Metagenome / Metatranscriptome Family F056637

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F056637
Family Type	Metagenome / Metatranscriptome
Number of Sequences	137
Average Sequence Length	46 residues
Representative Sequence	VIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV
Number of Associated Samples	58
Number of Associated Scaffolds	136

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	5.88 %
% of genes near scaffold ends (potentially truncated)	94.16 %
% of genes from short scaffolds (< 2000 bps)	97.08 %
Associated GOLD sequencing projects	55
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (88.321 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (58.394 % of family members)
Environment Ontology (ENVO)	Unclassified (98.540 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (59.854 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 66.67% Coil/Unstructured: 33.33%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 136 Family Scaffolds
PF06739	SBBP	0.74

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.32 %
Unclassified	root	N/A	11.68 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	88.32 %
Unclassified	root	N/A	11.68 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	88.32 %
Unclassified	root	N/A	11.68 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	87.59 %
Unclassified	root	N/A	11.68 %
Elusimicrobia	phylum	All Organisms → cellular organisms → Bacteria → Elusimicrobia	0.73 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	87.59 %
Unclassified	root	N/A	11.68 %
unclassified Elusimicrobiota	no rank	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota	0.73 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	87.59 %
Unclassified	root	N/A	11.68 %
Elusimicrobia bacterium GWA2_38_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	0.73 %

Name	Rank	Taxonomy	Distribution
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	82.48 %
Unclassified	root	N/A	11.68 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	2.19 %
Elusimicrobia bacterium GWA2_38_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	0.73 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	82.48 %
Unclassified	root	N/A	11.68 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	2.19 %
Elusimicrobia bacterium GWA2_38_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	0.73 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	82.48 %
Unclassified	root	N/A	11.68 %
Salibacteraceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Salibacteraceae	1.46 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.73 %
Elusimicrobia bacterium GWA2_38_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	0.73 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	82.48 %
Unclassified	root	N/A	11.68 %
Salibacter	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Salibacteraceae → Salibacter	1.46 %
Flavobacterium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium	0.73 %
Elusimicrobia bacterium GWA2_38_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	0.73 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	82.48 %
Unclassified	root	N/A	11.68 %
Salibacter halophilus	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Salibacteraceae → Salibacter → Salibacter halophilus	1.46 %
Flavobacterium branchiophilum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium branchiophilum	0.73 %
Elusimicrobia bacterium GWA2_38_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005492\|Ga0068665_116123	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	594	Open in IMG/M
3300005494\|Ga0068668_1013369	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1212	Open in IMG/M
3300005494\|Ga0068668_1038438	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	574	Open in IMG/M
3300005494\|Ga0068668_1115839	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	638	Open in IMG/M
3300005495\|Ga0068666_1034038	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	654	Open in IMG/M
3300005495\|Ga0068666_1046952	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	630	Open in IMG/M
3300005497\|Ga0068648_1005798	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	559	Open in IMG/M
3300005497\|Ga0068648_1019188	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	526	Open in IMG/M
3300005498\|Ga0068649_1014321	Not Available	505	Open in IMG/M
3300005501\|Ga0068650_1007003	Not Available	581	Open in IMG/M
3300005501\|Ga0068650_1014022	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1418	Open in IMG/M
3300005501\|Ga0068650_1014170	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	848	Open in IMG/M
3300005501\|Ga0068650_1026955	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	552	Open in IMG/M
3300005501\|Ga0068650_1135476	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	521	Open in IMG/M
3300005501\|Ga0068650_1136488	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	925	Open in IMG/M
3300005638\|Ga0068669_1165608	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1167	Open in IMG/M
3300006380\|Ga0068664_1079641	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	611	Open in IMG/M
3300006380\|Ga0068664_1086784	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	620	Open in IMG/M
3300006380\|Ga0068664_1095321	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	714	Open in IMG/M
3300006380\|Ga0068664_1128706	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	643	Open in IMG/M
3300006380\|Ga0068664_1184930	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	588	Open in IMG/M
3300006848\|Ga0101768_1008161	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	726	Open in IMG/M
3300006848\|Ga0101768_1028958	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	600	Open in IMG/M
3300006848\|Ga0101768_1106605	Not Available	945	Open in IMG/M
3300006849\|Ga0102029_1086922	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	874	Open in IMG/M
3300007000\|Ga0102499_1020034	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	819	Open in IMG/M
3300007000\|Ga0102499_1122006	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Salibacteraceae → Salibacter → Salibacter halophilus	526	Open in IMG/M
3300007000\|Ga0102499_1124781	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	534	Open in IMG/M
3300007000\|Ga0102499_1130832	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	847	Open in IMG/M
3300010184\|Ga0124920_1115137	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	614	Open in IMG/M
3300010186\|Ga0124916_1026212	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	578	Open in IMG/M
3300010190\|Ga0124925_1068548	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	516	Open in IMG/M
3300010190\|Ga0124925_1069218	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	500	Open in IMG/M
3300010190\|Ga0124925_1081630	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	591	Open in IMG/M
3300010191\|Ga0124914_1010813	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	546	Open in IMG/M
3300010194\|Ga0124921_1019825	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	620	Open in IMG/M
3300010195\|Ga0124911_1092644	Not Available	612	Open in IMG/M
3300010197\|Ga0124922_1202663	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	837	Open in IMG/M
3300010197\|Ga0124922_1203022	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7	1492	Open in IMG/M
3300010255\|Ga0124910_1068752	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	514	Open in IMG/M
3300010255\|Ga0124910_1147257	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	657	Open in IMG/M
3300010256\|Ga0124939_1037212	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	507	Open in IMG/M
3300010257\|Ga0124913_1009882	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	510	Open in IMG/M
3300010257\|Ga0124913_1152985	Not Available	503	Open in IMG/M
3300010257\|Ga0124913_1231648	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	612	Open in IMG/M
3300026237\|Ga0209750_1040330	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	888	Open in IMG/M
3300026237\|Ga0209750_1047240	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	800	Open in IMG/M
3300026237\|Ga0209750_1070111	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	615	Open in IMG/M
3300026237\|Ga0209750_1085807	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	535	Open in IMG/M
3300026280\|Ga0209017_10039156	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1149	Open in IMG/M
3300026509\|Ga0209809_1088876	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	814	Open in IMG/M
3300026509\|Ga0209809_1105057	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	710	Open in IMG/M
3300027279\|Ga0209691_1012983	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	2423	Open in IMG/M
3300027279\|Ga0209691_1032197	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1125	Open in IMG/M
3300027279\|Ga0209691_1052290	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	781	Open in IMG/M
3300031245\|Ga0308395_1034552	Not Available	1458	Open in IMG/M
3300031245\|Ga0308395_1041559	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1264	Open in IMG/M
3300031245\|Ga0308395_1044200	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1207	Open in IMG/M
3300031245\|Ga0308395_1063902	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	917	Open in IMG/M
3300031245\|Ga0308395_1068904	Not Available	868	Open in IMG/M
3300031245\|Ga0308395_1100137	Not Available	664	Open in IMG/M
3300031245\|Ga0308395_1102362	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Salibacteraceae → Salibacter → Salibacter halophilus	654	Open in IMG/M
3300031245\|Ga0308395_1104380	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	645	Open in IMG/M
3300031245\|Ga0308395_1111624	Not Available	616	Open in IMG/M
3300031508\|Ga0308394_1013693	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium branchiophilum	2589	Open in IMG/M
3300031509\|Ga0308399_1040393	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1068	Open in IMG/M
3300031509\|Ga0308399_1061387	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	803	Open in IMG/M
3300031509\|Ga0308399_1088263	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	628	Open in IMG/M
3300031509\|Ga0308399_1092666	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	607	Open in IMG/M
3300031512\|Ga0308397_1026486	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1621	Open in IMG/M
3300031512\|Ga0308397_1029138	Not Available	1513	Open in IMG/M
3300031512\|Ga0308397_1048429	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1047	Open in IMG/M
3300031512\|Ga0308397_1083740	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	706	Open in IMG/M
3300031512\|Ga0308397_1097606	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	634	Open in IMG/M
3300031512\|Ga0308397_1102434	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	613	Open in IMG/M
3300031512\|Ga0308397_1132507	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	513	Open in IMG/M
3300031514\|Ga0308390_1054857	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	998	Open in IMG/M
3300031515\|Ga0308396_1044229	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1022	Open in IMG/M
3300031515\|Ga0308396_1068130	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	757	Open in IMG/M
3300031516\|Ga0308398_1048878	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1055	Open in IMG/M
3300031517\|Ga0308392_1118135	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	533	Open in IMG/M
3300031518\|Ga0308389_1070513	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	864	Open in IMG/M
3300031518\|Ga0308389_1107058	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	622	Open in IMG/M
3300031567\|Ga0308391_1016629	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1883	Open in IMG/M
3300031567\|Ga0308391_1037137	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1126	Open in IMG/M
3300031568\|Ga0308393_1080251	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	714	Open in IMG/M
3300031767\|Ga0308401_1048355	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	868	Open in IMG/M
3300031767\|Ga0308401_1066049	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	715	Open in IMG/M
3300031767\|Ga0308401_1068600	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	699	Open in IMG/M
3300031767\|Ga0308401_1081810	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	628	Open in IMG/M
3300031767\|Ga0308401_1109683	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	525	Open in IMG/M
3300031767\|Ga0308401_1116071	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	507	Open in IMG/M
3300031783\|Ga0308418_1049550	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1032	Open in IMG/M
3300031783\|Ga0308418_1050476	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1018	Open in IMG/M
3300031783\|Ga0308418_1053473	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	979	Open in IMG/M
3300031783\|Ga0308418_1059041	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	913	Open in IMG/M
3300031783\|Ga0308418_1065616	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	848	Open in IMG/M
3300031783\|Ga0308418_1122441	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	555	Open in IMG/M
3300031830\|Ga0308409_1093903	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	673	Open in IMG/M
3300031830\|Ga0308409_1122573	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	560	Open in IMG/M
3300031865\|Ga0308408_1021041	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1816	Open in IMG/M
3300031865\|Ga0308408_1050300	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1020	Open in IMG/M
3300031875\|Ga0308405_1020883	Not Available	2149	Open in IMG/M
3300031875\|Ga0308405_1082353	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	809	Open in IMG/M
3300031875\|Ga0308405_1084719	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	793	Open in IMG/M
3300031875\|Ga0308405_1134687	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	575	Open in IMG/M
3300031878\|Ga0308404_1038983	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	988	Open in IMG/M
3300031878\|Ga0308404_1038983	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	988	Open in IMG/M
3300031878\|Ga0308404_1046423	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	889	Open in IMG/M
3300031948\|Ga0308406_1057724	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	857	Open in IMG/M
3300031948\|Ga0308406_1079433	Not Available	689	Open in IMG/M
3300031948\|Ga0308406_1097123	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	602	Open in IMG/M
3300031948\|Ga0308406_1117158	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	530	Open in IMG/M
3300031948\|Ga0308406_1119148	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	524	Open in IMG/M
3300031950\|Ga0308417_1176173	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	683	Open in IMG/M
3300031950\|Ga0308417_1260777	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	519	Open in IMG/M
3300031966\|Ga0308420_1072694	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1172	Open in IMG/M
3300031966\|Ga0308420_1198995	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	574	Open in IMG/M
3300031966\|Ga0308420_1209893	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	553	Open in IMG/M
3300031980\|Ga0308403_1093381	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	587	Open in IMG/M
3300032033\|Ga0308402_1094144	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	568	Open in IMG/M
3300032034\|Ga0308407_1096303	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	607	Open in IMG/M
3300032034\|Ga0308407_1117669	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	530	Open in IMG/M
3300032045\|Ga0308400_1117286	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	532	Open in IMG/M
3300032056\|Ga0308310_1067918	Not Available	935	Open in IMG/M
3300032056\|Ga0308310_1083064	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	800	Open in IMG/M
3300032056\|Ga0308310_1094163	Not Available	726	Open in IMG/M
3300032056\|Ga0308310_1114704	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	625	Open in IMG/M
3300032057\|Ga0308421_1038192	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	1423	Open in IMG/M
3300032057\|Ga0308421_1071453	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	902	Open in IMG/M
3300033886\|Ga0308413_090621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	778	Open in IMG/M
3300034449\|Ga0372963_22026	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	580	Open in IMG/M
3300034647\|Ga0372968_026117	Not Available	794	Open in IMG/M
3300034648\|Ga0372970_026424	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	917	Open in IMG/M
3300034650\|Ga0372973_043788	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	640	Open in IMG/M
3300034696\|Ga0370516_195642	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	605	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.27%
Terrestrial	Environmental → Terrestrial	0.73%

Habitat	Taxonomy	Distribution
Thermal Springs	Environmental → Aquatic → Thermal Springs	99.27%
Peat	Environmental → Terrestrial → Peat	0.73%

Habitat	Taxonomy	Distribution
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	99.27%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	99.27%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	58.39%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	36.50%
Anoxygenic And Chlorotrophic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic	3.65%
Hot Spring Water	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Water	0.73%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.73%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005492	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005494	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005495	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005497	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005498	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005501	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005638	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006380	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006848	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300006849	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007000	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010184	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010186	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010190	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010191	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010194	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010195	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010197	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1000_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010255	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010256	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010257	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300026237	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)	Environmental	Open in IMG/M
3300026280	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes)	Environmental	Open in IMG/M
3300026509	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)	Environmental	Open in IMG/M
3300027279	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)	Environmental	Open in IMG/M
3300031245	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4	Environmental	Open in IMG/M
3300031508	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2	Environmental	Open in IMG/M
3300031509	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60	Environmental	Open in IMG/M
3300031512	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8	Environmental	Open in IMG/M
3300031514	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149	Environmental	Open in IMG/M
3300031515	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2	Environmental	Open in IMG/M
3300031516	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9	Environmental	Open in IMG/M
3300031517	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2	Environmental	Open in IMG/M
3300031518	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148	Environmental	Open in IMG/M
3300031567	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1	Environmental	Open in IMG/M
3300031568	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2	Environmental	Open in IMG/M
3300031767	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1	Environmental	Open in IMG/M
3300031783	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd	Environmental	Open in IMG/M
3300031830	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4	Environmental	Open in IMG/M
3300031865	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3	Environmental	Open in IMG/M
3300031875	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13	Environmental	Open in IMG/M
3300031878	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031948	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1	Environmental	Open in IMG/M
3300031950	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65	Environmental	Open in IMG/M
3300031966	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55	Environmental	Open in IMG/M
3300031980	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3	Environmental	Open in IMG/M
3300032033	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2	Environmental	Open in IMG/M
3300032034	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2	Environmental	Open in IMG/M
3300032045	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65	Environmental	Open in IMG/M
3300032056	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65	Environmental	Open in IMG/M
3300032057	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60	Environmental	Open in IMG/M
3300033886	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd	Environmental	Open in IMG/M
3300034449	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_2000_MSt2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034647	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034648	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1000_MSt9 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034650	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034696	Hot spring water microbial communities from Yellowstone National Park, WY, United States - YNP_Buffalopool_103118	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068665_1161231	3300005492	Anoxygenic And Chlorotrophic Microbial Mat	WLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068668_10133694	3300005494	Anoxygenic And Chlorotrophic Microbial Mat	MIGVIAVFTQTVWLSVPGAKVSVMVLLGRTMMVPVAVTFPQPPVRVTV*
Ga0068668_10384381	3300005494	Anoxygenic And Chlorotrophic Microbial Mat	PVVLYVIGVIAVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068668_11158393	3300005494	Anoxygenic And Chlorotrophic Microbial Mat	IGVIAVFTQTVWLFVPGAEVRVMVLLGCTMIVPVAVTFPQPPVRVTV*
Ga0068666_10340383	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	ENVAPVAPVVLYVIGVMGVSTQTVWLSVPGAEVRVMVLLGRTMMVPVAVVTPPQPPVKVTV*
Ga0068666_10469523	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	APVVLYVIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPAAVTFPQPPVRVTV*
Ga0068648_10057983	3300005497	Anoxygenic And Chlorotrophic Microbial Mat	WLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068648_10191881	3300005497	Anoxygenic And Chlorotrophic Microbial Mat	WLSVPGAEVSVMVLLGCTMMVPVAVIFPQPPVKVTV*
Ga0068649_10143211	3300005498	Anoxygenic And Chlorotrophic Microbial Mat	VIAVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068650_10070033	3300005501	Anoxygenic And Chlorotrophic Microbial Mat	VWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068650_10140226	3300005501	Anoxygenic And Chlorotrophic Microbial Mat	PVVLYVIGVIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVIFPQPPVRVTV*
Ga0068650_10141701	3300005501	Anoxygenic And Chlorotrophic Microbial Mat	LYVIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068650_10269551	3300005501	Anoxygenic And Chlorotrophic Microbial Mat	VAPVVLYVIGVIAVFTQTVWLSVPGAEVSVMLGCTMMVPVAVTFLQPPVRVTV*
Ga0068650_11354762	3300005501	Anoxygenic And Chlorotrophic Microbial Mat	VWLFVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068650_11364881	3300005501	Anoxygenic And Chlorotrophic Microbial Mat	WLFVPGAEVRVMVLLGCTMMVPVAVTSPQSLVKVTV*
Ga0068669_11656081	3300005638	Anoxygenic And Chlorotrophic Microbial Mat	WLFVPGAEVSVMVVLLGRTMMVPVAVTFPQPPVKVTV*
Ga0068664_10796413	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	IAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0068664_10867843	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	IGVIAVFTQTVWLSVPGAEASVMALSGCTTMVPVAVTFPQPPVRVTV*
Ga0068664_10953213	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	VIGVIGVFTQTVWLSVPGAEVRVMVLLGRTVMVPVAVTFPQPPVK
Ga0068664_11287063	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	NVAPVAPVVLYVIGVIAVFTQTVWLSVPGAEVRVMVLSGCTMMVPVAVTFPQPPVKVTV*
Ga0068664_11849303	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	MAVFTQTVWLFVPVAEVRVMVLFGCTVMVPVAVTFPQPPVRVTV*
Ga0101768_10081613	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	LFVPGAEVSVMVGLLGCTMMVPVAVTFPQPPVRVTV*
Ga0101768_10289583	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	VFTQTVWLSVPVAEVSVMVLFGCTMMVPVAVTFPQPPVKVTV*
Ga0101768_11066051	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	FVPGAEVRVMVLLGRTVMVPVAVTFPQPPVKVTV*
Ga0102029_10869224	3300006849	Anoxygenic And Chlorotrophic Microbial Mat	VFTQTVWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV*
Ga0102499_10200341	3300007000	Anoxygenic And Chlorotrophic Microbial Mat	VIGVIAVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0102499_11220063	3300007000	Anoxygenic And Chlorotrophic Microbial Mat	WLSVPGAEVSVMLGCTMMVPVAVTFPQPPVKVTV*
Ga0102499_11247813	3300007000	Anoxygenic And Chlorotrophic Microbial Mat	VLYVIGVIAVFTQTVWLSVPGAEVSVMLGCTMMVPVAVTFLQPPVRVTV*
Ga0102499_11308324	3300007000	Anoxygenic And Chlorotrophic Microbial Mat	VLYVIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV*
Ga0124920_11151373	3300010184	Anoxygenic And Chlorotrophic Microbial Mat	VWLFVPGAEVSVMVLLGRTMMVPVAVTFPQPPVRVTV*
Ga0124916_10262121	3300010186	Anoxygenic And Chlorotrophic Microbial Mat	PVVLYVIGVIAVFTQTVWLFGPDAGVRVMAVLGCTVIVPVAVTSPQSPVTVTV*
Ga0124925_10685482	3300010190	Anoxygenic And Chlorotrophic Microbial Mat	VIAVFTQTVWLFVPGAEVRVMVLLGRTVMVPVAVTFPQPPVKVTV*
Ga0124925_10692183	3300010190	Anoxygenic And Chlorotrophic Microbial Mat	VIAVFTQTVWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV*
Ga0124925_10816301	3300010190	Anoxygenic And Chlorotrophic Microbial Mat	LIGVIAVFTQTVWLFVPGAEVSVMVVLLGRTMMVPVAVTFPQPPVKVTV*
Ga0124914_10108133	3300010191	Anoxygenic And Chlorotrophic Microbial Mat	LYVIGVIAVFTQTVWLFVPGAEVRVMVLLGCTMMVPVAITFPQPPVRVTV*
Ga0124921_10198253	3300010194	Anoxygenic And Chlorotrophic Microbial Mat	VPGAEVRVMVLLGCTMMVPVAVVTPPQPPVRVTV*
Ga0124911_10926443	3300010195	Anoxygenic And Chlorotrophic Microbial Mat	APVAPVVLYVIGVIAVFTQTVWLSVPGAEVSVMVGCTMRVPVAVVKPPQPPVRITV*
Ga0124922_12026631	3300010197	Anoxygenic And Chlorotrophic Microbial Mat	VLYLISVIGVFTQTVWLFVPGAEVRVMVLLGCTMIVPVAVTFPQPPVRVTV*
Ga0124922_12030221	3300010197	Anoxygenic And Chlorotrophic Microbial Mat	WLSVPGSEVRVMVLLGCTMMVPVAVTFPQPPVKVTV*
Ga0124910_10687523	3300010255	Anoxygenic And Chlorotrophic Microbial Mat	VWLFVPGAEVRVMVLLGCTMMVPVAITFPQPPVRVTV*
Ga0124910_11472571	3300010255	Anoxygenic And Chlorotrophic Microbial Mat	VLYVIGVIAVFTQTVWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV*
Ga0124939_10372123	3300010256	Anoxygenic And Chlorotrophic Microbial Mat	VFTQTVWLFVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV*
Ga0124913_10098823	3300010257	Anoxygenic And Chlorotrophic Microbial Mat	AVFTQTVWLSVPGAEVSVMLGCTVMVPVAVTFPQPPVRVTV*
Ga0124913_11529852	3300010257	Anoxygenic And Chlorotrophic Microbial Mat	VVLYVIGVIAVFTQTVWLFVPGAEVRVMVLLGRTMMVPVAAVTLPQPPVRVTV*
Ga0124913_12316483	3300010257	Anoxygenic And Chlorotrophic Microbial Mat	ENVAPVAPVVLYVIGVIAVFTQTVWLSVPGAEVSVMLGCTMMVPLAVTFPQPPVKVTV*
Ga0209750_10403301	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	PVAPVVLYVIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPAAVTFPQPPVRVTV
Ga0209750_10472404	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	VFTQTVWLFVPGAEVRVMVLLGCTMIVPVAVTFPQPPVRVTV
Ga0209750_10701113	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	LSVPGAEVSVMVLLVLLSCTMMVPVAVVTPPQPPVRVTV
Ga0209750_10858073	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	PVAPVVLYMIGVIAVFTQTVWLSVPGAEASVMALSGCTTMVPVAVTFPQPPVRVTV
Ga0209017_100391563	3300026280	Anoxygenic And Chlorotrophic Microbial Mat	MIGVIAVFTQTVWLSVPGAKVSVMVLLGRTMMVPVAVTFPQPPVRVTV
Ga0209809_10888764	3300026509	Anoxygenic And Chlorotrophic	PVAPVVLYVIGVIAVFTQTVWLSVPGAEVSVMLGCTMMVPVAVTFPQPPVKVTV
Ga0209809_11050571	3300026509	Anoxygenic And Chlorotrophic	APVVLYVIGVIAVFTQTVWLSVPGAEVRVMVLSGCTMMVPVAVTFPQPPVRVTV
Ga0209691_10129831	3300027279	Anoxygenic And Chlorotrophic	IAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0209691_10321975	3300027279	Anoxygenic And Chlorotrophic	APVVLYVIGVIAVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0209691_10522901	3300027279	Anoxygenic And Chlorotrophic	VFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVTFPQPPVKVTV
Ga0308395_10345521	3300031245	Hot Spring Phototrophic Mat	IGVIAVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVGVTV
Ga0308395_10415591	3300031245	Hot Spring Phototrophic Mat	YVIGVIGVFTQTVWLFVPGAEVRVMVLLGRTMMVPVAVTFPQPPVRVTV
Ga0308395_10442005	3300031245	Hot Spring Phototrophic Mat	LYVIGVMAVFTQTVWLFVPEAEVRVMVLFGCTMMVPVAVTFPQPPVKVTV
Ga0308395_10639024	3300031245	Hot Spring Phototrophic Mat	PVVLYVIRVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308395_10689041	3300031245	Hot Spring Phototrophic Mat	VIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308395_11001373	3300031245	Hot Spring Phototrophic Mat	VIGVVAVFTQTVWLFVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0308395_11023623	3300031245	Hot Spring Phototrophic Mat	TQTVWLSVPAPEERVMVLSGCTMMVPVAVTFPQPPVRVTV
Ga0308395_11043803	3300031245	Hot Spring Phototrophic Mat	IGVIAVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308395_11116243	3300031245	Hot Spring Phototrophic Mat	VLYVIGVMGVSTQTVWLSVPGAEVRVMVLLGRTMMVPVAVTFPQPPVRVTV
Ga0308394_10136931	3300031508	Hot Spring Phototrophic Mat	VWLSVPGAEVRVMVLLGRTVMVPVAVTFPQPPVKVTV
Ga0308399_10403934	3300031509	Hot Spring Phototrophic Mat	KPENVAPVAPVVLYAIGVIAVFTQTVWLSVPGAEVRVMLGCTMMVPVAVTFPQPPVKVTV
Ga0308399_10613871	3300031509	Hot Spring Phototrophic Mat	VIGVMAVFTQTVWLSVPEAEVRVMVLSGCTVMVPVAVTFPQPPVRVTV
Ga0308399_10882631	3300031509	Hot Spring Phototrophic Mat	APVVLYVIGVIAVFTQTVWLSVPGAEVRVMVLLGRTMMVPVAVTFPQPPVRVTM
Ga0308399_10926661	3300031509	Hot Spring Phototrophic Mat	VIALFTQTVWLAVPGAEVSVMAVLGCTVIVPVAVTSPQSPVTVTV
Ga0308397_10264866	3300031512	Hot Spring Phototrophic Mat	TVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVGVTV
Ga0308397_10291381	3300031512	Hot Spring Phototrophic Mat	AVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0308397_10484295	3300031512	Hot Spring Phototrophic Mat	TQTVWLFVPGAEVSVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308397_10837401	3300031512	Hot Spring Phototrophic Mat	PVVLYVIGVMGVFTQTVWLFVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308397_10976061	3300031512	Hot Spring Phototrophic Mat	APVVLYVIGVMAVFTQTVWLFVPEAEVRVMVLFGCTMMVPVAVTFPQPPVKVTV
Ga0308397_11024341	3300031512	Hot Spring Phototrophic Mat	GKSANVATVAPVVLYVIGVIAVFTQTVWLSVPGAEVRVMLGCTMMVPVAVTFPQPPVKVT
Ga0308397_11325072	3300031512	Hot Spring Phototrophic Mat	VIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVTPPQPPVKVTV
Ga0308390_10548574	3300031514	Hot Spring Phototrophic Mat	IPVFTQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVKITV
Ga0308396_10442294	3300031515	Hot Spring Phototrophic Mat	YVIGVIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVIFPQPPVRVTV
Ga0308396_10681303	3300031515	Hot Spring Phototrophic Mat	IRVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308398_10488781	3300031516	Hot Spring Phototrophic Mat	NVAPVAPVVLYVIGVIAVSTQTVWLFVPGAEVRVMVLLGRTTMVPVAVTFPQPPVRVTV
Ga0308392_11181353	3300031517	Hot Spring Phototrophic Mat	FANVAPVAPVVLYVIGVIAVFTQTVWLSVPRAEVRVMVLFGCTMMVPVAVTFPQPPVRVT
Ga0308389_10705131	3300031518	Hot Spring Phototrophic Mat	PVVLYVIGVIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVIFPQPPVRVTV
Ga0308389_11070581	3300031518	Hot Spring Phototrophic Mat	TQTVWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308391_10166297	3300031567	Hot Spring Phototrophic Mat	ALFTRTVWLSVPGAEVRVMVLFGCTMMVPVAVVTPPQPPVRVTV
Ga0308391_10371371	3300031567	Hot Spring Phototrophic Mat	WLSVPRAEVRVMVLFGCTMMVPVAVTFPQPPVRVTM
Ga0308393_10802513	3300031568	Hot Spring Phototrophic Mat	VVLYVIGVIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVTFPQPPVKVTV
Ga0308401_10483551	3300031767	Hot Spring Phototrophic Mat	PVVLYVIGVIAVFTQTVWLFVPGAEVSVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308401_10660491	3300031767	Hot Spring Phototrophic Mat	IGVIAVFTQTAWLSVPGAEVSVMVVLGCTMMVPVAVTFPQPPVKVTM
Ga0308401_10686001	3300031767	Hot Spring Phototrophic Mat	APVVLYVIGVIAVFTQTVWLSVPGAEVRVMLGCTMMVPVAVTFPQPPVKVTV
Ga0308401_10818103	3300031767	Hot Spring Phototrophic Mat	PVAPVVLYLIGVIGVFTQTVWLSVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308401_11096831	3300031767	Hot Spring Phototrophic Mat	LYVIGVIAVFTQTVWLSVPAAEVRVMVLSGCTMMVPVAVTFPQPPVKVTV
Ga0308401_11160711	3300031767	Hot Spring Phototrophic Mat	TQTVWLSVPGAEVRVMVLLLGCTMMVPVAVTFPQPPVKVTV
Ga0308418_10495501	3300031783	Hot Spring Phototrophic Mat	PVAPVVLYVIGVMGVSTQTVWLFVPGAEVSVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308418_10504764	3300031783	Hot Spring Phototrophic Mat	LFVPGAEVSVMVVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308418_10534734	3300031783	Hot Spring Phototrophic Mat	GVIAVFTQTVWLSVPGAEVSVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308418_10590414	3300031783	Hot Spring Phototrophic Mat	VCLFVPGAEVSVMVVLLGRTVMVPVAVTFPQPPVKVTV
Ga0308418_10656164	3300031783	Hot Spring Phototrophic Mat	VWLSVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308418_11224411	3300031783	Hot Spring Phototrophic Mat	AVFTQTVWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV
Ga0308409_10939033	3300031830	Hot Spring Phototrophic Mat	VWLFVPGAEVRVMVLLGRTVMVPVAVTFPQPPVKVTV
Ga0308409_11225731	3300031830	Hot Spring Phototrophic Mat	VIAVFTQTVWLSVPGAEVSVMVVLGCTMMVPLAVTFPQPPVRVTV
Ga0308408_10210416	3300031865	Hot Spring Phototrophic Mat	VLYAIGVMGVSTQTVWLFVPGAEVRVMVLLGCTMMVPVAVTSPQSLVKVTV
Ga0308408_10503001	3300031865	Hot Spring Phototrophic Mat	VWLSVPGAEVRVMVLSGCTMMVPVAVTFPQPPVRVTV
Ga0308405_10208838	3300031875	Hot Spring Phototrophic Mat	VFTQTVWLSVPGAEVRVMVLLGRTVMVPVAVTFPQPPVKVTV
Ga0308405_10823534	3300031875	Hot Spring Phototrophic Mat	VWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV
Ga0308405_10847191	3300031875	Hot Spring Phototrophic Mat	AVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308405_11346873	3300031875	Hot Spring Phototrophic Mat	TQTVWLFVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0308404_10389833	3300031878	Hot Spring Phototrophic Mat	VIGVIGVSTQTVWLSVPGAEVSVMVLLVLLSCTMMVPVAVTFPQPAVKVTV
Ga0308404_10389834	3300031878	Hot Spring Phototrophic Mat	PENVAPVAPVVLYLIGVIAVFTQTVWLSVPGAEVSVMVLLGRTMMVPVAVTFPQPPVRVT
Ga0308404_10464234	3300031878	Hot Spring Phototrophic Mat	GVIAVFTQTVWLSVTDAEVRVMVLLGCTMMVPVAVTFPQPSVRVTV
Ga0302322_1011651962	3300031902	Fen	VFIQTFWLSVPAAEERVIVLVVITLIDPVAVTVPQPPVRVTV
Ga0308406_10577244	3300031948	Hot Spring Phototrophic Mat	VFTQTVWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV
Ga0308406_10794331	3300031948	Hot Spring Phototrophic Mat	VIGVFTQTVWLFVPGAEVRVMVLLGCTVMVPVAVTFPQSPVTVTV
Ga0308406_10971231	3300031948	Hot Spring Phototrophic Mat	VFTQTLWLFVPDAEVRVMVLLGRTMMVPVAVTFPQPPVRVTV
Ga0308406_11171583	3300031948	Hot Spring Phototrophic Mat	ICWLSVPGAEVSVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0308406_11191481	3300031948	Hot Spring Phototrophic Mat	FTQTVWLFVPGAEVSVMVVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308417_11761731	3300031950	Hot Spring Phototrophic Mat	QTVWLSVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308417_12607771	3300031950	Hot Spring Phototrophic Mat	VAPVVLYVIGVIAVFTQTVWLSVPGSEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308420_10726945	3300031966	Hot Spring Phototrophic Mat	WLSVPGAEVSVMVLLGCTMMVPAAVTFPQPPVKVTV
Ga0308420_11989951	3300031966	Hot Spring Phototrophic Mat	VAPVVLYVIGVIAVFTQTVWLFVPGAEVSVMVLLLGCTMMVPMAVTFPQPPVGVTV
Ga0308420_12098933	3300031966	Hot Spring Phototrophic Mat	TVWLSVPGAEVRVMVLVGCTMMVPVAVTFPQPPVRVTV
Ga0308403_10933813	3300031980	Hot Spring Phototrophic Mat	PVVLYVIGVIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVTFPQPPVKVTV
Ga0308402_10941443	3300032033	Hot Spring Phototrophic Mat	WLFVPEAEVRVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308407_10963033	3300032034	Hot Spring Phototrophic Mat	APVVLYVIGVIAVFTQTVWLFVPGAEVRVMVLFGCTMMVPVAVTPPQPPVKVTV
Ga0308407_11176693	3300032034	Hot Spring Phototrophic Mat	IAVFTQTVWLSVPGAEVRVMVLSGCTMMVPVAVTFPQPPVRVTV
Ga0308400_11172861	3300032045	Hot Spring Phototrophic Mat	PENVAPVAPVVLYLIGVIAVSTQTVWLFVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKVT
Ga0308310_10679184	3300032056	Hot Spring Phototrophic Mat	VWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVKVTV
Ga0308310_10830641	3300032056	Hot Spring Phototrophic Mat	LYVIGVIAVFTQTVWLSVPGSEVRVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0308310_10941633	3300032056	Hot Spring Phototrophic Mat	PENVAPVAPVVLYVIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPAAVTFPQPPVRVT
Ga0308310_11147041	3300032056	Hot Spring Phototrophic Mat	VLYLIGVIAVSTQTVWLFVPGAEVSVMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308421_10381922	3300032057	Hot Spring Phototrophic Mat	VIGVIAVFTQTVWLSVPGAEVRVMVLLGCTMMVPVAVTFPQPPVRVTV
Ga0308421_10714534	3300032057	Hot Spring Phototrophic Mat	VAPVAPVVLYVIGVIAVFTQTVWLSVPGAEVSMMVLLGRTMMVPVAVTFPQPPVKVTV
Ga0308413_090621_3_131	3300033886	Hot Spring Phototrophic Mat	MIGVIGVFTQTIWLSVPDAEVRVMVLLGCTVMVPVAVVTLPQP
Ga0372963_22026_467_580	3300034449	Hot Spring Phototrophic Mat	QTVWLSVPGAEVSVMLGCTMMVPVAVTFPQPPVKVTV
Ga0372968_026117_40_186	3300034647	Hot Spring Phototrophic Mat	MISVIAVFTQTVWLSVPGSEVRVMAVLGCTVIVPVAVTSPQSPVTVTV
Ga0372970_026424_37_183	3300034648	Hot Spring Phototrophic Mat	MISVIAVFTQTVWLSVPGSEVRVMAVLGCTVMVPVAVTFPQPPVKVTV
Ga0372973_043788_528_638	3300034650	Hot Spring Phototrophic Mat	WLFVPGAEVRVMVLLGRTVMVPVAVTFPQTPVKVTV
Ga0370516_195642_471_605	3300034696	Hot Spring Water	IGVFTQTVWLSVPGAEVRVMVLLGRTMMVPVAVTFPQPPVKLTV

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F056637

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences