Basic Information | |
---|---|
Family ID | F056426 |
Family Type | Metagenome |
Number of Sequences | 137 |
Average Sequence Length | 48 residues |
Representative Sequence | PSREGMEQIVKSLQLLGQFTGRKVAFEEVADARIAREVAKELGYKVD |
Number of Associated Samples | 122 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.84 % |
% of genes near scaffold ends (potentially truncated) | 91.97 % |
% of genes from short scaffolds (< 2000 bps) | 91.24 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.350 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.489 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.657 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.226 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.00% β-sheet: 0.00% Coil/Unstructured: 64.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF09084 | NMT1 | 36.50 |
PF00291 | PALP | 4.38 |
PF07883 | Cupin_2 | 2.92 |
PF03591 | AzlC | 2.92 |
PF07331 | TctB | 2.19 |
PF00753 | Lactamase_B | 2.19 |
PF01494 | FAD_binding_3 | 1.46 |
PF01970 | TctA | 1.46 |
PF03401 | TctC | 0.73 |
PF00400 | WD40 | 0.73 |
PF01627 | Hpt | 0.73 |
PF00535 | Glycos_transf_2 | 0.73 |
PF02615 | Ldh_2 | 0.73 |
PF02900 | LigB | 0.73 |
PF01609 | DDE_Tnp_1 | 0.73 |
PF04909 | Amidohydro_2 | 0.73 |
PF07746 | LigA | 0.73 |
PF13185 | GAF_2 | 0.73 |
PF05437 | AzlD | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 36.50 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 36.50 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.92 |
COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 2.92 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.46 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.46 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.46 |
COG1784 | TctA family transporter | General function prediction only [R] | 1.46 |
COG3333 | TctA family transporter | General function prediction only [R] | 1.46 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.73 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.73 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.73 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.73 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.73 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.73 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.35 % |
Unclassified | root | N/A | 3.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000655|AF_2010_repII_A100DRAFT_1101591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
3300000789|JGI1027J11758_12343464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
3300000891|JGI10214J12806_13190816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300000955|JGI1027J12803_104500277 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300000956|JGI10216J12902_100078282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 550 | Open in IMG/M |
3300002123|C687J26634_10078397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1202 | Open in IMG/M |
3300003997|Ga0055466_10033111 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300003997|Ga0055466_10227499 | Not Available | 557 | Open in IMG/M |
3300004019|Ga0055439_10059794 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300005174|Ga0066680_10641412 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005178|Ga0066688_10622292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
3300005180|Ga0066685_10222244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1299 | Open in IMG/M |
3300005332|Ga0066388_105732527 | Not Available | 628 | Open in IMG/M |
3300005335|Ga0070666_10280432 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300005451|Ga0066681_10274486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1027 | Open in IMG/M |
3300005467|Ga0070706_101152473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 713 | Open in IMG/M |
3300005471|Ga0070698_101548114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300005535|Ga0070684_101021063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
3300005563|Ga0068855_100335443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1668 | Open in IMG/M |
3300005713|Ga0066905_102065908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
3300006049|Ga0075417_10434349 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006804|Ga0079221_10032099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2234 | Open in IMG/M |
3300006845|Ga0075421_100901655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1009 | Open in IMG/M |
3300006853|Ga0075420_101511432 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300006871|Ga0075434_100633127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1088 | Open in IMG/M |
3300006880|Ga0075429_100736450 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300006904|Ga0075424_100344737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1587 | Open in IMG/M |
3300006904|Ga0075424_102684981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300006969|Ga0075419_10836355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
3300009094|Ga0111539_10102225 | All Organisms → cellular organisms → Bacteria | 3364 | Open in IMG/M |
3300009100|Ga0075418_12410773 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300009100|Ga0075418_12708741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
3300009157|Ga0105092_10016256 | All Organisms → cellular organisms → Bacteria | 3913 | Open in IMG/M |
3300009157|Ga0105092_10297440 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300009162|Ga0075423_10198649 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
3300009167|Ga0113563_10607985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1212 | Open in IMG/M |
3300009168|Ga0105104_10688253 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300009610|Ga0105340_1456863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 571 | Open in IMG/M |
3300009792|Ga0126374_10114122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1564 | Open in IMG/M |
3300009810|Ga0105088_1050911 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300010047|Ga0126382_10237104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
3300010047|Ga0126382_11042336 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300010304|Ga0134088_10370700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 696 | Open in IMG/M |
3300010359|Ga0126376_11219321 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300010359|Ga0126376_12575630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
3300010360|Ga0126372_12755986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300010362|Ga0126377_10836232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 981 | Open in IMG/M |
3300010362|Ga0126377_12299125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300010375|Ga0105239_13417785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300010397|Ga0134124_10109800 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
3300010403|Ga0134123_12548725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
3300012022|Ga0120191_10047889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
3300012174|Ga0137338_1060306 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300012174|Ga0137338_1096162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300012203|Ga0137399_11317506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300012355|Ga0137369_11082323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300012361|Ga0137360_10867268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
3300012483|Ga0157337_1010163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
3300012519|Ga0157352_1025394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
3300012676|Ga0137341_1067014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 599 | Open in IMG/M |
3300012685|Ga0137397_10709467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 747 | Open in IMG/M |
3300012918|Ga0137396_10089177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2185 | Open in IMG/M |
3300012923|Ga0137359_10830789 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300012927|Ga0137416_10020377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4224 | Open in IMG/M |
3300012930|Ga0137407_10589618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1043 | Open in IMG/M |
3300012931|Ga0153915_11540871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 777 | Open in IMG/M |
3300012971|Ga0126369_13518396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300012977|Ga0134087_10413588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
3300012987|Ga0164307_11877102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
3300013105|Ga0157369_11641522 | Not Available | 653 | Open in IMG/M |
3300014262|Ga0075301_1116342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
3300014268|Ga0075309_1076285 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300014296|Ga0075344_1021310 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300014320|Ga0075342_1198337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
3300014870|Ga0180080_1089177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300014883|Ga0180086_1113753 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300015262|Ga0182007_10370612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
3300015371|Ga0132258_13815064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1026 | Open in IMG/M |
3300015372|Ga0132256_101673790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
3300015372|Ga0132256_101987783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
3300015373|Ga0132257_101746688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 798 | Open in IMG/M |
3300015373|Ga0132257_102386220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 686 | Open in IMG/M |
3300015374|Ga0132255_103047062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
3300016371|Ga0182034_10077117 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2309 | Open in IMG/M |
3300018052|Ga0184638_1065274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1331 | Open in IMG/M |
3300018071|Ga0184618_10190917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 853 | Open in IMG/M |
3300018072|Ga0184635_10030047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2036 | Open in IMG/M |
3300018076|Ga0184609_10327481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 716 | Open in IMG/M |
3300018076|Ga0184609_10390634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
3300018077|Ga0184633_10067593 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
3300018078|Ga0184612_10076915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1741 | Open in IMG/M |
3300018079|Ga0184627_10607199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300018084|Ga0184629_10006473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4405 | Open in IMG/M |
3300018084|Ga0184629_10085886 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
3300018422|Ga0190265_10415072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1446 | Open in IMG/M |
3300018422|Ga0190265_13105097 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300018433|Ga0066667_11310594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
3300018469|Ga0190270_11300933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 770 | Open in IMG/M |
3300019377|Ga0190264_11625742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300019881|Ga0193707_1157343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
3300019882|Ga0193713_1088172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 870 | Open in IMG/M |
3300020006|Ga0193735_1047029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1290 | Open in IMG/M |
3300021178|Ga0210408_11164446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
3300025002|Ga0209001_1082848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
3300025164|Ga0209521_10377257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
3300025167|Ga0209642_10595490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 602 | Open in IMG/M |
3300025174|Ga0209324_10121973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1780 | Open in IMG/M |
3300025289|Ga0209002_10667250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300025318|Ga0209519_10107445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1642 | Open in IMG/M |
3300025326|Ga0209342_10276482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1467 | Open in IMG/M |
3300025558|Ga0210139_1030635 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300025910|Ga0207684_10346793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1278 | Open in IMG/M |
3300025910|Ga0207684_10921865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 734 | Open in IMG/M |
3300025917|Ga0207660_11496186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300025922|Ga0207646_10698965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 907 | Open in IMG/M |
3300025923|Ga0207681_11074161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 676 | Open in IMG/M |
3300025930|Ga0207701_10626147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 915 | Open in IMG/M |
3300025937|Ga0207669_11310577 | Not Available | 615 | Open in IMG/M |
3300026075|Ga0207708_11174123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
3300027163|Ga0209878_1051435 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300027511|Ga0209843_1012525 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
3300027787|Ga0209074_10122178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
3300027873|Ga0209814_10175760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 922 | Open in IMG/M |
3300027876|Ga0209974_10164803 | Not Available | 806 | Open in IMG/M |
3300028536|Ga0137415_10076474 | All Organisms → cellular organisms → Bacteria | 3207 | Open in IMG/M |
3300028784|Ga0307282_10147090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1114 | Open in IMG/M |
3300028807|Ga0307305_10184474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 961 | Open in IMG/M |
3300030620|Ga0302046_11488885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300031170|Ga0307498_10074293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 987 | Open in IMG/M |
3300031229|Ga0299913_10584232 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300031716|Ga0310813_10207259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1611 | Open in IMG/M |
3300031720|Ga0307469_10947244 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300031720|Ga0307469_11780585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 595 | Open in IMG/M |
3300033433|Ga0326726_12364766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300033551|Ga0247830_11384921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300034164|Ga0364940_0027306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1470 | Open in IMG/M |
3300034417|Ga0364941_003030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2746 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.49% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.30% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.84% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.65% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.92% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.19% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.19% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.19% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.46% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.46% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.46% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.46% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.46% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.73% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.73% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.73% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.73% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.73% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A100DRAFT_11015912 | 3300000655 | Forest Soil | IKSLQMLGQFTGKKIAFDEVADPRIAREVARELGYKVD* |
