 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F056563 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 137 |
| Average Sequence Length | 40 residues |
| Representative Sequence | DLVVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 137 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.54 % |
| % of genes from short scaffolds (< 2000 bps) | 92.70 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (86.131 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.788 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.175 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.124 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.38% β-sheet: 0.00% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 137 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 2.92 |
| PF01507 | PAPS_reduct | 1.46 |
| PF08299 | Bac_DnaA_C | 1.46 |
| PF07463 | NUMOD4 | 0.73 |
| PF00476 | DNA_pol_A | 0.73 |
| COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.46 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 86.13 % |
| All Organisms | root | All Organisms | 13.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.87% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.14% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 10.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 7.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.65% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.19% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.46% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.46% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.46% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.46% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.73% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.73% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.73% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.73% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.73% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.73% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.73% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.73% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.73% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.73% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
| 3300003824 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012740 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES018 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012741 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES014 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012745 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES017 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012748 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012785 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES011 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013063 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES051 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013076 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES042 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024541 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024550 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024850 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025420 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028247 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028530 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_3DRAFT_11339111 | 3300000229 | Groundwater | AEKALKALHKELPGELVTAISSGSTLAPESDPRPAYLQIGQQLRSALSKLQ* |
| B570J40625_1010035432 | 3300002835 | Freshwater | KKRHIAMPEGFTVSMSTGHTIAPESDPRPAVLTIGSDIRRAFSKLEAK* |
| Ga0007856_10101231 | 3300003815 | Freshwater | PDDLVMAISSGTTMASESDPRPAVLKIGQQMTAALSKLN* |
| Ga0007874_10089792 | 3300003824 | Freshwater | SNKAVLDDLVVAVSSGSTLVAENDPRPAVLNIGRQLTAALNKLN* |
| Ga0007746_14185561 | 3300004763 | Freshwater Lake | LPDDLVVAVSSGTTIAPESDPRPAVVLIGQQLNAALSKIM* |
| Ga0007745_13053741 | 3300004765 | Freshwater Lake | PDDLVVAVSSGTTIAPESDPRPAVVLIGQQLNAALSKIM* |
| Ga0007751_113416171 | 3300004794 | Freshwater Lake | PADLIVAVSSGSTLAPESDSRPAVLQIGQMLTKAMSKIQ* |
| Ga0007764_114350751 | 3300004797 | Freshwater Lake | PDDLVIAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ* |
| Ga0068885_15850092 | 3300005565 | Freshwater Lake | LVIAVSSGSTLAPESDPRPAVVPIGQTLKKAMAKIQ* |
| Ga0049080_100503961 | 3300005582 | Freshwater Lentic | TVAISSGNTIAPESDPRPAVVLIGQQLNAALSKLM* |
| Ga0049085_100613724 | 3300005583 | Freshwater Lentic | LKQALPDDLVASISSGTTLAPESDPRPEVLQIGQQLTAALSKLM* |
| Ga0078894_107897301 | 3300005662 | Freshwater Lake | VSVSSGDTLAPDSDPRPAVLQIGKQLTAALSKIQ* |
| Ga0079957_10327651 | 3300005805 | Lake | AEKAKIELPADLVVAVSTGSTLAPENDPRPAVLQIGQTLTKAMSKIQ* |
| Ga0007836_11138491 | 3300006107 | Freshwater | AISSGNTIAPESDPRPAVLQVGQHLRAAFSKLEVK* |
| Ga0007828_10695682 | 3300006128 | Freshwater | DLPKDHVVAISSGNTIAPESDPRPAVLQVGQHLRAAFSKLEVK* |
| Ga0075461_102656031 | 3300006637 | Aqueous | LALPDDLVIAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ* |
| Ga0070749_107371682 | 3300006802 | Aqueous | DDLVVAVSSGTTMAPESDPRPAVVQIGQTLVAALSKLQ* |
| Ga0070749_107587711 | 3300006802 | Aqueous | AVSSGNTLAPESDPRPAVLTIGNDIRRAFSKLEVK* |
| Ga0075472_103502952 | 3300006917 | Aqueous | DDLVIAVSSGSTLAPESDPRPAVASIGQTLKKAMAKIQ* |
| Ga0070748_10609231 | 3300006920 | Aqueous | EDLVVAVSSGSTLVADSDPRPAILNIGKQLADAVSKLN* |
| Ga0070748_13130381 | 3300006920 | Aqueous | LKKAKIELPADLVVAVSTGSTLAPPDDARPEVLQIGQMLTKAMSKLQ* |
| Ga0102978_13439304 | 3300007177 | Freshwater Lake | SKLALPDDLVVAVSSGSTLAPESDPRPAVLNLGTHLTTALSKLQ* |
| Ga0075460_103159512 | 3300007234 | Aqueous | PEGLIVAVSSGNTLAPESDPRPAVLTIGNDIRRAFSKLEVK* |
| Ga0075458_100484451 | 3300007363 | Aqueous | ELPDNLVVSVSTGTTLAPEKDPRPAVLQIGRTLSKAMAKIQ* |
| Ga0075458_100704081 | 3300007363 | Aqueous | IVAVSSGNTLAPESDPRPAVLTIGNDIRRAFSKLEVK* |
| Ga0105050_104939991 | 3300007516 | Freshwater | ADMVVAVSSGSTLAAESDPRPAVLQIGRQLAAAFAKIG* |
| Ga0099848_11060391 | 3300007541 | Aqueous | LVVSVSTGNTFAPESDPRPAVLQIGQQLTAALSKLI* |
| Ga0099846_10444431 | 3300007542 | Aqueous | SKLALPDDLVVAVSSGSTLAPESDPRPAVLNVGKQITAALSKLQ* |
| Ga0099846_11690351 | 3300007542 | Aqueous | LPLPDDLVVSVSTGNTFAPESDPRPAVLQIGPQLTAALSKLL* |
| Ga0105736_11217771 | 3300007861 | Estuary Water | IELPEDLVVSVSTGSTLAAESDPRPSVLQLGHTLKKAMAKLQ* |
| Ga0114840_10478801 | 3300008258 | Freshwater, Plankton | DLVVAVSSGSTLAPGNDPRPAVLQIGHTLKKAMAKIQ* |
| Ga0114841_12554182 | 3300008259 | Freshwater, Plankton | VVAVSSGTTLAPESDPRSAVLQIGKQLTAALSKIN* |
| Ga0114363_10818463 | 3300008266 | Freshwater, Plankton | QNLPDDLVIAVSSGSTLAPESDPRPAVVPIGQTLKKAMAKIQ* |
| Ga0114363_12017231 | 3300008266 | Freshwater, Plankton | MPDDQIISVSSGTTLAPESDPRPAVLQIGQQLTAALSKLV* |
| Ga0114876_11710882 | 3300008448 | Freshwater Lake | DDLVIAVSSGSTLAPESDPRPPVLNVGLHLTAALSKLQ* |
| Ga0105105_108809011 | 3300009009 | Freshwater Sediment | LKKAKKELPDDLVVAVSSGSTLAPESDPRPSVLQIGQTLSKAMAKIQ* |
| Ga0105093_106675692 | 3300009037 | Freshwater Sediment | PADLVVAVSTGSTLAPESDPRPAVLQIGQTLTKAMSKIQ* |
| Ga0105090_103781702 | 3300009075 | Freshwater Sediment | VVTSVSSGDTIAPESDPRPAKVLLGQQMTAALSKIV* |
| Ga0105090_107237071 | 3300009075 | Freshwater Sediment | QVVAVSSGSTLVEDSDPRPAVLQIGQQLTAALSKLQ* |
| Ga0105099_107332181 | 3300009082 | Freshwater Sediment | LPADLVVAVSTGSTLAPENDPRPEVLQIGQALRKAMSKIQ* |
| Ga0105103_102725551 | 3300009085 | Freshwater Sediment | VAVSSGSTLVEDSDPRPAVLQIGQQLTAALYKLQ* |
| Ga0105102_100575421 | 3300009165 | Freshwater Sediment | KLPDGLTVAISSGNTIAPESDPRPAVVLIGQQLNAALSKIM* |
| Ga0105102_108253142 | 3300009165 | Freshwater Sediment | LPANQVVAVSSGSTLVEESDPRPAVLQIGQQLTAALSKIQ* |
| Ga0114969_105391162 | 3300009181 | Freshwater Lake | VASVSSGTTFAPESDPRPEVLQIGSQLTAALSKLV* |
| Ga0114976_104216171 | 3300009184 | Freshwater Lake | QVVAVSSGSTMVEDSDPRPAVLQIGQQLTAALSKLQ* |
| Ga0114976_105696331 | 3300009184 | Freshwater Lake | HGKQLPANQVVAVSSGSTLVEESDSRPAVLQIGQQLTAALSKIQ* |
| Ga0118657_127080122 | 3300009506 | Mangrove Sediment | VALSSGTTMAPESDPRPAVVQIGQQLADAFKKLQ* |
| Ga0114958_102803091 | 3300009684 | Freshwater Lake | DLVVAVSSGSTLAPESDPRPAVLQIGHMLTKAMSKIQ* |
| Ga0129351_12696602 | 3300010300 | Freshwater To Marine Saline Gradient | DLVVSVSTGNTFAPESDPRPAVLQIGQQLTAALSKLL* |
| Ga0136655_12304471 | 3300010316 | Freshwater To Marine Saline Gradient | QAEQLVKKIPDELIKRVSSGTTMAEESDSRPAVLQIGQQLTAALSKLQ* |
| Ga0133913_128270303 | 3300010885 | Freshwater Lake | IAVSSGSTLAREEDPRPAVVQIGKQLVAALSKIQ* |
| Ga0136709_10111571 | 3300011184 | Freshwater | QVVAVSTGSTLAPESDPRPAVLQLGKQLSDAFSKLQ* |
| Ga0119951_10380534 | 3300012000 | Freshwater | DDLVVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ* |
| Ga0157138_10339141 | 3300012352 | Freshwater | VKSESSGTTMAPESDPRPAILQLGDLRATLSKLQ* |
| Ga0157607_11617572 | 3300012711 | Freshwater | LVVAVSSGSTLAPESDPRPAVLQIGRQLTAALTKL* |
| Ga0157604_12747052 | 3300012723 | Freshwater | VVAVSSGSTLAPESDPRPAVLQIGRQLTAALTKL* |
| Ga0157533_1135922 | 3300012740 | Freshwater | ADLVVAVSSGSTLAPESDPRPAVLQIGHALTKAMSKIQ* |
| Ga0157529_1411541 | 3300012741 | Freshwater | LVVAVSSGSTLAPESDPRPAVLQIGHALTKAMSKIQ* |
| Ga0157532_1391431 | 3300012745 | Freshwater | IELPADLVVAVSSGSTLAPESDPRPAVLQIGHALTKAMSKIQ* |
| Ga0157553_11212412 | 3300012748 | Freshwater | VAVSSGSTLAPESDPRPAVLQIGHALTKAMSKIQ* |
| Ga0157528_1363631 | 3300012785 | Freshwater | LPADLVVAVSSGTTLAPESDPRPAVLQIGHALTKAMSKIQ* |
| Ga0129337_13061761 | 3300012968 | Aqueous | LVASVSSGTTFAPESDPRPEVLQVGQQLTAALSKLV* |
| Ga0129337_13071191 | 3300012968 | Aqueous | LVASVSSGTTFAPESDPRPEVLQIGQQLTAALSKLV* |
| Ga0157558_1487932 | 3300013063 | Freshwater | DLVVAVSSGSTLAPESDPRPAVLQIGHALTKAMSKIQ* |
| Ga0157551_10724631 | 3300013076 | Freshwater | LVVAVSCNNTLAPGNDPRPAVLQIGHTLKKAMAKIQ* |
| (restricted) Ga0172365_108458911 | 3300013127 | Sediment | TMPEGLIVAISSGNTLAPESDPRPAVLTIGSDIRRAFSKLEVK* |
| Ga0134314_1040643 | 3300014711 | Surface Water | VVAVSSGTTMAPESDPRPAAVTIGATLVAALSKLQ* |
| (restricted) Ga0172376_104921631 | 3300014720 | Freshwater | QRSEKLPDDLVVAISSGSTVVPDSDPRPAVLHVGRQLIAALSKVV* |
| Ga0119954_10843231 | 3300014819 | Freshwater | VVAVSSGSTLAPESDPRPAVLNVGTHLTAALSKLQ* |
| Ga0181363_10114241 | 3300017707 | Freshwater Lake | TALPDDLVASVSSGTTFAPESDPRPEVLQIGQQLTAALSKII |
| Ga0181350_10880161 | 3300017716 | Freshwater Lake | PADLSVAVSSGSPLAPESDSRPAVLQIGQMLTKAMAKIQ |
| Ga0181350_11039001 | 3300017716 | Freshwater Lake | KAKIELPADLVVAVSSGSTLAPESDSRPAVLQIGQMLTKAMSKIQ |
| Ga0181347_10188531 | 3300017722 | Freshwater Lake | IVAVSSGSTLAPEKDSRPAVLQIGQMLTKAMAKIQ |
| Ga0181347_11357882 | 3300017722 | Freshwater Lake | DDLVASVSSGTTFAPESDPRPEVLQIGQHLTAALSKLV |
| Ga0181365_10650192 | 3300017736 | Freshwater Lake | KLPDGLTVAISSGNTIAPESDPRPSVVLIGQQLNAALSKIM |
| Ga0181352_10332943 | 3300017747 | Freshwater Lake | DLVVSVSTGNTIAPENDPRPEALQIGVHLRTALGKLS |
| Ga0181352_10945472 | 3300017747 | Freshwater Lake | LKKHGKQLPANQVVAVSSGSTLVEESDPRPAVLQIGQQLTAALSKIQ |
| Ga0181352_11210502 | 3300017747 | Freshwater Lake | KKLKLPMPDDQIISVSSGTTLAPESDPRPAVLQIGQQLTAALSKLV |
| Ga0181352_12083492 | 3300017747 | Freshwater Lake | HIAMPEGFTVSMSTGNTIAPESDPRPAVLTIGKDIRSAFSKLEVK |
| Ga0181344_10557541 | 3300017754 | Freshwater Lake | DLVVAVSRGSTLAREEDSRPAVVQIGKQLTAALSKIQ |
| Ga0181356_11188121 | 3300017761 | Freshwater Lake | ADLVVAVSSGNTLAPGNDPRPAVLQIGHTLKKAMAKIQ |
| Ga0181356_11245541 | 3300017761 | Freshwater Lake | KKMKIELPADLVVAVSTGNTLAPGNDPRPAVLQIGHTLKKAMAKIQ |
| Ga0181355_12131762 | 3300017785 | Freshwater Lake | LVVAVSSGNTLAPGNDPRPAVLQIGHTLKKAMAKIQ |
| Ga0180438_111407032 | 3300017971 | Hypersaline Lake Sediment | KLPLPDDLVVSVSTGNTFAPESDPRPAVLQIGQQLTAALSKLL |
| Ga0181359_11883002 | 3300019784 | Freshwater Lake | PADLIVAVSSGSTLAPESDSRPAVLQIGQMLTKAMAKIQ |
| Ga0214167_10663172 | 3300021136 | Freshwater | VAISSGNTVAPESDPRPAVLQVGQHLRAAFSKLEVK |
| Ga0222713_100677955 | 3300021962 | Estuarine Water | LPDDLVVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0222712_105368931 | 3300021963 | Estuarine Water | KKSKLALPDDLVIAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0181353_10135204 | 3300022179 | Freshwater Lake | ALPDDLVASVSSGTTFAPESDPRPEVLQIGQQLTAALSKII |
| Ga0181353_10249411 | 3300022179 | Freshwater Lake | RVAVSTGNTLAPESDPRPAVLQIGQMLSKAMAKIQ |
| Ga0256332_10555491 | 3300024484 | Freshwater | PDALVVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0256338_10870692 | 3300024536 | Freshwater | VVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0256343_10370081 | 3300024541 | Freshwater | LPDDLVVSVSSGSTIAPESDPRPAVLNIGKQITAALSKLQ |
| Ga0255266_10728042 | 3300024550 | Freshwater | LVVAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ |
| Ga0255280_10606512 | 3300024555 | Freshwater | DLVVAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ |
| Ga0255273_10769622 | 3300024565 | Freshwater | DHLVVAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ |
| Ga0255276_11015211 | 3300024570 | Freshwater | LVVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0255275_10485844 | 3300024574 | Freshwater | DLVVAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0255282_10368631 | 3300024850 | Freshwater | MVTSISSGSTLAPESDPRPEVLQIGKQLAAALSKLQ |
| Ga0208874_10325881 | 3300025396 | Freshwater | LPKDHVVAISSGNTIAPESDPRPAVLQVGQHLRAAFSKLEVK |
| Ga0208251_10581362 | 3300025398 | Freshwater | QLPANQVVAVSSGSTLAEESDPRPAVLQIGQQLTAALSKLQ |
| Ga0208107_10613541 | 3300025399 | Freshwater | PKDHVVAISSGNTVAPESDPRPAVLQVGQHLRAAFSKLEVK |
| Ga0208111_10726111 | 3300025420 | Freshwater | KDHVVAISTGNTIAPESDPRPAVLQVGQHLRAAFSKLEVK |
| Ga0208497_10132881 | 3300025466 | Freshwater | LDLPKDHVVAISSGNTIAPESDPRPAVLQVGQHLRAAFSKLEVK |
| Ga0208643_11728642 | 3300025645 | Aqueous | EDLVVAVSSGSTLVADSDPRPAILNIGKQLADAVSKLN |
| Ga0208161_11111543 | 3300025646 | Aqueous | VVSVSTGNTFAPESDPRPAVLQIGKQLTQALEKLL |
| Ga0208795_10978251 | 3300025655 | Aqueous | KKLKLRLPDDLVVSVSTGNTFAPESDPRPAVLQIGQQLTAALSKLL |
| Ga0208644_12572632 | 3300025889 | Aqueous | LPAEVVTSVSSGDTIAPESDPRPAKVLLGQQMTAALSKIS |
| Ga0255277_11363462 | 3300026569 | Freshwater | PDDLVVSVSSGSTIAPESDPRPAVLNIGKQITAALSKLQ |
| Ga0255270_10918672 | 3300026572 | Freshwater | VVAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ |
| Ga0255270_11816892 | 3300026572 | Freshwater | VTSISSGSTLAPESDPRPEVLQIGKQLAAALSKLQ |
| Ga0209392_11030201 | 3300027683 | Freshwater Sediment | KAKIELPDDLVVAVSTGSTLAPENDPRPAVLQIGHSLKKAMAKLQ |
| Ga0209599_100073175 | 3300027710 | Deep Subsurface | KKSKTALPDDLVKSVSSGTTMAPESDPRPAILQLGDLRATLSKLQ |
| Ga0209593_101231193 | 3300027743 | Freshwater Sediment | DGLTVAISSGNTIAPESDPRPAVVLIGQQLNAALSKLM |
| Ga0209668_108918601 | 3300027899 | Freshwater Lake Sediment | VAAISSGNTIAPESDPRPSVVQVGSQLRAAFSKLEVK |
| Ga0209298_101318621 | 3300027973 | Freshwater Lake | VLKKHGKQLPADQVVAVSSGSTMVEDSDPRPTVLQIGQQLTAALSKLQ |
| (restricted) Ga0247835_10517314 | 3300028114 | Freshwater | KQLPADQVVAVSSGSTLVAESDPRPAVLQIGQQLSAALSKLI |
| Ga0265593_10696022 | 3300028178 | Saline Water | ETSLISPAVAEKALKKLGLSLPEGTVVAVSSGNTLATEDDPRPAVLQIGQQLSKALGKLV |
| Ga0256346_1149681 | 3300028247 | Freshwater | VVSVSSGSTIAPESDPRPAVLNIGKQITAALSKLQ |
| Ga0255279_10513901 | 3300028530 | Freshwater | DDLVVSVSSGSTIAPESDPRPAVLNIGKQITAALSKLQ |
| (restricted) Ga0247840_105815551 | 3300028581 | Freshwater | ELPADLVVAVSTGNTLAPGNDPRPAVLQIGHTLKKAMAKIQ |
| Ga0315909_106066151 | 3300031857 | Freshwater | ALPDELVVAVSSGSTVVPESDPRPAVLNIGRQLTAALTKLR |
| Ga0315904_110330741 | 3300031951 | Freshwater | PDDLVVAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ |
| Ga0315904_111009591 | 3300031951 | Freshwater | DDLVIAVSSGSTLAPESDPRPAVLNVGLHLTAALSKLQ |
| Ga0315902_108451042 | 3300032093 | Freshwater | KRKQALPDDLVVAVSSGTTIASESDPRPAVIQISSQLRAAISKLQ |
| Ga0315903_104363361 | 3300032116 | Freshwater | QLPAELAPAVSSGSTLAPESDPRPAVLQIGQMLSKAMAKIQ |
| Ga0315270_108297031 | 3300032275 | Sediment | LIVAVSSGSTLAPESDSRPAVLQIGQMLTKAMSKIQ |
| Ga0316627_1019855752 | 3300033482 | Soil | PGDLVVAVSSGSTLAPESDPRPAVVSIGQTLSKAMAKIQ |
| Ga0316626_115002232 | 3300033485 | Soil | LPGGLAVSVSSGDTIAPESDPRPAKVLLAQQMAAALSKL |
| Ga0316616_1018360811 | 3300033521 | Soil | PPDLIVSVSSGNTIAPESDPRPAVLTIGSDIRRAFSKLEVK |
| Ga0334994_0335824_644_754 | 3300033993 | Freshwater | DLVVSVSTGNTIAPESDPRPEALQIGRQLAAALGKL |
| Ga0334998_0639820_456_572 | 3300034019 | Freshwater | DDLVVAVSSGSTLAPESDPRPAVLNVGMHLTAALFKLQ |
| Ga0335001_0052017_2243_2371 | 3300034064 | Freshwater | MPEGLIVAVSSGNTLAPESDPRPAVLTIGSDIRRAFSKLEVK |
| Ga0335053_0548669_3_137 | 3300034118 | Freshwater | SKLALPDDLVIAVSSGSTLAPESDPRPAVLNVGMHLTAALSKLQ |
| Ga0335065_0091225_3_131 | 3300034200 | Freshwater | KVLPEGLTVMASSGTTLASESDSRPAVLQIGQQLTAALSKLV |
| Ga0335065_0479938_3_140 | 3300034200 | Freshwater | KAKVELPAELAPAVSTGSTLAPESDPRPAVLQIGQTLSKAMAKIQ |
| Ga0335052_0053438_2377_2493 | 3300034279 | Freshwater | EGLTVVASSGTTLASESDSRPAVLQIGQQLTAALSKLV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |