural SoilMEQIVKSLQLLGQFTGRKIAFEEIADGQIAREVAKELGYKVD*
Ga0075421_10090165513300006845Populus RhizosphereSLQLLGQFTGKKIAFEEITDTRIARAVAKELGYKEN*
Ga0075420_10151143213300006853Populus RhizosphereSGSGVPSREGMQQIVKSLQLLGQFTGKKVAFEEIADARIAREIAKELGYRVE*
Ga0075434_10063312713300006871Populus RhizosphereGNGVPSREGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE*
Ga0075429_10073645013300006880Populus RhizosphereSLQLLGQFTGKKVAFEEIADARIAREIAKELGYRVE*
Ga0075424_10034473713300006904Populus RhizosphereTVSGNGVPSREGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKAE*
Ga0075424_10268498113300006904Populus RhizosphereVPSREGIEQIVKALQLLGQFSGRKVSFDEVADARIAREVAKELGYKVD*
Ga0075419_1083635513300006969Populus RhizosphereAEDTFVDYQKTVSGNGVPSREGIEQIVKSLQLLGQFVGRKVGFEEVADARIAREVAKELGYKIE*
Ga0111539_1010222543300009094Populus RhizosphereEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD*
Ga0075418_1241077313300009100Populus RhizosphereQIVKSLQLLGQFTGKKVAFEEIADARIAREIAKELGYRVE*
Ga0075418_1270874123300009100Populus RhizospherePSREGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE*
Ga0105092_1001625653300009157Freshwater SedimentPLLGQFTGKKVAFEEVADPRIAREVARELGYRVE*
Ga0105092_1029744013300009157Freshwater SedimentKSLQLLGQFTGKKVGFEEVADPRIASEVAKELGYKVD*
Ga0075423_1019864933300009162Populus RhizosphereQIVKSLQLLGQFTGKKVAFEEIADARIAREVARELGYKVD*
Ga0113563_1060798513300009167Freshwater WetlandsEQIVKSLQMLGQFTGRKIAFEEIADARIAREVARELGYKID*
Ga0105104_1068825313300009168Freshwater SedimentREGMEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD*
Ga0105340_145686313300009610SoilGIAQIVKSLQMLGQFTGRKIGFEEVADARIAREVAKELGYKVD*
Ga0126374_1011412223300009792Tropical Forest SoilFEDYRKTSSGSGVPSRKGMEEIIKSLQLLGQFTGKKIAFEEVADPRIAREVARELGYKVD
Ga0105088_105091113300009810Groundwater SandMEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD*
Ga0126382_1023710413300010047Tropical Forest SoilSGSGVPSRKGMEEIIKSLQLLGQFTGKKIGFEEVADPRIAREVARELGYKMD*
Ga0126382_1104233623300010047Tropical Forest SoilTSSGSGVPSRKGMEEIIKSLQLLGQFTGKKIAFDEVADPRIAREVARELGYKVD*
Ga0134088_1037070013300010304Grasslands SoilEGIEQIVKSLQLLGQFGGRKIAFDEVADARIAREVAKELGYNVE*
Ga0126376_1121932113300010359Tropical Forest SoilGVPSRKGMEEIIKLLQLLGQFTGKKIAFEEVADPRIAREVARELSYKVD*
Ga0126376_1257563023300010359Tropical Forest SoilRKGMEEIIKSLQMLGQFTGKKIAFEEVADPRIAREVARELGYKVD*
Ga0126372_1275598613300010360Tropical Forest SoilEIIKSLQLLGQFTGKKIAYEEVADPRIAREVARELGYKVD*
Ga0126377_1083623213300010362Tropical Forest SoilKTVSGNGVPSREGVEQIIKSLQLLGQFTGRKITFEEVADARIAREVAKELGYKVEKE*
Ga0126377_1229912523300010362Tropical Forest SoilEDSFEDYRKTSSGSGVPSRKGMEEIIKSLQMLGQFTGKKIAFDEVADPRIAREVARELGYKVD*
Ga0105239_1341778513300010375Corn RhizosphereKSLQMLGQFTGKKIPFEEITDIRLAREVAKELGYKVD*
Ga0134124_1010980013300010397Terrestrial SoilQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVD*
Ga0134123_1254872513300010403Terrestrial SoilLQLLGQFTGKKIPLEEIADVRIAREVAKELGYKID*
Ga0120191_1004788923300012022TerrestrialMEQIVKSLQLLGQFTGKKVAFEEVFDPRIAREVARELGYRVE*
Ga0137338_106030623300012174SoilTDYQKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKIAFEEIADARIAREVARELGYKIE*
Ga0137338_109616213300012174SoilTISGNGVPTREGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD*
Ga0137399_1131750613300012203Vadose Zone SoilDYQKTVSGNGVPSPEGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE*
Ga0137369_1108232323300012355Vadose Zone SoilGVPSRDGIEQIVKSLQLLGQFGGRKVAFEDVADARIAREVAKELGYKVE*
Ga0137360_1086726823300012361Vadose Zone SoilEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE*
Ga0157337_101016313300012483Arabidopsis RhizosphereMFADNRRSAAGNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD*
Ga0157352_102539423300012519Unplanted SoilFVDYQKTVSGNGVPSRDGIEQIVKSLQLLGQFVGRKVGFEEVADARIAREVAKELGYKIE
Ga0137341_106701413300012676SoilKSVQLLGQFPGRKIAFEEVADARISREVAKELGYKVD*
Ga0137397_1070946713300012685Vadose Zone SoilSGVMPSSVPSRDGIEQIVKSLQLLGQFVGRKVGFEEVADARIAREVAKELGYKNE*
Ga0137396_1008917733300012918Vadose Zone SoilSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD*
Ga0137359_1083078923300012923Vadose Zone SoilPSREGMEQIVKSLQLLGQFTGRKVAFEEVADARIAREVAKELGYKVD*
Ga0137416_1002037713300012927Vadose Zone SoilVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD*
Ga0137407_1058961823300012930Vadose Zone SoilEGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE*
Ga0153915_1154087123300012931Freshwater WetlandsGMEQIVKSLQMLGQFAGKKIAFEEIAATLIARDVGKELGYKVE*
Ga0126369_1351839623300012971Tropical Forest SoilPSREGMEQIVKSLQLLGQFVGRKVGFEEIADARIAREVAKELGYKID*
Ga0134087_1041358813300012977Grasslands SoilFIDYQKTVSGNGVPSREGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE
Ga0164307_1187710213300012987SoilSREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD*
Ga0157369_1164152223300013105Corn RhizosphereENRRSAAGNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVE*
Ga0075301_111634213300014262Natural And Restored WetlandsVEKIQMRPQAANAASASREGMEQIVKSLQLLGQFTGRKVAFEEIVDARIAREVAKELGYKVD*
Ga0075309_107628513300014268Natural And Restored WetlandsIVKSLQMLGQFTGKKIAFEEIADVRIAREVAKELGYKAE*
Ga0075344_102131013300014296Natural And Restored WetlandsDSYVDYRKTSSGNGVPTREGMEQIVKALQLLGQFTGKKIAFEEIADPRIASEVAKELGYKVE*
Ga0075342_119833713300014320Natural And Restored WetlandsMEQIVKSLQLLGQFAGRKVAFEEIADARIAKEVARELGYKVD*
Ga0180080_108917713300014870SoilIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD*
Ga0180086_111375323300014883SoilVPSREGMEQIVKSLQMLGQFTGKKIAFEEIADPRFAREVAKELGYKIN*
Ga0182007_1037061213300015262RhizosphereKSLQLLGQFTGKKIAFEEIADTRIARAVAKELGYKEN*
Ga0132258_1381506413300015371Arabidopsis RhizosphereSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE*
Ga0132256_10167379023300015372Arabidopsis RhizosphereGNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEIADGQIAREVGKELGYKVD*
Ga0132256_10198778333300015372Arabidopsis RhizosphereKSLQLLGQFTGRKNAFEEITDARNARDVAKELGYKVD*
Ga0132257_10174668813300015373Arabidopsis RhizosphereMFADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKID*
Ga0132257_10238622013300015373Arabidopsis RhizosphereMFADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRVAREVAKELGYKID*
Ga0132255_10304706213300015374Arabidopsis RhizosphereNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEITDTRIARDVAKELGYKVD*
Ga0182034_1007711713300016371SoilSREGMEQIVKALQLLGQFTGRKVAFEEVADARIAREVAKELGYKVD
Ga0184638_106527413300018052Groundwater SedimentASGNGVPSREGMEQIVKSLQLLGQFTGKKIAFEEITDTRIAREVAKELGYKLD
Ga0184618_1019091723300018071Groundwater SedimentGNGVPSREGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE
Ga0184635_1003004713300018072Groundwater SedimentAFGEYRKTISGNGVPTREGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKV
Ga0184609_1032748123300018076Groundwater SedimentVKSLQMLGQFGGRKIAFEDVADARIAREVAKELGYKVE
Ga0184609_1039063413300018076Groundwater SedimentEGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD
Ga0184633_1006759333300018077Groundwater SedimentSLQLLGQFAGRKIPLEEIADTRIAREVAKELDYKID
Ga0184612_1007691513300018078Groundwater SedimentRKTSSGSGVPSREGMEQIVKSLQLLGQFTGKKVAFEEIADARIAREVARELGYKVE
Ga0184627_1060719913300018079Groundwater SedimentGNGVPSREGIEQIVKSLQLLGQFVGRKVAFEEVADARIAREVAKELGYKVE
Ga0184629_1000647313300018084Groundwater SedimentREGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD
Ga0184629_1008588613300018084Groundwater SedimentIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD
Ga0190265_1041507233300018422SoilLQLLGQFTGKKIPFDEITDTRIAREVAKELGYKID
Ga0190265_1310509723300018422SoilREGIEQIVKSLQMLGQFTGKKIAFEEIADARFAREVAKELGYKIN
Ga0066667_1131059413300018433Grasslands SoilNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0190270_1130093323300018469SoilFTDYQKTVSGNGVPSREGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKIE
Ga0190264_1162574223300019377SoilGVPSREGMEQIFKSLQLLGQFTGKKIPFDEITDTRIAREVAKELGYKVD
Ga0193707_115734313300019881SoilADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0193713_108817223300019882SoilSGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0193735_104702933300020006SoilLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0210408_1116444623300021178SoilSYADYRKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEITDPRLAREVAKELGYKV
Ga0209001_108284813300025002SoilKSLQMLGQFTGKKIAFEEIADVRIAREVAKELGYKAE
Ga0209521_1037725723300025164SoilEGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKID
Ga0209642_1059549013300025167SoilGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKID
Ga0209324_1012197313300025174SoilSGSGVPTREGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKID
Ga0209002_1066725023300025289SoilSLQMLGQFTGKKIAFEEIADVRIAREVAKELGYKAE
Ga0209519_1010744513300025318SoilREGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVAKELGYKID
Ga0209342_1027648233300025326SoilGVPTREGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKTD
Ga0210139_103063523300025558Natural And Restored WetlandsMRPQAANAASASREGMEQIVKSLQLLGQFTGRKVAFEEIVDARIAREVAKELGYKVD
Ga0207684_1034679313300025910Corn, Switchgrass And Miscanthus RhizosphereSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEITDSRLAREVAKELGYKVD
Ga0207684_1092186513300025910Corn, Switchgrass And Miscanthus RhizosphereDYRKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEIADARIAREVAKELGYKVD
Ga0207660_1149618623300025917Corn RhizosphereDMFADNRRAAAGNGVPSREGMEQIVKSLQMLGQFTGKKIPFEEIADARVSREVAKELGYKID
Ga0207646_1069896523300025922Corn, Switchgrass And Miscanthus RhizosphereSYADYRKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEIADARIAREVAKELGYKV
Ga0207681_1107416123300025923Switchgrass RhizosphereMFADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKI
Ga0207701_1062614723300025930Corn, Switchgrass And Miscanthus RhizosphereREGMEQIVKSLQMLGQFTGKKIAFEEITDTRVAREVAKELGYKVD
Ga0207669_1131057723300025937Miscanthus RhizosphereNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD
Ga0207708_1117412313300026075Corn, Switchgrass And Miscanthus RhizosphereADNEKSSAGNGVPSREGMDQIVKSLQMLGQFTGKKIPFEEITDIRLAREVAKELGYKVD
Ga0209878_105143513300027163Groundwater SandSGSGVPTREGMEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD
Ga0209843_101252523300027511Groundwater SandMEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD
Ga0209074_1012217823300027787Agricultural SoilAAGNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD
Ga0209814_1017576013300027873Populus RhizospherePSREGVEQIVKSLQLLGQFGGRKVAFDEVADARIAREVAKELGYKVE
Ga0209974_1016480313300027876Arabidopsis Thaliana RhizosphereDEMFAENRRSAAGNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVD
Ga0137415_1007647413300028536Vadose Zone SoilVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0307282_1014709023300028784SoilGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0307305_1018447423300028807SoilREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD
Ga0302046_1148888523300030620SoilADNRRSAAGNGVPSRAGMEQIVKSLQMLGQFTGKQIAFEEITDPRIAREVAKELGY
Ga0307498_1007429313300031170SoilEMFADNRRSASGNGVPSREGMEQIVKSLQMLGQFSGKKIPFEKITDTRIAREVAKELGYKVD
Ga0299913_1058423213300031229SoilNRRGAAGNGVPSREGIEQIVKSLQMLGQFTGKKIAFEEIADARIAREVAKELGYKAE
Ga0310813_1020725913300031716SoilAAGNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD
Ga0307469_1094724413300031720Hardwood Forest SoilSREGMEQIVKSLQMLGQFTGKKVAFEEIADARIAREVARELGYKVD
Ga0307469_1178058523300031720Hardwood Forest SoilQIVKSLQMLGQFTGKKVAFEEIADARIAREVAKELGYKVD
Ga0326726_1236476613300033433Peat SoilPSYEGIEQIVKSLQSLGQFAGRKVAFEEVADDRLAKEVARELGYKVE
Ga0247830_1138492113300033551SoilGMEQIIKSLQLLGQFTGRKISIDEIADTRIAREVAKELGYKVE
Ga0364940_0027306_1311_14693300034164SedimentSGSGVPSREGMEQIVKSLQLLGQFTGRKIAFEEIADARIAREVARELGYKID
Ga0364941_003030_2590_27183300034417SedimentMEQIVKSLQMLGQFTGKKVAFEEIADARIAREVARELGHKVD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.