Basic Information | |
---|---|
Family ID | F056486 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 137 |
Average Sequence Length | 45 residues |
Representative Sequence | MDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.84 % |
% of genes near scaffold ends (potentially truncated) | 27.01 % |
% of genes from short scaffolds (< 2000 bps) | 85.40 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.131 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.547 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.226 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.854 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF03740 | PdxJ | 13.14 |
PF04588 | HIG_1_N | 10.22 |
PF01923 | Cob_adeno_trans | 5.84 |
PF15916 | DUF4743 | 5.11 |
PF02771 | Acyl-CoA_dh_N | 2.92 |
PF00749 | tRNA-synt_1c | 2.19 |
PF04255 | DUF433 | 0.73 |
PF01578 | Cytochrom_C_asm | 0.73 |
PF02738 | MoCoBD_1 | 0.73 |
PF05016 | ParE_toxin | 0.73 |
PF13560 | HTH_31 | 0.73 |
PF12680 | SnoaL_2 | 0.73 |
PF01464 | SLT | 0.73 |
PF05685 | Uma2 | 0.73 |
PF07969 | Amidohydro_3 | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 13.14 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.92 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.19 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.73 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.13 % |
Unclassified | root | N/A | 13.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459009|GA8DASG01E2E16 | Not Available | 501 | Open in IMG/M |
2228664022|INPgaii200_c0704641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100653171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1632 | Open in IMG/M |
3300001661|JGI12053J15887_10114810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1445 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100853830 | Not Available | 792 | Open in IMG/M |
3300002568|C688J35102_118337647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
3300004081|Ga0063454_101044485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300004114|Ga0062593_100275195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1413 | Open in IMG/M |
3300005171|Ga0066677_10037715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2353 | Open in IMG/M |
3300005174|Ga0066680_10915501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
3300005175|Ga0066673_10145639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1314 | Open in IMG/M |
3300005175|Ga0066673_10772026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300005176|Ga0066679_10187253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1314 | Open in IMG/M |
3300005176|Ga0066679_10384016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 919 | Open in IMG/M |
3300005176|Ga0066679_10630373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300005178|Ga0066688_10130015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1564 | Open in IMG/M |
3300005179|Ga0066684_10708051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 673 | Open in IMG/M |
3300005181|Ga0066678_10750389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 648 | Open in IMG/M |
3300005184|Ga0066671_10246788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1097 | Open in IMG/M |
3300005184|Ga0066671_10828598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
3300005332|Ga0066388_100902602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1462 | Open in IMG/M |
3300005344|Ga0070661_101053907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
3300005435|Ga0070714_101453603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 669 | Open in IMG/M |
3300005445|Ga0070708_100025619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5043 | Open in IMG/M |
3300005446|Ga0066686_10950905 | Not Available | 561 | Open in IMG/M |
3300005451|Ga0066681_10437484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 803 | Open in IMG/M |
3300005467|Ga0070706_100308022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1477 | Open in IMG/M |
3300005467|Ga0070706_100768462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
3300005471|Ga0070698_100085580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3140 | Open in IMG/M |
3300005552|Ga0066701_10749838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
3300005568|Ga0066703_10052386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2288 | Open in IMG/M |
3300005586|Ga0066691_10562056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
3300005610|Ga0070763_10661206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
3300005764|Ga0066903_101385407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1320 | Open in IMG/M |
3300005764|Ga0066903_103062717 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300005921|Ga0070766_10152219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1417 | Open in IMG/M |
3300006046|Ga0066652_100216921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1656 | Open in IMG/M |
3300006791|Ga0066653_10317932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 784 | Open in IMG/M |
3300006794|Ga0066658_10084666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1458 | Open in IMG/M |
3300006796|Ga0066665_11553244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
3300006806|Ga0079220_10104569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1476 | Open in IMG/M |
3300006893|Ga0073928_10000419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 100320 | Open in IMG/M |
3300006893|Ga0073928_10001580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 43039 | Open in IMG/M |
3300007255|Ga0099791_10432320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300007788|Ga0099795_10202942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
3300009038|Ga0099829_10635767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
3300009088|Ga0099830_10366262 | Not Available | 1161 | Open in IMG/M |
3300009089|Ga0099828_10562942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1027 | Open in IMG/M |
3300009090|Ga0099827_10088769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2432 | Open in IMG/M |
3300009090|Ga0099827_10302404 | Not Available | 1354 | Open in IMG/M |
3300009137|Ga0066709_100001660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 15060 | Open in IMG/M |
3300009137|Ga0066709_102885189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
3300009143|Ga0099792_10059569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1890 | Open in IMG/M |
3300010159|Ga0099796_10002297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4160 | Open in IMG/M |
3300010159|Ga0099796_10205161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
3300010303|Ga0134082_10195630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 827 | Open in IMG/M |
3300010321|Ga0134067_10059411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
3300010321|Ga0134067_10302231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300010359|Ga0126376_11803582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300010364|Ga0134066_10181808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
3300010366|Ga0126379_12814156 | Not Available | 582 | Open in IMG/M |
3300010373|Ga0134128_10276120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1884 | Open in IMG/M |
3300011269|Ga0137392_10092101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2374 | Open in IMG/M |
3300011271|Ga0137393_10694205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
3300012189|Ga0137388_10363705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1336 | Open in IMG/M |
3300012198|Ga0137364_11101255 | Not Available | 598 | Open in IMG/M |
3300012199|Ga0137383_10293693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1190 | Open in IMG/M |
3300012202|Ga0137363_10988865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 714 | Open in IMG/M |
3300012205|Ga0137362_10805208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
3300012207|Ga0137381_10368956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1251 | Open in IMG/M |
3300012210|Ga0137378_10569151 | Not Available | 1042 | Open in IMG/M |
3300012210|Ga0137378_10808984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
3300012210|Ga0137378_11421731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