JGI1027J11758_123434642 | 3300000789 | Soil | IEQIVKSLQLLGQFGGRKIAFEDVADAQIAREVAKELGYKIE* |
JGI10214J12806_131908163 | 3300000891 | Soil | IVKSLQLLGQFTGKKIPLEEIADVRIAREVAKELGYKID* |
JGI1027J12803_1045002771 | 3300000955 | Soil | SGSGVPKREGMEQIVKSLQLTGQFTGKKVGFEEIADARIAAEVAKELGYKVE* |
JGI10216J12902_1000782823 | 3300000956 | Soil | GSGVPSREGMEQIVKSLQMLGQFTGKKVAFEEIADARIAREVAKELGYKVD* |
C687J26634_100783973 | 3300002123 | Soil | MEQIVKSLQMLGQFAGRKIAFEEIADARIAREVAKELGYKID* |
Ga0055466_100331111 | 3300003997 | Natural And Restored Wetlands | GMEQIIKSLQMLGQFTGKKIPMEEVADTKVAREVATELGYKVE* |
Ga0055466_102274991 | 3300003997 | Natural And Restored Wetlands | RSAAGNGVPSRAGMEQIVKSLQMLGQFAGKKIPMEEVADTKVAREVAKELGYKVD* |
Ga0055439_100597942 | 3300004019 | Natural And Restored Wetlands | MRPQAANAASASREGMEQIVKSLQLLGQFTGRKVAFEEIVDARIAREVAKELGYKVD* |
Ga0066680_106414121 | 3300005174 | Soil | REGMEQIVKSLQMLGQFTGKKIAFEEVADARIAREVAKELGYKVD* |
Ga0066688_106222921 | 3300005178 | Soil | VKSLQLLGQFVGRNVTFDEIADPRIAREVARELGYKVDL* |
Ga0066685_102222441 | 3300005180 | Soil | YQKTVSGNGVPSREGVEQIVKSLQLLGSSAAGIAFEDVADARIAREVAKELGYKVE* |
Ga0066388_1057325271 | 3300005332 | Tropical Forest Soil | KTINGSGVPSREGIEQIIRSLQLLGQFPGRKVAFEEVADARIAREVAKELGYNVE* |
Ga0070666_102804322 | 3300005335 | Switchgrass Rhizosphere | EGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD* |
Ga0066681_102744861 | 3300005451 | Soil | TVSGNGVPSRDGIEQIVKSLQLLGQFTGRKTAFEEVADARISREVAKELGYKVE* |
Ga0070706_1011524732 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEIADARIAREVAKELGYKVD* |
Ga0070698_1015481142 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PSREGMEQIVKSLQMLGQFAGKKIPLEEIADTRIAREVAKELGYKID* |
Ga0070684_1010210631 | 3300005535 | Corn Rhizosphere | AAAGNGVPSREGMEQIVKSLQMLGQFTGKKIPFEEIADARVSREVAKELGYKID* |
Ga0068855_1003354431 | 3300005563 | Corn Rhizosphere | GVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVD* |
Ga0066905_1020659081 | 3300005713 | Tropical Forest Soil | QLLGQFTGKKIAFEEVADPRIAREVARELGYKVD* |
Ga0075417_104343492 | 3300006049 | Populus Rhizosphere | NRRSASGNGVPSREGIEQIVKSLQMLGQFAGRKIPLEEIADTRIARDVAKELGYKVD* |
Ga0079221_100320993 | 3300006804 | Agricultural Soil | MEQIVKSLQLLGQFTGRKIAFEEIADGQIAREVAKELGYKVD* |
Ga0075421_1009016551 | 3300006845 | Populus Rhizosphere | SLQLLGQFTGKKIAFEEITDTRIARAVAKELGYKEN* |
Ga0075420_1015114321 | 3300006853 | Populus Rhizosphere | SGSGVPSREGMQQIVKSLQLLGQFTGKKVAFEEIADARIAREIAKELGYRVE* |
Ga0075434_1006331271 | 3300006871 | Populus Rhizosphere | GNGVPSREGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE* |
Ga0075429_1007364501 | 3300006880 | Populus Rhizosphere | SLQLLGQFTGKKVAFEEIADARIAREIAKELGYRVE* |
Ga0075424_1003447371 | 3300006904 | Populus Rhizosphere | TVSGNGVPSREGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKAE* |
Ga0075424_1026849811 | 3300006904 | Populus Rhizosphere | VPSREGIEQIVKALQLLGQFSGRKVSFDEVADARIAREVAKELGYKVD* |
Ga0075419_108363551 | 3300006969 | Populus Rhizosphere | AEDTFVDYQKTVSGNGVPSREGIEQIVKSLQLLGQFVGRKVGFEEVADARIAREVAKELGYKIE* |
Ga0111539_101022254 | 3300009094 | Populus Rhizosphere | EQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD* |
Ga0075418_124107731 | 3300009100 | Populus Rhizosphere | QIVKSLQLLGQFTGKKVAFEEIADARIAREIAKELGYRVE* |
Ga0075418_127087412 | 3300009100 | Populus Rhizosphere | PSREGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE* |
Ga0105092_100162565 | 3300009157 | Freshwater Sediment | PLLGQFTGKKVAFEEVADPRIAREVARELGYRVE* |
Ga0105092_102974401 | 3300009157 | Freshwater Sediment | KSLQLLGQFTGKKVGFEEVADPRIASEVAKELGYKVD* |
Ga0075423_101986493 | 3300009162 | Populus Rhizosphere | QIVKSLQLLGQFTGKKVAFEEIADARIAREVARELGYKVD* |
Ga0113563_106079851 | 3300009167 | Freshwater Wetlands | EQIVKSLQMLGQFTGRKIAFEEIADARIAREVARELGYKID* |
Ga0105104_106882531 | 3300009168 | Freshwater Sediment | REGMEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD* |
Ga0105340_14568631 | 3300009610 | Soil | GIAQIVKSLQMLGQFTGRKIGFEEVADARIAREVAKELGYKVD* |
Ga0126374_101141222 | 3300009792 | Tropical Forest Soil | FEDYRKTSSGSGVPSRKGMEEIIKSLQLLGQFTGKKIAFEEVADPRIAREVARELGYKVD |
Ga0105088_10509111 | 3300009810 | Groundwater Sand | MEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD* |
Ga0126382_102371041 | 3300010047 | Tropical Forest Soil | SGSGVPSRKGMEEIIKSLQLLGQFTGKKIGFEEVADPRIAREVARELGYKMD* |
Ga0126382_110423362 | 3300010047 | Tropical Forest Soil | TSSGSGVPSRKGMEEIIKSLQLLGQFTGKKIAFDEVADPRIAREVARELGYKVD* |
Ga0134088_103707001 | 3300010304 | Grasslands Soil | EGIEQIVKSLQLLGQFGGRKIAFDEVADARIAREVAKELGYNVE* |
Ga0126376_112193211 | 3300010359 | Tropical Forest Soil | GVPSRKGMEEIIKLLQLLGQFTGKKIAFEEVADPRIAREVARELSYKVD* |
Ga0126376_125756302 | 3300010359 | Tropical Forest Soil | RKGMEEIIKSLQMLGQFTGKKIAFEEVADPRIAREVARELGYKVD* |
Ga0126372_127559861 | 3300010360 | Tropical Forest Soil | EIIKSLQLLGQFTGKKIAYEEVADPRIAREVARELGYKVD* |
Ga0126377_108362321 | 3300010362 | Tropical Forest Soil | KTVSGNGVPSREGVEQIIKSLQLLGQFTGRKITFEEVADARIAREVAKELGYKVEKE* |
Ga0126377_122991252 | 3300010362 | Tropical Forest Soil | EDSFEDYRKTSSGSGVPSRKGMEEIIKSLQMLGQFTGKKIAFDEVADPRIAREVARELGYKVD* |
Ga0105239_134177851 | 3300010375 | Corn Rhizosphere | KSLQMLGQFTGKKIPFEEITDIRLAREVAKELGYKVD* |
Ga0134124_101098001 | 3300010397 | Terrestrial Soil | QIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVD* |
Ga0134123_125487251 | 3300010403 | Terrestrial Soil | LQLLGQFTGKKIPLEEIADVRIAREVAKELGYKID* |
Ga0120191_100478892 | 3300012022 | Terrestrial | MEQIVKSLQLLGQFTGKKVAFEEVFDPRIAREVARELGYRVE* |
Ga0137338_10603062 | 3300012174 | Soil | TDYQKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKIAFEEIADARIAREVARELGYKIE* |
Ga0137338_10961621 | 3300012174 | Soil | TISGNGVPTREGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD* |
Ga0137399_113175061 | 3300012203 | Vadose Zone Soil | DYQKTVSGNGVPSPEGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE* |
Ga0137369_110823232 | 3300012355 | Vadose Zone Soil | GVPSRDGIEQIVKSLQLLGQFGGRKVAFEDVADARIAREVAKELGYKVE* |
Ga0137360_108672682 | 3300012361 | Vadose Zone Soil | EQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE* |
Ga0157337_10101631 | 3300012483 | Arabidopsis Rhizosphere | MFADNRRSAAGNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD* |
Ga0157352_10253942 | 3300012519 | Unplanted Soil | FVDYQKTVSGNGVPSRDGIEQIVKSLQLLGQFVGRKVGFEEVADARIAREVAKELGYKIE |
Ga0137341_10670141 | 3300012676 | Soil | KSVQLLGQFPGRKIAFEEVADARISREVAKELGYKVD* |
Ga0137397_107094671 | 3300012685 | Vadose Zone Soil | SGVMPSSVPSRDGIEQIVKSLQLLGQFVGRKVGFEEVADARIAREVAKELGYKNE* |
Ga0137396_100891773 | 3300012918 | Vadose Zone Soil | SLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD* |
Ga0137359_108307892 | 3300012923 | Vadose Zone Soil | PSREGMEQIVKSLQLLGQFTGRKVAFEEVADARIAREVAKELGYKVD* |
Ga0137416_100203771 | 3300012927 | Vadose Zone Soil | VPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD* |
Ga0137407_105896182 | 3300012930 | Vadose Zone Soil | EGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE* |
Ga0153915_115408712 | 3300012931 | Freshwater Wetlands | GMEQIVKSLQMLGQFAGKKIAFEEIAATLIARDVGKELGYKVE* |
Ga0126369_135183962 | 3300012971 | Tropical Forest Soil | PSREGMEQIVKSLQLLGQFVGRKVGFEEIADARIAREVAKELGYKID* |
Ga0134087_104135881 | 3300012977 | Grasslands Soil | FIDYQKTVSGNGVPSREGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE |
Ga0164307_118771021 | 3300012987 | Soil | SREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD* |
Ga0157369_116415222 | 3300013105 | Corn Rhizosphere | ENRRSAAGNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVE* |
Ga0075301_11163421 | 3300014262 | Natural And Restored Wetlands | VEKIQMRPQAANAASASREGMEQIVKSLQLLGQFTGRKVAFEEIVDARIAREVAKELGYKVD* |
Ga0075309_10762851 | 3300014268 | Natural And Restored Wetlands | IVKSLQMLGQFTGKKIAFEEIADVRIAREVAKELGYKAE* |
Ga0075344_10213101 | 3300014296 | Natural And Restored Wetlands | DSYVDYRKTSSGNGVPTREGMEQIVKALQLLGQFTGKKIAFEEIADPRIASEVAKELGYKVE* |
Ga0075342_11983371 | 3300014320 | Natural And Restored Wetlands | MEQIVKSLQLLGQFAGRKVAFEEIADARIAKEVARELGYKVD* |
Ga0180080_10891771 | 3300014870 | Soil | IEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD* |
Ga0180086_11137532 | 3300014883 | Soil | VPSREGMEQIVKSLQMLGQFTGKKIAFEEIADPRFAREVAKELGYKIN* |
Ga0182007_103706121 | 3300015262 | Rhizosphere | KSLQLLGQFTGKKIAFEEIADTRIARAVAKELGYKEN* |
Ga0132258_138150641 | 3300015371 | Arabidopsis Rhizosphere | SLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE* |
Ga0132256_1016737902 | 3300015372 | Arabidopsis Rhizosphere | GNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEIADGQIAREVGKELGYKVD* |
Ga0132256_1019877833 | 3300015372 | Arabidopsis Rhizosphere | KSLQLLGQFTGRKNAFEEITDARNARDVAKELGYKVD* |
Ga0132257_1017466881 | 3300015373 | Arabidopsis Rhizosphere | MFADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKID* |
Ga0132257_1023862201 | 3300015373 | Arabidopsis Rhizosphere | MFADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRVAREVAKELGYKID* |
Ga0132255_1030470621 | 3300015374 | Arabidopsis Rhizosphere | NGVPSREGMEQIVKSLQLLGQFTGRKIAFEEITDTRIARDVAKELGYKVD* |
Ga0182034_100771171 | 3300016371 | Soil | SREGMEQIVKALQLLGQFTGRKVAFEEVADARIAREVAKELGYKVD |
Ga0184638_10652741 | 3300018052 | Groundwater Sediment | ASGNGVPSREGMEQIVKSLQLLGQFTGKKIAFEEITDTRIAREVAKELGYKLD |
Ga0184618_101909172 | 3300018071 | Groundwater Sediment | GNGVPSREGIEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKVE |
Ga0184635_100300471 | 3300018072 | Groundwater Sediment | AFGEYRKTISGNGVPTREGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKV |
Ga0184609_103274812 | 3300018076 | Groundwater Sediment | VKSLQMLGQFGGRKIAFEDVADARIAREVAKELGYKVE |
Ga0184609_103906341 | 3300018076 | Groundwater Sediment | EGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD |
Ga0184633_100675933 | 3300018077 | Groundwater Sediment | SLQLLGQFAGRKIPLEEIADTRIAREVAKELDYKID |
Ga0184612_100769151 | 3300018078 | Groundwater Sediment | RKTSSGSGVPSREGMEQIVKSLQLLGQFTGKKVAFEEIADARIAREVARELGYKVE |
Ga0184627_106071991 | 3300018079 | Groundwater Sediment | GNGVPSREGIEQIVKSLQLLGQFVGRKVAFEEVADARIAREVAKELGYKVE |
Ga0184629_100064731 | 3300018084 | Groundwater Sediment | REGIEQIIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD |
Ga0184629_100858861 | 3300018084 | Groundwater Sediment | IIKSVQLLGQFPGRKIAFEEVADARIAREVAKELGYKVD |
Ga0190265_104150723 | 3300018422 | Soil | LQLLGQFTGKKIPFDEITDTRIAREVAKELGYKID |
Ga0190265_131050972 | 3300018422 | Soil | REGIEQIVKSLQMLGQFTGKKIAFEEIADARFAREVAKELGYKIN |
Ga0066667_113105941 | 3300018433 | Grasslands Soil | NGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0190270_113009332 | 3300018469 | Soil | FTDYQKTVSGNGVPSREGVEQIVKSLQLLGQFGGRKIAFEDVADARIAREVAKELGYKIE |
Ga0190264_116257422 | 3300019377 | Soil | GVPSREGMEQIFKSLQLLGQFTGKKIPFDEITDTRIAREVAKELGYKVD |
Ga0193707_11573431 | 3300019881 | Soil | ADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0193713_10881722 | 3300019882 | Soil | SGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0193735_10470293 | 3300020006 | Soil | LQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0210408_111644462 | 3300021178 | Soil | SYADYRKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEITDPRLAREVAKELGYKV |
Ga0209001_10828481 | 3300025002 | Soil | KSLQMLGQFTGKKIAFEEIADVRIAREVAKELGYKAE |
Ga0209521_103772572 | 3300025164 | Soil | EGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKID |
Ga0209642_105954901 | 3300025167 | Soil | GMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKID |
Ga0209324_101219731 | 3300025174 | Soil | SGSGVPTREGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKID |
Ga0209002_106672502 | 3300025289 | Soil | SLQMLGQFTGKKIAFEEIADVRIAREVAKELGYKAE |
Ga0209519_101074451 | 3300025318 | Soil | REGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVAKELGYKID |
Ga0209342_102764823 | 3300025326 | Soil | GVPTREGMEQIVKSLQMLGQFAGRKIAFEEIADARIAREVARELGYKTD |
Ga0210139_10306352 | 3300025558 | Natural And Restored Wetlands | MRPQAANAASASREGMEQIVKSLQLLGQFTGRKVAFEEIVDARIAREVAKELGYKVD |
Ga0207684_103467931 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEITDSRLAREVAKELGYKVD |
Ga0207684_109218651 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DYRKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEIADARIAREVAKELGYKVD |
Ga0207660_114961862 | 3300025917 | Corn Rhizosphere | DMFADNRRAAAGNGVPSREGMEQIVKSLQMLGQFTGKKIPFEEIADARVSREVAKELGYKID |
Ga0207646_106989652 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SYADYRKTSSGSGVPSREGMEQIVKSLQLLGQFTGRKVAFEEIADARIAREVAKELGYKV |
Ga0207681_110741612 | 3300025923 | Switchgrass Rhizosphere | MFADNRRSASGNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKI |
Ga0207701_106261472 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | REGMEQIVKSLQMLGQFTGKKIAFEEITDTRVAREVAKELGYKVD |
Ga0207669_113105772 | 3300025937 | Miscanthus Rhizosphere | NGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD |
Ga0207708_111741231 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ADNEKSSAGNGVPSREGMDQIVKSLQMLGQFTGKKIPFEEITDIRLAREVAKELGYKVD |
Ga0209878_10514351 | 3300027163 | Groundwater Sand | SGSGVPTREGMEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD |
Ga0209843_10125252 | 3300027511 | Groundwater Sand | MEQIVKSLQMLGQFTGKKVAFEEVADARIAREVARELGYKVD |
Ga0209074_101221782 | 3300027787 | Agricultural Soil | AAGNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD |
Ga0209814_101757601 | 3300027873 | Populus Rhizosphere | PSREGVEQIVKSLQLLGQFGGRKVAFDEVADARIAREVAKELGYKVE |
Ga0209974_101648031 | 3300027876 | Arabidopsis Thaliana Rhizosphere | DEMFAENRRSAAGNGVPTREGMEQIVKSLQLLGQFTGRKIAFEEITDARIAREVAKELGYKVD |
Ga0137415_100764741 | 3300028536 | Vadose Zone Soil | VPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0307282_101470902 | 3300028784 | Soil | GNGVPSREGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0307305_101844742 | 3300028807 | Soil | REGMEQIVKSLQMLGQFAGKKIAFEEITDTRIAREVAKELGYKMD |
Ga0302046_114888852 | 3300030620 | Soil | ADNRRSAAGNGVPSRAGMEQIVKSLQMLGQFTGKQIAFEEITDPRIAREVAKELGY |
Ga0307498_100742931 | 3300031170 | Soil | EMFADNRRSASGNGVPSREGMEQIVKSLQMLGQFSGKKIPFEKITDTRIAREVAKELGYKVD |
Ga0299913_105842321 | 3300031229 | Soil | NRRGAAGNGVPSREGIEQIVKSLQMLGQFTGKKIAFEEIADARIAREVAKELGYKAE |
Ga0310813_102072591 | 3300031716 | Soil | AAGNGVPSREGMEQIVKSLQLLGQFTGRKIAFEEITDARIARDVAKELGYKVD |
Ga0307469_109472441 | 3300031720 | Hardwood Forest Soil | SREGMEQIVKSLQMLGQFTGKKVAFEEIADARIAREVARELGYKVD |
Ga0307469_117805852 | 3300031720 | Hardwood Forest Soil | QIVKSLQMLGQFTGKKVAFEEIADARIAREVAKELGYKVD |
Ga0326726_123647661 | 3300033433 | Peat Soil | PSYEGIEQIVKSLQSLGQFAGRKVAFEEVADDRLAKEVARELGYKVE |
Ga0247830_113849211 | 3300033551 | Soil | GMEQIIKSLQLLGQFTGRKISIDEIADTRIAREVAKELGYKVE |
Ga0364940_0027306_1311_1469 | 3300034164 | Sediment | SGSGVPSREGMEQIVKSLQLLGQFTGRKIAFEEIADARIAREVARELGYKID |
Ga0364941_003030_2590_2718 | 3300034417 | Sediment | MEQIVKSLQMLGQFTGKKVAFEEIADARIAREVARELGHKVD |
⦗Top⦘ |