Metagenome Family F056651

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F056651
Family Type	Metagenome
Number of Sequences	137
Average Sequence Length	46 residues
Representative Sequence	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Number of Associated Samples	74
Number of Associated Scaffolds	137

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	32.12 %
% of genes from short scaffolds (< 2000 bps)	97.08 %
Associated GOLD sequencing projects	73
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (91.971 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (90.511 % of family members)
Environment Ontology (ENVO)	Unclassified (91.241 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (90.511 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 9.46% β-sheet: 0.00% Coil/Unstructured: 90.54%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.18
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF13456	RVT_3	0.73

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
All Organisms	root	All Organisms	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
cellular organisms	root	All Organisms → cellular organisms	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	8.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.97 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	8.03 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003316\|rootH1_10105981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1243	Open in IMG/M
3300005334\|Ga0068869_100505490	Not Available	1010	Open in IMG/M
3300005718\|Ga0068866_10150928	Not Available	1345	Open in IMG/M
3300006358\|Ga0068871_100236574	Not Available	1587	Open in IMG/M
3300011119\|Ga0105246_11762242	Not Available	590	Open in IMG/M
3300013296\|Ga0157374_11225788	Not Available	772	Open in IMG/M
3300015267\|Ga0182122_1000500	Not Available	1967	Open in IMG/M
3300015267\|Ga0182122_1004544	Not Available	1063	Open in IMG/M
3300015267\|Ga0182122_1005665	Not Available	999	Open in IMG/M
3300015268\|Ga0182154_1008529	Not Available	896	Open in IMG/M
3300015268\|Ga0182154_1019566	Not Available	721	Open in IMG/M
3300015269\|Ga0182113_1018956	Not Available	811	Open in IMG/M
3300015269\|Ga0182113_1044664	Not Available	637	Open in IMG/M
3300015269\|Ga0182113_1060992	Not Available	581	Open in IMG/M
3300015274\|Ga0182188_1001449	Not Available	1370	Open in IMG/M
3300015274\|Ga0182188_1008504	Not Available	837	Open in IMG/M
3300015274\|Ga0182188_1008926	Not Available	826	Open in IMG/M
3300015275\|Ga0182172_1003115	Not Available	1210	Open in IMG/M
3300015276\|Ga0182170_1016552	Not Available	773	Open in IMG/M
3300015277\|Ga0182128_1003025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1231	Open in IMG/M
3300015279\|Ga0182174_1003625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1215	Open in IMG/M
3300015279\|Ga0182174_1006317	Not Available	1039	Open in IMG/M
3300015279\|Ga0182174_1031363	Not Available	674	Open in IMG/M
3300015281\|Ga0182160_1005409	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1069	Open in IMG/M
3300015281\|Ga0182160_1058390	Not Available	560	Open in IMG/M
3300015283\|Ga0182156_1004556	Not Available	1156	Open in IMG/M
3300015283\|Ga0182156_1081164	Not Available	515	Open in IMG/M
3300015285\|Ga0182186_1026794	Not Available	698	Open in IMG/M