3300012212|Ga0150985_111148946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
3300012285|Ga0137370_10210649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1142 | Open in IMG/M |
3300012357|Ga0137384_10723954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
3300012361|Ga0137360_11218329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella aerolata | 651 | Open in IMG/M |
3300012363|Ga0137390_10155266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2275 | Open in IMG/M |
3300012363|Ga0137390_10788634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
3300012363|Ga0137390_11247697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
3300012469|Ga0150984_105885921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
3300012923|Ga0137359_10997018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
3300012924|Ga0137413_10996197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
3300012925|Ga0137419_10742821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 799 | Open in IMG/M |
3300012927|Ga0137416_11940913 | Not Available | 539 | Open in IMG/M |
3300012955|Ga0164298_10767005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
3300012975|Ga0134110_10096162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1194 | Open in IMG/M |
3300012984|Ga0164309_10304889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1150 | Open in IMG/M |
3300012989|Ga0164305_10559585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
3300014166|Ga0134079_10669436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300015245|Ga0137409_10998924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300015357|Ga0134072_10080128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
3300018431|Ga0066655_10352816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
3300018431|Ga0066655_10867585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
3300018433|Ga0066667_10385025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1128 | Open in IMG/M |
3300018433|Ga0066667_10608915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
3300018433|Ga0066667_10903094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300018433|Ga0066667_12249300 | Not Available | 509 | Open in IMG/M |
3300018468|Ga0066662_10703867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 965 | Open in IMG/M |
3300018468|Ga0066662_12559753 | Not Available | 538 | Open in IMG/M |
3300018482|Ga0066669_10799037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
3300018482|Ga0066669_12115450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
3300020199|Ga0179592_10295991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 720 | Open in IMG/M |
3300021086|Ga0179596_10711946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300021170|Ga0210400_10003731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 13400 | Open in IMG/M |
3300021178|Ga0210408_10878922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 699 | Open in IMG/M |
3300021374|Ga0213881_10568135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300021432|Ga0210384_10052297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3706 | Open in IMG/M |
3300021560|Ga0126371_10276288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1801 | Open in IMG/M |
3300022557|Ga0212123_10000086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 312382 | Open in IMG/M |
3300022557|Ga0212123_10000744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 100375 | Open in IMG/M |
3300025922|Ga0207646_10212496 | Not Available | 1747 | Open in IMG/M |
3300025939|Ga0207665_10096523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2056 | Open in IMG/M |
3300026301|Ga0209238_1113681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
3300026301|Ga0209238_1169635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
3300026309|Ga0209055_1282337 | Not Available | 519 | Open in IMG/M |
3300026312|Ga0209153_1047359 | Not Available | 1516 | Open in IMG/M |
3300026318|Ga0209471_1317036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300026325|Ga0209152_10231588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
3300026335|Ga0209804_1303616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300026538|Ga0209056_10351170 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300026547|Ga0209156_10241563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 843 | Open in IMG/M |
3300026550|Ga0209474_10247696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1100 | Open in IMG/M |
3300026551|Ga0209648_10124967 | Not Available | 2069 | Open in IMG/M |
3300027633|Ga0208988_1102481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 709 | Open in IMG/M |
3300027889|Ga0209380_10072245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1972 | Open in IMG/M |
3300027903|Ga0209488_10200578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1503 | Open in IMG/M |
3300028047|Ga0209526_10828421 | Not Available | 570 | Open in IMG/M |
3300028906|Ga0308309_10348398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1262 | Open in IMG/M |
3300028906|Ga0308309_11877889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
3300031058|Ga0308189_10245599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
3300031091|Ga0308201_10385648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300031720|Ga0307469_10931750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
3300032174|Ga0307470_10590282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 829 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.65% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.19% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.46% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.73% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.73% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.73% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.73% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.73% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459009 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F47_00353250 | 2170459009 | Grass Soil | MEAAMDQRIVQTPTEARQGSKSGIVRYVLTISTALVVIAFAVAYITSV |
INPgaii200_07046412 | 2228664022 | Soil | MMEAAMDQRIVQSPTEARQGSKNGIVRYVLAISTALVVIAFAVAYITSV |
INPhiseqgaiiFebDRAFT_1006531713 | 3300000364 | Soil | MDQRIVQSPTEARQGSKNGIVRYVLAISTALVVIAFAVAYITSV* |
JGI12053J15887_101148103 | 3300001661 | Forest Soil | MDQRIVQSPTKARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV* |
JGIcombinedJ26739_1008538301 | 3300002245 | Forest Soil | TPTEARQGSKSGIVRYVLAISTALVVIAFAVAYITSV* |
C688J35102_1183376471 | 3300002568 | Soil | MEAAMDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV*SGGLHELGSPGAR |
Ga0063454_1010444851 | 3300004081 | Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0062593_1002751952 | 3300004114 | Soil | MDDGRRIVESPSRARQASKYGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0066677_100377154 | 3300005171 | Soil | MDDGRRIVESPSRARQANKPGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0066680_109155012 | 3300005174 | Soil | MDQRIVETPNQARQGRKYGIVRYVLLISTVLVVIAFAVAYMTSV* |
Ga0066673_101456391 | 3300005175 | Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIGFAVAYMTSV* |
Ga0066673_107720262 | 3300005175 | Soil | MDQRIDPRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV* |
Ga0066679_101872531 | 3300005176 | Soil | MDQRIVESPNQARAGRKYGVLRYVLLISTLLVVIAFAVAYTLSV* |
Ga0066679_103840164 | 3300005176 | Soil | RRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMSSV* |
Ga0066679_106303731 | 3300005176 | Soil | MDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV* |
Ga0066688_101300153 | 3300005178 | Soil | MDQRWDHRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV* |
Ga0066684_107080511 | 3300005179 | Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYM |
Ga0066678_107503891 | 3300005181 | Soil | MDQRIVQSPTKARQGRKYGIVRYVLLISTLLVVIAFAVAYTLTV* |
Ga0066671_102467882 | 3300005184 | Soil | MDDGRRIVESPSRARQANKPGIVRYVLAISLALVVIAFAVAYMSAV* |
Ga0066671_108285981 | 3300005184 | Soil | IVESPTRARQGGKYGIVRYVLVISTVLVVIAFAVAYIASV* |
Ga0066388_1009026022 | 3300005332 | Tropical Forest Soil | MDDGRRIVESPTRARQAGKYGIVRYVLAISLVLVVIAFAVAYMTSV* |
Ga0070661_1010539071 | 3300005344 | Corn Rhizosphere | MDDGRRIVESPSRARQASKYGVVRYVLAISLVLVVIAFAVAYMTSV* |
Ga0070714_1014536031 | 3300005435 | Agricultural Soil | MDDGRRIVESPSRARQASKYGIVRYVLAISLVLVVIAFAVAYMTSV* |
Ga0070708_1000256195 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0066686_109509052 | 3300005446 | Soil | MDQDQRVVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVTSV* |
Ga0066681_104374842 | 3300005451 | Soil | MDQDQRVVETPERARSARKHGVLRYILGISLVLVVIAFAVAYVTSV* |
Ga0070706_1003080223 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAAMDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIAFA |
Ga0070706_1007684621 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IVQSPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0070698_1000855804 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIAFAAAYITSV* |
Ga0070739_100597543 | 3300005532 | Surface Soil | MPQRIVEDPTSARAGTKSGIVRYILAVSVALVVIAFIVAYFVTI* |
Ga0066701_107498382 | 3300005552 | Soil | MDQRIVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0066703_100523865 | 3300005568 | Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMSSV* |
Ga0066691_105620562 | 3300005586 | Soil | MDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV* |
Ga0070763_106612063 | 3300005610 | Soil | SPNQVRQGGKFGVVRYVLLISTLLVVIAFAVAYTLSV* |
Ga0066903_1013854074 | 3300005764 | Tropical Forest Soil | RIVESPTRARQAGKYGVVRYVLAISLLLVVIAFAVAYMTSV* |
Ga0066903_1030627173 | 3300005764 | Tropical Forest Soil | MAQRIVQSPTKARQGSKYGIVRYVLAISVVLVVIAFAVAYMTSV* |
Ga0070766_101522192 | 3300005921 | Soil | MDQRIVLSPNQVRQGGKFGVVRYVLLISTLLVVIAFAVAYTLSV* |
Ga0066652_1002169213 | 3300006046 | Soil | MDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV* |
Ga0066653_103179322 | 3300006791 | Soil | MDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0066658_100846663 | 3300006794 | Soil | MDDGRRIVESPSRARQANKPGIVRYVLAISLALVVIAFAVAYMSSV* |
Ga0066665_115532441 | 3300006796 | Soil | ERGRATTEAAMDDGRRIVESPSRARQANKPGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0079220_101045693 | 3300006806 | Agricultural Soil | MDDGRRIVESPSRARQASKYGIVRYVLAISLVLVVIAFAVAY |
Ga0073928_1000041921 | 3300006893 | Iron-Sulfur Acid Spring | MDQNIVSTPERARGARKAGVVRYVLAVSLLLVVIAFAVAYVTSV* |
Ga0073928_1000158013 | 3300006893 | Iron-Sulfur Acid Spring | MDQRIDQPIGQRIVQDPTRARQGSKPGIVRYVLVISTLLVVIAFAVAYMTSV* |
Ga0099791_104323202 | 3300007255 | Vadose Zone Soil | VDQRIVETPERTHAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0099795_102029421 | 3300007788 | Vadose Zone Soil | MEAAMDQRIVQSPTKARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV* |
Ga0099829_106357672 | 3300009038 | Vadose Zone Soil | MDQRIVLSPEKARAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0099830_103662621 | 3300009088 | Vadose Zone Soil | PTRQLVDQRIVETPERTHAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0099828_105629422 | 3300009089 | Vadose Zone Soil | MDQRIVETLESARAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0099827_100887691 | 3300009090 | Vadose Zone Soil | MDQRIVETPERARAARKCGVLRYILEVIRELVVIAFAVAYVT |
Ga0099827_103024041 | 3300009090 | Vadose Zone Soil | RRAPPARQALDQRIVETPEKARAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0066709_10000166011 | 3300009137 | Grasslands Soil | MEAAMDQRWDHRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0066709_1028851891 | 3300009137 | Grasslands Soil | MDQRIVETPERTRAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0099792_100595694 | 3300009143 | Vadose Zone Soil | MEAAMDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0099796_100022975 | 3300010159 | Vadose Zone Soil | MEAAMDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0099796_102051612 | 3300010159 | Vadose Zone Soil | MEAAMDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV* |
Ga0134082_101956301 | 3300010303 | Grasslands Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTFV* |
Ga0134067_100594111 | 3300010321 | Grasslands Soil | MEAAMDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMSAV* |
Ga0134067_103022311 | 3300010321 | Grasslands Soil | MDQRIDPRIVETPTEVRQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0126376_118035822 | 3300010359 | Tropical Forest Soil | MDDGRRIVESPTRARQAGKYGVVRYVLAISLLLVVIAFAVAYMTSV* |
Ga0134066_101818081 | 3300010364 | Grasslands Soil | MDDGRRIVESPSRARQANKPGIVRYVLAISLALVVI |
Ga0126379_128141562 | 3300010366 | Tropical Forest Soil | MDDGRRIVESPTRARGARVYGIVRYVLVISTVLVVIAFAVAYMTSV* |
Ga0134128_102761203 | 3300010373 | Terrestrial Soil | MNDGRRIVESPSRARQASKYGIVRYVLAISLVLVVIAFAVAYMTSV* |
Ga0137392_100921015 | 3300011269 | Vadose Zone Soil | MDQRIVETPERARAARKNGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0137393_106942051 | 3300011271 | Vadose Zone Soil | RTRAARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0137388_103637051 | 3300012189 | Vadose Zone Soil | MDQRIVLSPEKTRAARKYGVLRYILGISLVLVVIAFAVAYVIS |
Ga0137364_111012551 | 3300012198 | Vadose Zone Soil | MDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0137383_102936932 | 3300012199 | Vadose Zone Soil | MDQDQRVVETPERARSARKYGVLRYILRISLVLGVIAFAVAYVTSV* |
Ga0137363_109888652 | 3300012202 | Vadose Zone Soil | MEAAMDQRIVQSPTKARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV* |
Ga0137362_108052082 | 3300012205 | Vadose Zone Soil | MDQRIVETPEKARAAREYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0137381_103689563 | 3300012207 | Vadose Zone Soil | MDQRIVASPEKARAARKYGVVRYILVISLVLVVIAFAVAYVTSV* |
Ga0137378_105691513 | 3300012210 | Vadose Zone Soil | MDQRIVETPEGTRAARKYGVLRYILGLSLVLVVIAFAVAYVISV* |
Ga0137378_108089843 | 3300012210 | Vadose Zone Soil | MDQRIVASPEKARAARKYGVVRYILGISLVLVVIAFAVAYVTSV* |
Ga0137378_114217312 | 3300012210 | Vadose Zone Soil | MDQRIVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVTSV* |
Ga0150985_1111489461 | 3300012212 | Avena Fatua Rhizosphere | TTEAAMDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0137370_102106493 | 3300012285 | Vadose Zone Soil | MMEALMDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0137384_107239542 | 3300012357 | Vadose Zone Soil | MDQHIVASPEKARAARKYGVVRYILGISLVLVVIAFAVAYVTSV* |
Ga0137360_112183291 | 3300012361 | Vadose Zone Soil | MDQRIVESPEQARQGRKYGVMRYVLLISTLLVVIAFAVAYTLSV* |
Ga0137390_101552661 | 3300012363 | Vadose Zone Soil | MDQRIVETPEKARAARKYGVLRYILGISLVLVVIAFAVA |
Ga0137390_107886341 | 3300012363 | Vadose Zone Soil | MDQRIVETPERARSARKYGVLRYILGISLVLVVILFAVAY |
Ga0137390_112476971 | 3300012363 | Vadose Zone Soil | MDQRVVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVISV* |
Ga0150984_1058859213 | 3300012469 | Avena Fatua Rhizosphere | VLFRSEVPHMAQRIAEGPERARQGRPEHVVRYVLILSTLLVVILFAVAYTLSV* |
Ga0137359_109970182 | 3300012923 | Vadose Zone Soil | MDQRVVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVTSV* |
Ga0137413_109961971 | 3300012924 | Vadose Zone Soil | MEAAMDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV* |
Ga0137419_107428211 | 3300012925 | Vadose Zone Soil | AMDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV* |
Ga0137416_119409131 | 3300012927 | Vadose Zone Soil | MEAAMDQRIVQSPTKARQGSKYGIVRYVLAISTALV |
Ga0164298_107670051 | 3300012955 | Soil | MDDGRRIGESPSRARQASKYGIVRYVLAISLVLVVIAFAVAYMTSV* |
Ga0134110_100961622 | 3300012975 | Grasslands Soil | MEALMDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAVAYITSV* |
Ga0164309_103048893 | 3300012984 | Soil | MDDGRRIVESPSRVRQASKYGIVRYVLAISLVLVVIAFAVAYMTSV* |
Ga0164305_105595854 | 3300012989 | Soil | IVESPSRARQGSKPGIVRYVLAISLALVVIAFAVAYMTSV* |
Ga0134079_106694362 | 3300014166 | Grasslands Soil | MDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAV |
Ga0137409_109989242 | 3300015245 | Vadose Zone Soil | MDQRIVASPEKARAARKYGVVRYILGISLVLVVIAFAVAYVISV* |
Ga0134072_100801282 | 3300015357 | Grasslands Soil | MEAAMDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIGFAVAYMTSV* |
Ga0066655_103528161 | 3300018431 | Grasslands Soil | MDDGRRIVESPSRARQANKPGIVRYVLAISLALVVIAFAVAYMTSV |
Ga0066655_108675852 | 3300018431 | Grasslands Soil | MDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV |
Ga0066667_103850253 | 3300018433 | Grasslands Soil | MDQRIDPRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV |
Ga0066667_106089151 | 3300018433 | Grasslands Soil | MDQDQRIVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVTSV |
Ga0066667_109030943 | 3300018433 | Grasslands Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIGFAVAYMTSV |
Ga0066667_122493001 | 3300018433 | Grasslands Soil | MDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAF |
Ga0066662_107038673 | 3300018468 | Grasslands Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTFV |
Ga0066662_125597532 | 3300018468 | Grasslands Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV |
Ga0066669_107990371 | 3300018482 | Grasslands Soil | RIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMSSV |
Ga0066669_121154501 | 3300018482 | Grasslands Soil | MDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFA |
Ga0179592_102959913 | 3300020199 | Vadose Zone Soil | MDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV |
Ga0179596_107119461 | 3300021086 | Vadose Zone Soil | MDQRIVLSPEKARAARKYGVLRYILGISLVLVVIAFAVAYVISV |
Ga0210400_1000373110 | 3300021170 | Soil | MDQRIVQTPTEARQGSKYGIVRYVLAISTALVVIGFAVAYITSV |
Ga0210408_108789222 | 3300021178 | Soil | MDQRIVQTPTEARQGSKPGIVRYVLAISTALVVIAFAVAYITSV |
Ga0213881_105681351 | 3300021374 | Exposed Rock | MDDGRRVVETPTEARAGSKSGVARYVLAISLALVVIAFAVAYITSV |
Ga0210384_100522976 | 3300021432 | Soil | MDQRIVLSPNQVRQGRKFGVVRYVLLISTLLVVIAFAVAYTLSV |
Ga0126371_102762881 | 3300021560 | Tropical Forest Soil | MDDGRRIVESPTRARQAGKYGVVRYVLAISLLLVVIAFAVAYMTSV |
Ga0212123_10000086323 | 3300022557 | Iron-Sulfur Acid Spring | MDQRIDQPIGQRIVQDPTRARQGSKPGIVRYVLVISTLLVVIAFAVAYMTSV |
Ga0212123_1000074477 | 3300022557 | Iron-Sulfur Acid Spring | MDQNIVSTPERARGARKAGVVRYVLAVSLLLVVIAFAVAYVTSV |
Ga0207646_102124964 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQRIVQSPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV |
Ga0207665_100965233 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDGRRIVESPSRARQASKYGIVRYVLEISLVLVVIAFAVAYMTSV |
Ga0209238_11136814 | 3300026301 | Grasslands Soil | DGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV |
Ga0209238_11696351 | 3300026301 | Grasslands Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMSSV |
Ga0209055_12823371 | 3300026309 | Soil | MDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYITSV |
Ga0209153_10473593 | 3300026312 | Soil | MDDGRRIVESPSRARQANKPGIVRYVLAISLALVVIAFAVAYMSAV |
Ga0209471_13170361 | 3300026318 | Soil | MDQRIVESPNQARAGRKYGVLRYVLLISTLLVVIAFAVAYTLSV |
Ga0209152_102315883 | 3300026325 | Soil | MDDGRRIVESPSRARQASKYGIVRYVLAISLALVVIAFAVAYMTSV |
Ga0209804_13036162 | 3300026335 | Soil | RIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV |
Ga0209056_103511701 | 3300026538 | Soil | MDQDQRVVETPERARSARKYGVLRYILGISLVLVVIAFAVAYVTSV |
Ga0209156_102415633 | 3300026547 | Soil | MDQRIVETPTAARQGSKYGIVRYVLAISTALVVIAFAVAY |
Ga0209474_102476963 | 3300026550 | Soil | MDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYITSV |
Ga0209648_101249673 | 3300026551 | Grasslands Soil | MDQRIVETPERARAARKNGVLRYILGISLVLVVIAFAVAYVISV |
Ga0208988_11024811 | 3300027633 | Forest Soil | MDQRIVQSPTKARQGSKYGIVRYVLAISTALVVIGFAVAYMTSV |
Ga0209810_10006148 | 3300027773 | Surface Soil | MPQRIVEDPTSARAGTKSGIVRYILAVSVALVVIAFIVAYFVTI |
Ga0209380_100722454 | 3300027889 | Soil | MDQRIVLSPNQVRQGGKFGVVRYVLLISTLLVVIAFAVAYTLSV |
Ga0209488_102005782 | 3300027903 | Vadose Zone Soil | MDRRIVLSPEKARAARKYGVLRYILGISLVLVVIAFAVAYVISV |
Ga0209526_108284211 | 3300028047 | Forest Soil | MDQRIVQTPTEARQGSKSGIVRYVLAISTALVVIAFAVAYITSV |
Ga0308309_103483984 | 3300028906 | Soil | SLGNIEGAIMDQRIVLSPNQVRQGGKFGVVRYVLLISTLLVVIAFAVAYTLSV |
Ga0308309_118778892 | 3300028906 | Soil | VERRVVESPQQARSAQKPGIVRYVLAVSLVLVVILFLVAYTI |
Ga0308189_102455991 | 3300031058 | Soil | ATTEAAMDDGRRIVESPSRARQASKPGIVRYVLAISLALVVIAFAVAYMTSV |
Ga0308189_105040502 | 3300031058 | Soil | RMEAAMDQRWDDQRIDQRIVETPTEARQGSKYGIVRYVLAISTALVVIAFAVAYMTSV |
Ga0308201_103856482 | 3300031091 | Soil | RRIDESPSRARQASKPGIVRYVVAISLALVVIAFAVAYMTSV |
Ga0307469_109317502 | 3300031720 | Hardwood Forest Soil | MDQRIVQSPTEARQGSKNGIVRYVLAISTALVVIAFAVAYITSV |
Ga0307470_105902822 | 3300032174 | Hardwood Forest Soil | MDQRIVQSPTEARQGSKNGIVRYVLAISTALVVIAFAVAYMTSV |
⦗Top⦘ |