3300015285\|Ga0182186_1060436	Not Available	553	Open in IMG/M
3300015285\|Ga0182186_1064309	Not Available	543	Open in IMG/M
3300015287\|Ga0182171_1009507	Not Available	937	Open in IMG/M
3300015287\|Ga0182171_1011850	Not Available	882	Open in IMG/M
3300015287\|Ga0182171_1012799	Not Available	863	Open in IMG/M
3300015287\|Ga0182171_1066154	Not Available	549	Open in IMG/M
3300015287\|Ga0182171_1083726	Not Available	511	Open in IMG/M
3300015288\|Ga0182173_1002078	Not Available	1402	Open in IMG/M
3300015289\|Ga0182138_1041731	Not Available	629	Open in IMG/M
3300015289\|Ga0182138_1065742	Not Available	551	Open in IMG/M
3300015291\|Ga0182125_1008658	Not Available	987	Open in IMG/M
3300015291\|Ga0182125_1023656	Not Available	751	Open in IMG/M
3300015291\|Ga0182125_1036689	Not Available	664	Open in IMG/M
3300015291\|Ga0182125_1076860	Not Available	536	Open in IMG/M
3300015292\|Ga0182141_1024745	Not Available	740	Open in IMG/M
3300015292\|Ga0182141_1028454	Not Available	712	Open in IMG/M
3300015294\|Ga0182126_1010013	Not Available	955	Open in IMG/M
3300015295\|Ga0182175_1005227	Not Available	1155	Open in IMG/M
3300015295\|Ga0182175_1009161	Not Available	990	Open in IMG/M
3300015296\|Ga0182157_1004003	Not Available	1267	Open in IMG/M
3300015298\|Ga0182106_1002628	Not Available	1467	Open in IMG/M
3300015298\|Ga0182106_1061066	Not Available	591	Open in IMG/M
3300015300\|Ga0182108_1002085	Not Available	1553	Open in IMG/M
3300015300\|Ga0182108_1022689	Not Available	795	Open in IMG/M
3300015302\|Ga0182143_1006969	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1084	Open in IMG/M
3300015302\|Ga0182143_1007194	Not Available	1073	Open in IMG/M
3300015302\|Ga0182143_1017108	Not Available	849	Open in IMG/M
3300015304\|Ga0182112_1006121	Not Available	1126	Open in IMG/M
3300015304\|Ga0182112_1101037	Not Available	510	Open in IMG/M
3300015305\|Ga0182158_1030338	Not Available	724	Open in IMG/M
3300015305\|Ga0182158_1104445	Not Available	503	Open in IMG/M
3300015307\|Ga0182144_1049344	Not Available	639	Open in IMG/M
3300015307\|Ga0182144_1064056	Not Available	592	Open in IMG/M
3300015308\|Ga0182142_1013572	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	941	Open in IMG/M
3300015308\|Ga0182142_1108064	Not Available	513	Open in IMG/M
3300015314\|Ga0182140_1002135	Not Available	1566	Open in IMG/M
3300015314\|Ga0182140_1054452	Not Available	635	Open in IMG/M
3300015321\|Ga0182127_1079305	Not Available	582	Open in IMG/M
3300015322\|Ga0182110_1002057	Not Available	1618	Open in IMG/M
3300015323\|Ga0182129_1087950	Not Available	548	Open in IMG/M
3300015323\|Ga0182129_1116287	Not Available	502	Open in IMG/M
3300015342\|Ga0182109_1091819	Not Available	701	Open in IMG/M
3300015342\|Ga0182109_1172037	Not Available	556	Open in IMG/M
3300015343\|Ga0182155_1037695	Not Available	942	Open in IMG/M
3300015343\|Ga0182155_1161154	Not Available	570	Open in IMG/M
3300015344\|Ga0182189_1016244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1253	Open in IMG/M
3300015345\|Ga0182111_1041196	Not Available	973	Open in IMG/M
3300015345\|Ga0182111_1232132	Not Available	513	Open in IMG/M
3300015346\|Ga0182139_1070962	Not Available	804	Open in IMG/M
3300015346\|Ga0182139_1099676	Not Available	710	Open in IMG/M
3300015347\|Ga0182177_1133762	Not Available	638	Open in IMG/M
3300015351\|Ga0182161_1137645	Not Available	655	Open in IMG/M
3300015351\|Ga0182161_1251741	Not Available	515	Open in IMG/M
3300015355\|Ga0182159_1182650	Not Available	668	Open in IMG/M
3300015361\|Ga0182145_1097704	Not Available	634	Open in IMG/M
3300017404\|Ga0182203_1007321	Not Available	1284	Open in IMG/M
3300017404\|Ga0182203_1118392	Not Available	560	Open in IMG/M
3300017407\|Ga0182220_1052534	Not Available	617	Open in IMG/M
3300017409\|Ga0182204_1038462	Not Available	708	Open in IMG/M
3300017410\|Ga0182207_1019483	Not Available	1017	Open in IMG/M
3300017410\|Ga0182207_1138544	Not Available	547	Open in IMG/M
3300017411\|Ga0182208_1033218	Not Available	760	Open in IMG/M
3300017411\|Ga0182208_1085677	Not Available	573	Open in IMG/M
3300017413\|Ga0182222_1005601	Not Available	1070	Open in IMG/M
3300017415\|Ga0182202_1011804	Not Available	1065	Open in IMG/M
3300017415\|Ga0182202_1030535	Not Available	807	Open in IMG/M
3300017420\|Ga0182228_1016804	Not Available	1114	Open in IMG/M
3300017420\|Ga0182228_1042368	Not Available	762	Open in IMG/M
3300017424\|Ga0182219_1024193	Not Available	869	Open in IMG/M
3300017424\|Ga0182219_1089892	Not Available	579	Open in IMG/M
3300017425\|Ga0182224_1109551	Not Available	576	Open in IMG/M
3300017427\|Ga0182190_1112482	Not Available	574	Open in IMG/M
3300017430\|Ga0182192_1004912	Not Available	1619	Open in IMG/M
3300017430\|Ga0182192_1127996	Not Available	559	Open in IMG/M
3300017430\|Ga0182192_1145759	Not Available	534	Open in IMG/M
3300017433\|Ga0182206_1009793	Not Available	1178	Open in IMG/M
3300017433\|Ga0182206_1087504	Not Available	609	Open in IMG/M
3300017436\|Ga0182209_1056249	Not Available	721	Open in IMG/M
3300017436\|Ga0182209_1080525	Not Available	645	Open in IMG/M
3300017438\|Ga0182191_1024916	Not Available	960	Open in IMG/M
3300017438\|Ga0182191_1070420	Not Available	692	Open in IMG/M
3300017438\|Ga0182191_1093577	Not Available	630	Open in IMG/M
3300017442\|Ga0182221_1042069	Not Available	772	Open in IMG/M
3300017442\|Ga0182221_1050563	Not Available	732	Open in IMG/M
3300017442\|Ga0182221_1064537	Not Available	679	Open in IMG/M
3300017442\|Ga0182221_1096933	Not Available	600	Open in IMG/M
3300017443\|Ga0182193_1108146	Not Available	619	Open in IMG/M
3300017681\|Ga0182226_1054265	Not Available	727	Open in IMG/M
3300017683\|Ga0182218_1030743	Not Available	818	Open in IMG/M
3300017683\|Ga0182218_1037076	Not Available	774	Open in IMG/M
3300017683\|Ga0182218_1081933	Not Available	611	Open in IMG/M
3300017683\|Ga0182218_1108661	Not Available	561	Open in IMG/M
3300017684\|Ga0182225_1057410	Not Available	669	Open in IMG/M
3300017684\|Ga0182225_1120746	Not Available	532	Open in IMG/M
3300017686\|Ga0182205_1002453	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1919	Open in IMG/M
3300017686\|Ga0182205_1028386	Not Available	905	Open in IMG/M
3300017686\|Ga0182205_1035317	Not Available	845	Open in IMG/M
3300017689\|Ga0182231_1070994	Not Available	660	Open in IMG/M
3300017690\|Ga0182223_1042501	Not Available	676	Open in IMG/M
3300017690\|Ga0182223_1122694	Not Available	504	Open in IMG/M
3300025899\|Ga0207642_10899271	Not Available	567	Open in IMG/M
3300025908\|Ga0207643_10001790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	11959	Open in IMG/M
3300025926\|Ga0207659_11533039	Not Available	570	Open in IMG/M
3300025935\|Ga0207709_10665276	Not Available	830	Open in IMG/M
3300025938\|Ga0207704_10067726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2247	Open in IMG/M
3300026023\|Ga0207677_10523139	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1029	Open in IMG/M
3300026023\|Ga0207677_10749631	Not Available	870	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	90.51%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.11%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.92%
Roots	Host-Associated → Plants → Roots	0.73%
Rhizome	Host-Associated → Plants → Rhizome	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	90.51%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.19%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.73%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	0.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	90.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.19%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.73%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	0.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	90.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.73%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	0.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.73%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003316	Sugarcane root Sample L1	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
rootH1_101059812	3300003316	Sugarcane Root And Bulk Soil	VIVVSASVPKAIPIPSFEVVVDDLFNVPLPNLGFSGVAGSFRKVIR*
Ga0068869_1005054902	3300005334	Miscanthus Rhizosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0068866_101509284	3300005718	Miscanthus Rhizosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK*
Ga0068871_1002365745	3300006358	Miscanthus Rhizosphere	EALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0105246_117622422	3300011119	Miscanthus Rhizosphere	PCAPSVIVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAENFKKVIK*
Ga0157374_112257881	3300013296	Miscanthus Rhizosphere	VTVASASIPEAILVPSFEVVADDLFGVPLPSLGFLEVAGSFK
Ga0182122_10005004	3300015267	Miscanthus Phyllosphere	VIVASASVLESLPIHSFEVVEDDLFDAPLPNLGFSGVAGNFKKVIK*
Ga0182122_10045442	3300015267	Miscanthus Phyllosphere	VTVVSASILGAIPIPSFEVVEDDLFNVPLPNLGFLGVAGSFKKVIK*
Ga0182122_10056652	3300015267	Miscanthus Phyllosphere	VTVASASVLEAIPVPSFEVVEDDLFDVPLPSLGFSGVASSFNKAIK*
Ga0182154_10085292	3300015268	Miscanthus Phyllosphere	VIVVSASVPEAVPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182154_10195663	3300015268	Miscanthus Phyllosphere	GAIPIPSFEAVEDDLFDVPLLSLGFSGVAGSFKKVIK*
Ga0182113_10189562	3300015269	Miscanthus Phyllosphere	SASVPEVIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK*
Ga0182113_10446642	3300015269	Miscanthus Phyllosphere	MTIVSASVLEAISIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182113_10609922	3300015269	Miscanthus Phyllosphere	MTVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFLEVAGSFKKAIK*
Ga0182188_10014491	3300015274	Miscanthus Phyllosphere	SRKPAPCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSGVAGNFKKVIK*
Ga0182188_10085041	3300015274	Miscanthus Phyllosphere	MTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK*
Ga0182188_10089261	3300015274	Miscanthus Phyllosphere	SRKPAPCAPSVIVVSASVLEAIPIPSFEVVEDDLFNVPLSNLGFSGVAGSFKKVIK*
Ga0182172_10031154	3300015275	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVDDDLFDVPLPNLGFLGVAGNFKKVIK*
Ga0182170_10165521	3300015276	Miscanthus Phyllosphere	VIVVSASVPEVIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182128_10030253	3300015277	Miscanthus Phyllosphere	VIVVSASVLEAIPIPSFEVVEDDLFDVPLPDLGFSGVASSSKKVIK*
Ga0182174_10036252	3300015279	Miscanthus Phyllosphere	VIVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSGVARNFKKVIK*
Ga0182174_10063172	3300015279	Miscanthus Phyllosphere	VTVAFASVPKAIPIPSFELVGDDLFDMPLLDLGFSGVAGNFKKVIK*
Ga0182174_10313631	3300015279	Miscanthus Phyllosphere	VTVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK*
Ga0182160_10054092	3300015281	Miscanthus Phyllosphere	VIVVSASVLEALPIPSFKVVEDDLFDVPLSNLGFSGVAGNFKNVIK*
Ga0182160_10583901	3300015281	Miscanthus Phyllosphere	VTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182156_10045562	3300015283	Miscanthus Phyllosphere	VKVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0182156_10811641	3300015283	Miscanthus Phyllosphere	PNVTIASASVPEAIPIPSFEVVEDDLFSVPLPDFIFSEVAGDFKKVIK*
Ga0182186_10267941	3300015285	Miscanthus Phyllosphere	VTVVSASVPEAIPIPSFEVVDDDLFNVPLPNLGFSGV
Ga0182186_10604361	3300015285	Miscanthus Phyllosphere	FFQYSRKPAPCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182186_10643092	3300015285	Miscanthus Phyllosphere	VTVVSASVPEAIPIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK*
Ga0182171_10095072	3300015287	Miscanthus Phyllosphere	VTVVSASVLGAIPIPSFEVVEDDLFDVPLLNLGFSRVAGSFKKVIK*
Ga0182171_10118503	3300015287	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNPGFSGVAGNFKKVIK*
Ga0182171_10127993	3300015287	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFLGVPGNFKKVIK*
Ga0182171_10661542	3300015287	Miscanthus Phyllosphere	VIVVSASILEALPIPSFEVVEDDLFDVPLPNLGFS
Ga0182171_10837261	3300015287	Miscanthus Phyllosphere	APCAPSVTVVSASIPEAILIPSFEVVEDDLFNVPLPNLGFSGVACSFRKVIR*
Ga0182173_10020782	3300015288	Miscanthus Phyllosphere	VTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK*
Ga0182138_10417312	3300015289	Miscanthus Phyllosphere	VIVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0182138_10657422	3300015289	Miscanthus Phyllosphere	VIVVSASVPEAIPTPSFEVVEDDLFNVPLSNLGFSGVAGSFKKVIK*
Ga0182125_10086583	3300015291	Miscanthus Phyllosphere	MTIVSASVLEAISIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK*
Ga0182125_10236562	3300015291	Miscanthus Phyllosphere	MTVVSASVLGAIRIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK*
Ga0182125_10366892	3300015291	Miscanthus Phyllosphere	VTVVSASVPEAIPIPSFEVVEDDLFNVPLLNLGFLGVAGSFKKNIK*
Ga0182125_10768601	3300015291	Miscanthus Phyllosphere	VIVVSASVLEALPIPCFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0182141_10247452	3300015292	Miscanthus Phyllosphere	MTVVSAFILGAIPIPSFEVVEDDLFDVPLPSLGFLEVAGSFKKAIK*
Ga0182141_10284541	3300015292	Miscanthus Phyllosphere	VTIVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK
Ga0182126_10100131	3300015294	Miscanthus Phyllosphere	EALPIPSFEVVEDDLFDVPLPNIGFSGVAGNFKKVIK*
Ga0182175_10052273	3300015295	Miscanthus Phyllosphere	VTVVSASVPEAIPIPFFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182175_10091612	3300015295	Miscanthus Phyllosphere	VTVASASVLEAIPVPSFEVVADDLFDVPLLNLGSLEVAGSFKKAIK*
Ga0182157_10040035	3300015296	Miscanthus Phyllosphere	LPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK*
Ga0182106_10026284	3300015298	Miscanthus Phyllosphere	ASVLEALPIPSFEVVEDDLFDVPLLNLGFLGVAGNFKKVIK*
Ga0182106_10610661	3300015298	Miscanthus Phyllosphere	QCAPSMTVVSTSVLEAILIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK*
Ga0182108_10020854	3300015300	Miscanthus Phyllosphere	MTVVSASVPEAIPIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK*
Ga0182108_10226891	3300015300	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKV
Ga0182143_10069691	3300015302	Miscanthus Phyllosphere	VTVVSTSILEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKK
Ga0182143_10071941	3300015302	Miscanthus Phyllosphere	IASASVPEAIPIPSFEVVEDDLFSVPLLDFIFLEVAGDFKKVIK*
Ga0182143_10171081	3300015302	Miscanthus Phyllosphere	VIVVSASVPEDIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182112_10061214	3300015304	Miscanthus Phyllosphere	APCAPSMIVVSASVLGAIPIPSFEVVEEDLFDVPLPSLGFSGVAGSFKKVIK*
Ga0182112_11010371	3300015304	Miscanthus Phyllosphere	VTVASASVLEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKVIK*
Ga0182158_10303381	3300015305	Miscanthus Phyllosphere	VTVVSASVLEAIPIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK*
Ga0182158_11044452	3300015305	Miscanthus Phyllosphere	VTVASASVPEAIPVPSFEVVADDLFDVPLLNLGSLEVAGSFKKAIK*
Ga0182144_10493442	3300015307	Miscanthus Phyllosphere	VTVAFASVPEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK*
Ga0182144_10640562	3300015307	Miscanthus Phyllosphere	MTVVYASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVI*
Ga0182142_10135721	3300015308	Miscanthus Phyllosphere	MTVVSASVLEALPIPSFEVVEDDLFDVPLSNLGFSGVAGNFKKVIK*
Ga0182142_11080642	3300015308	Miscanthus Phyllosphere	VTVAFASVPKAIPIPSFELVGDDLFDMPLPDLGFLGVAGNFKK
Ga0182140_10021353	3300015314	Miscanthus Phyllosphere	MTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182140_10544522	3300015314	Miscanthus Phyllosphere	VPEAIPIPSFEVVEDDLFSVPLPDFIFLEVAGDFKKVIK*
Ga0182127_10793052	3300015321	Miscanthus Phyllosphere	VTFVSTSVLEALPIPSFEVVDDDLFDVPLSNLGFLGVAGNFKKVIK*
Ga0182110_10020574	3300015322	Miscanthus Phyllosphere	MTVVSASVPEAVLIPSFEVVEDDLFNVPLLNLGFSGVAGSFKKVIK*
Ga0182129_10879502	3300015323	Miscanthus Phyllosphere	VLEALPIPSFEVVDDDLFDVPLPNICFSGVAGNFKKVIK*
Ga0182129_11162872	3300015323	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSRVARNFKKVIK*
Ga0182109_10918192	3300015342	Miscanthus Phyllosphere	MTVVSASVLEALPIPSFEVAEDDLFDVPLPNPSFSGVAGNFKKVIK*
Ga0182109_11720372	3300015342	Miscanthus Phyllosphere	VTVVSASVLEALLIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0182155_10376952	3300015343	Miscanthus Phyllosphere	ASTSVPEAIPIPSFEVVKDDLFSISLPDFIFSEVAGDFKKVIK*
Ga0182155_11611541	3300015343	Miscanthus Phyllosphere	VTVVSASVLEALPISSFEVVEDDLFDVPLPNLGFSGV
Ga0182189_10162442	3300015344	Miscanthus Phyllosphere	VTIASASVPEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK*
Ga0182111_10411962	3300015345	Miscanthus Phyllosphere	VIVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182111_12321322	3300015345	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSRVAGNFKKVIK*
Ga0182139_10709622	3300015346	Miscanthus Phyllosphere	PNVTIASASVPKAIPIPSFEVVEDDLFSVPLPDFIFSEVAGDFKKVIK*
Ga0182139_10996761	3300015346	Miscanthus Phyllosphere	VTVVSASIPEVIPIPSFEVVDDDLFNVPLPNLGFSGVAGSFKKVIK*
Ga0182177_11337622	3300015347	Miscanthus Phyllosphere	MTVVSASILEVIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK*
Ga0182161_11376452	3300015351	Miscanthus Phyllosphere	MTVVSASVLEALPIPSLEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0182161_12517412	3300015351	Miscanthus Phyllosphere	APCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK*
Ga0182159_11826501	3300015355	Miscanthus Phyllosphere	VTVASASIPEAILVPSFEVVADDLFGVPLPSLGFLEVAGSFKKAIK*
Ga0182145_10977042	3300015361	Miscanthus Phyllosphere	VTVASASVLEAILVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK*
Ga0182203_10073213	3300017404	Miscanthus Phyllosphere	VTVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182203_11183921	3300017404	Miscanthus Phyllosphere	VIVASASVPEAIPVPSFEVVANDLFDVPLLSLGFLEVVGSFKKAIN
Ga0182220_10525342	3300017407	Miscanthus Phyllosphere	VTFSSASVLEAIPVPSFEVVENDLFNVPLPNLGFSGMAGSFKKVIK
Ga0182204_10384621	3300017409	Miscanthus Phyllosphere	VTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182207_10194833	3300017410	Miscanthus Phyllosphere	RKLAPCAPSVTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182207_11385441	3300017410	Miscanthus Phyllosphere	VTVASASVPEAIPVPSFEVVADDLFDVPLPSLGFLEVACSFKKAISK
Ga0182207_11715422	3300017410	Miscanthus Phyllosphere	FQYSRELAPCASNVTVASASVPEAIPVPSFQVVEDDLFDVPLPSLGFSGVAGSFNKVIK
Ga0182208_10332181	3300017411	Miscanthus Phyllosphere	FFQYSHKPAPCAPSVTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182208_10856771	3300017411	Miscanthus Phyllosphere	SVTVASASVLEAIPVPSFEVVEDDLFDVPLPSLGFSGVASSFNKAIK
Ga0182222_10056013	3300017413	Miscanthus Phyllosphere	PNVIVASASVPEAIPVPSFEVVADDLFDVPLPSLGFLEVAGNFKKAIK
Ga0182202_10118042	3300017415	Miscanthus Phyllosphere	VIVVSASVPEAVPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182202_10305353	3300017415	Miscanthus Phyllosphere	NCFFHYSRKPAPCAPSVTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182228_10168042	3300017420	Miscanthus Phyllosphere	VIVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSRVAGSFKKVIK
Ga0182228_10423682	3300017420	Miscanthus Phyllosphere	VIVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSRVAGNFKKVIK
Ga0182219_10241932	3300017424	Miscanthus Phyllosphere	MTVVSTSVPEALPIPSFEVVEDDLFDVPLLNLNFSGVAGNFKKVIK
Ga0182219_10550202	3300017424	Miscanthus Phyllosphere	FQYSRKPAPCAPSVIVVFASVPEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182219_10898922	3300017424	Miscanthus Phyllosphere	MTVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK
Ga0182224_11095511	3300017425	Miscanthus Phyllosphere	VTVVSTSILEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182190_11124822	3300017427	Miscanthus Phyllosphere	IPVPSFQVVEDDLFDVPLPSLGFSGVAVSFKKAIK
Ga0182192_10049122	3300017430	Miscanthus Phyllosphere	MTVVSASVLEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182192_11279961	3300017430	Miscanthus Phyllosphere	VTVASASVLEAILVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKVIK
Ga0182192_11457592	3300017430	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKK
Ga0182206_10097932	3300017433	Miscanthus Phyllosphere	MTVVSASVLEALPIPFFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182206_10875042	3300017433	Miscanthus Phyllosphere	VTVVSASILEAVPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182209_10562492	3300017436	Miscanthus Phyllosphere	VIVVSASVPEAIPIPSFEVVEDDLFNVPLPNLGFSGVAGSFKKVIK
Ga0182209_10805252	3300017436	Miscanthus Phyllosphere	VTVASASVLEAIPVPSFEVVADDLFDVPLPSLGFLEVAGSFKKAIK
Ga0182191_10249162	3300017438	Miscanthus Phyllosphere	VIVVSAYVLVALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182191_10704201	3300017438	Miscanthus Phyllosphere	VTVAFASVPEAIPVPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK
Ga0182191_10935772	3300017438	Miscanthus Phyllosphere	MNCFFHYSQKPAPCAPSVIVVSASVLEALPIPSFKVVEDDLFDVPLSNLGFSGVAGNFKKVI
Ga0182221_10420692	3300017442	Miscanthus Phyllosphere	NCFFQYSRKPAPYAPSVIVVSASVPEAVPMPSFEVVEDDLFNVPLPNLGFSGVVGSFKKVIK
Ga0182221_10505631	3300017442	Miscanthus Phyllosphere	PEVIPIPFFEVVEDDLFSMPLPEFIFSEVAGDFKKVIK
Ga0182221_10645372	3300017442	Miscanthus Phyllosphere	VTVVSASVPEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182221_10969332	3300017442	Miscanthus Phyllosphere	VIVVSASVPEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0182193_11081462	3300017443	Miscanthus Phyllosphere	QYSHEPAPCAPSVIVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK
Ga0182226_10542651	3300017681	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLSNLGFLGVAGNFKKVIK
Ga0182218_10307431	3300017683	Miscanthus Phyllosphere	VTVASASVLEAIPVPSFEVVADDLFDVPLLSLGFLEVAGSFKKAIK
Ga0182218_10370762	3300017683	Miscanthus Phyllosphere	VTVVSASVLGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFKKAIK
Ga0182218_10819332	3300017683	Miscanthus Phyllosphere	VTVVSASVPEAIPIPSFEVVDDDLFNVPLPNLGFSGVAGSFKKAIK
Ga0182218_11086611	3300017683	Miscanthus Phyllosphere	MTVVSASVPEAVLIPSFEVVEDDLFNVPLLNLGFLGVAGRFKKVIK
Ga0182225_10574101	3300017684	Miscanthus Phyllosphere	MTVVSASVLGAIPIPSFEVVEDDLFDVPLLSLGFLEVVGSFKKAIN
Ga0182225_11207461	3300017684	Miscanthus Phyllosphere	VTIASASVLEAIPVPSFEVVEDDLFDVPLLSLGFSRVAGSFKKAIK
Ga0182205_10024535	3300017686	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVARNFKKVIK
Ga0182205_10283861	3300017686	Miscanthus Phyllosphere	VIVASASVPEAIPVPSFEVVADDLFDVPLLSLGFLEVAGSFKKAIK
Ga0182205_10353171	3300017686	Miscanthus Phyllosphere	PEAIPIPSFEVVEDDLFSVPLPDFIFSEVAGDFKKVIK
Ga0182231_10709942	3300017689	Miscanthus Phyllosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLSNLGFSGVAGNFKKVIK
Ga0182223_10425011	3300017690	Miscanthus Phyllosphere	VPEAIPVPSFEVVANDLFDVPLLSLGFLEVAGNFKKAIK
Ga0182223_11226942	3300017690	Miscanthus Phyllosphere	MTVVSAFILGAIPIPSFEVVEDDLFDVPLPSLGFSGVAGSFNKVIK
Ga0207642_108992712	3300025899	Miscanthus Rhizosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0207643_100017907	3300025908	Miscanthus Rhizosphere	VTVVSASVLEALPIPSFEVAEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0207659_115330391	3300025926	Miscanthus Rhizosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGRFKKVIK
Ga0207709_106652762	3300025935	Miscanthus Rhizosphere	VTVVSGSVLEALPIPSFEVVEDDLFDVPLPNLGFSGVAGNFKKVIK
Ga0207704_100677264	3300025938	Miscanthus Rhizosphere	VTVVSASVLEALPIPSFEVVEDDLFDVPLPNHGFSGVAGNFKKVIK
Ga0207677_105231392	3300026023	Miscanthus Rhizosphere	MTVVSASVLEALPIPSFEVVEDDLFDVPLLNLGFSGVAGNFKKVIK
Ga0207677_107496314	3300026023	Miscanthus Rhizosphere	SVLEALPIPSFEVVEDDLFDVPLLNLGFSGVAGNFKKVIK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F056651

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences