NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056654

Metagenome / Metatranscriptome Family F056654

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056654
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 45 residues
Representative Sequence MLRKPDSIPSGDTVIQDPVMEPFFITKSQSGGYTVYERVIKGENNTE
Number of Associated Samples 118
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.35 %
% of genes from short scaffolds (< 2000 bps) 91.24 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (69.343 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(13.869 % of family members)
Environment Ontology (ENVO) Unclassified
(43.066 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.591 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.00%    β-sheet: 17.33%    Coil/Unstructured: 74.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF00085Thioredoxin 78.83
PF02867Ribonuc_red_lgC 11.68
PF10107Endonuc_Holl 2.92
PF00535Glycos_transf_2 1.46
PF06508QueC 0.73
PF06737Transglycosylas 0.73
PF16861Carbam_trans_C 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 11.68
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.73
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 0.73
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.73
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.73
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.73
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.73
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.73
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 0.73
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.73

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.75 %
UnclassifiedrootN/A18.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10269654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes510Open in IMG/M
3300000224|SI34jun09_10mDRAFT_1042424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes630Open in IMG/M
3300001939|GOS2225_1002134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2141215Open in IMG/M
3300002483|JGI25132J35274_1029479All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300003216|JGI26079J46598_1083647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes593Open in IMG/M
3300006357|Ga0075502_1660291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes561Open in IMG/M
3300006484|Ga0070744_10112546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes785Open in IMG/M
3300006621|Ga0101441_100401Not Available113607Open in IMG/M
3300006735|Ga0098038_1188655Not Available671Open in IMG/M
3300006868|Ga0075481_10315804Not Available543Open in IMG/M
3300006869|Ga0075477_10413896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes523Open in IMG/M
3300006924|Ga0098051_1119807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes702Open in IMG/M
3300007346|Ga0070753_1295135Not Available580Open in IMG/M
3300007540|Ga0099847_1127906All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes763Open in IMG/M
3300007554|Ga0102820_1010112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2394Open in IMG/M
3300007554|Ga0102820_1188653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes500Open in IMG/M
3300007555|Ga0102817_1060477Not Available827Open in IMG/M
3300007557|Ga0102821_1011571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2456Open in IMG/M
3300007609|Ga0102945_1026037Not Available1253Open in IMG/M
3300007609|Ga0102945_1101542Not Available517Open in IMG/M
3300007681|Ga0102824_1119643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes692Open in IMG/M
3300008996|Ga0102831_1285129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes545Open in IMG/M
3300009000|Ga0102960_1000938Not Available11008Open in IMG/M
3300009003|Ga0102813_1224512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes580Open in IMG/M
3300009027|Ga0102957_1263152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes626Open in IMG/M
3300009512|Ga0115003_10230719Not Available1107Open in IMG/M
3300009677|Ga0115104_10386647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.518Open in IMG/M
3300010151|Ga0098061_1314768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300010297|Ga0129345_1300676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes556Open in IMG/M
3300012920|Ga0160423_10227970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1293Open in IMG/M
3300012920|Ga0160423_10438189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes891Open in IMG/M
3300012928|Ga0163110_10628923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes831Open in IMG/M
3300012928|Ga0163110_10720333All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300012928|Ga0163110_11675342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes518Open in IMG/M
3300012954|Ga0163111_12533388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes522Open in IMG/M
3300017706|Ga0181377_1050520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes797Open in IMG/M
3300017714|Ga0181412_1147291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes531Open in IMG/M
3300017717|Ga0181404_1089238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes759Open in IMG/M
3300017719|Ga0181390_1091036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes828Open in IMG/M
3300017719|Ga0181390_1125082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes667Open in IMG/M
3300017721|Ga0181373_1004102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2142829Open in IMG/M
3300017723|Ga0181362_1125399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes502Open in IMG/M
3300017740|Ga0181418_1071742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes849Open in IMG/M
3300017740|Ga0181418_1147370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes565Open in IMG/M
3300017741|Ga0181421_1072290Not Available905Open in IMG/M
3300017743|Ga0181402_1195504Not Available502Open in IMG/M
3300017746|Ga0181389_1131315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes675Open in IMG/M
3300017748|Ga0181393_1087137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes814Open in IMG/M
3300017757|Ga0181420_1155139All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes681Open in IMG/M
3300017769|Ga0187221_1131949All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300017772|Ga0181430_1194225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes581Open in IMG/M
3300017967|Ga0181590_10604584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes750Open in IMG/M
3300017969|Ga0181585_10558139All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes762Open in IMG/M
3300017985|Ga0181576_10817799All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300018049|Ga0181572_10528441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes724Open in IMG/M
3300018416|Ga0181553_10409244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes736Open in IMG/M
3300018418|Ga0181567_10630822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes690Open in IMG/M
3300018420|Ga0181563_10071064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2362Open in IMG/M
3300018421|Ga0181592_10212426All Organisms → Viruses → Predicted Viral1440Open in IMG/M
3300018421|Ga0181592_10438876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes914Open in IMG/M
3300018421|Ga0181592_10474276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes870Open in IMG/M
3300018421|Ga0181592_10482788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes860Open in IMG/M
3300018426|Ga0181566_11215642All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes501Open in IMG/M
3300019751|Ga0194029_1097324All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes515Open in IMG/M
3300020169|Ga0206127_1248871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes616Open in IMG/M
3300020188|Ga0181605_10367194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes581Open in IMG/M
3300020377|Ga0211647_10157054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes751Open in IMG/M
3300020403|Ga0211532_10090694All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2141326Open in IMG/M
3300020438|Ga0211576_10459107Not Available646Open in IMG/M
3300020441|Ga0211695_10114285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED214909Open in IMG/M
3300020442|Ga0211559_10239084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes852Open in IMG/M
3300020454|Ga0211548_10447675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes632Open in IMG/M
3300020463|Ga0211676_10381897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes776Open in IMG/M
3300020470|Ga0211543_10165797All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300021169|Ga0206687_1093865All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes573Open in IMG/M
3300021353|Ga0206693_1707317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes510Open in IMG/M
3300021368|Ga0213860_10339365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes654Open in IMG/M
3300021957|Ga0222717_10143626Not Available1458Open in IMG/M
3300021958|Ga0222718_10023826All Organisms → Viruses → Predicted Viral4196Open in IMG/M
3300021959|Ga0222716_10064808Not Available2552Open in IMG/M
3300021959|Ga0222716_10116182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2141788Open in IMG/M
3300021959|Ga0222716_10343250Not Available886Open in IMG/M
3300021959|Ga0222716_10709344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes533Open in IMG/M
3300021959|Ga0222716_10716627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes529Open in IMG/M
3300021959|Ga0222716_10771406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes502Open in IMG/M
3300021960|Ga0222715_10144724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1480Open in IMG/M
3300021964|Ga0222719_10349301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes939Open in IMG/M
3300021964|Ga0222719_10701179Not Available572Open in IMG/M
3300022407|Ga0181351_1176483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes740Open in IMG/M
3300022939|Ga0255754_10183933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1065Open in IMG/M
3300023172|Ga0255766_10263563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes899Open in IMG/M
3300023180|Ga0255768_10283567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes940Open in IMG/M
3300024228|Ga0228633_1074519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes819Open in IMG/M
3300024228|Ga0228633_1157962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes500Open in IMG/M
3300024242|Ga0228673_1040632Not Available823Open in IMG/M
3300024242|Ga0228673_1087723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes553Open in IMG/M
3300024250|Ga0228677_1088867Not Available603Open in IMG/M
3300024266|Ga0228661_1114506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes507Open in IMG/M
3300024291|Ga0228660_1024799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1133Open in IMG/M
3300024314|Ga0228657_1062440All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300024316|Ga0228654_1064754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes568Open in IMG/M
3300024335|Ga0228672_1134664All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes656Open in IMG/M
3300024348|Ga0244776_10802157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes569Open in IMG/M
3300025098|Ga0208434_1079350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes669Open in IMG/M
3300025108|Ga0208793_1065906All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1076Open in IMG/M
3300025636|Ga0209136_1153373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes603Open in IMG/M
3300025655|Ga0208795_1028750All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300025771|Ga0208427_1187283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes664Open in IMG/M
3300025897|Ga0209425_10465784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes591Open in IMG/M
3300026097|Ga0209953_1009843Not Available1991Open in IMG/M
3300026183|Ga0209932_1022535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1641Open in IMG/M
3300026187|Ga0209929_1068263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes972Open in IMG/M
3300026470|Ga0247599_1062583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes787Open in IMG/M
3300026500|Ga0247592_1098609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes705Open in IMG/M
3300026503|Ga0247605_1164330Not Available532Open in IMG/M
3300026505|Ga0228647_1098778Not Available697Open in IMG/M
3300027188|Ga0208921_1004460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2389Open in IMG/M
3300027192|Ga0208673_1024035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1033Open in IMG/M
3300027198|Ga0208163_1049856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes678Open in IMG/M
3300027298|Ga0208970_1065186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes601Open in IMG/M
3300027413|Ga0208950_1006723All Organisms → Viruses → Predicted Viral4106Open in IMG/M
3300027506|Ga0208973_1112430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes602Open in IMG/M
3300027571|Ga0208897_1162698All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes548Open in IMG/M
3300027672|Ga0209383_1196652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes590Open in IMG/M
3300027721|Ga0209492_1295518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes540Open in IMG/M
3300027757|Ga0208671_10214187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes690Open in IMG/M
3300028111|Ga0233397_1043345Not Available1335Open in IMG/M
3300028196|Ga0257114_1162841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED214850Open in IMG/M
3300028273|Ga0228640_1028482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1095Open in IMG/M
3300028273|Ga0228640_1060477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes741Open in IMG/M
3300028280|Ga0228646_1049363Not Available1042Open in IMG/M
3300028392|Ga0304729_1136815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes801Open in IMG/M
3300031519|Ga0307488_10552089Not Available678Open in IMG/M
3300031766|Ga0315322_10159084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1603Open in IMG/M
3300032047|Ga0315330_10056409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2621Open in IMG/M
3300033995|Ga0335003_0379768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes611Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater13.87%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.68%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.49%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.76%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water8.03%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.30%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.11%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.11%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water5.11%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater4.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.46%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.46%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.46%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.46%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.73%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.73%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.73%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.73%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.73%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.73%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.73%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.73%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300001939Marine microbial communities from Block Island, New York, USA - GS009EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006621Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time pointEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007609Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MGEnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020377Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022939Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaGEnvironmentalOpen in IMG/M
3300023172Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024242Seawater microbial communities from Monterey Bay, California, United States - 91DEnvironmentalOpen in IMG/M
3300024250Seawater microbial communities from Monterey Bay, California, United States - 58D_rEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024316Seawater microbial communities from Monterey Bay, California, United States - 66DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026097Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026505Seawater microbial communities from Monterey Bay, California, United States - 59DEnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027298Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300028280Seawater microbial communities from Monterey Bay, California, United States - 58DEnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1026965413300000116MarineMLRNPNSIPSTDTLIQDPAMEPFFIARSQTGGFTVYERVVK
SI34jun09_10mDRAFT_104242413300000224MarineMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNT
GOS2225_100213443300001939MarineMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVVKGENNTEYIKTV
JGI25132J35274_102947953300002483MarineMLRRPDSIPDGDTVIEDSVMEPFFIAKSSSGGYTVYERVIKGENDTHYIKTICYP
JGI26079J46598_108364713300003216MarineMLRRPDSIPAGDTVITDPVMEPFFISKSQSGGYTVYERVIKGDNDTEYI
Ga0075502_166029133300006357AqueousMLRNPNSIPAGDTIIADPVMEPFFITRSQTGGYTVYER
Ga0070744_1011254643300006484EstuarineMLRRPDSIPAGDTVITDPVMEPFFISKSQSGGYTV
Ga0101441_10040193300006621Marine Surface WaterMLRRPDSIPAGDTVITDPALEPFFITRSNTGGFTLYERVTKGDNNTEY
Ga0098038_118865513300006735MarineMLRRPDSIPNGDTIISDPILEPFFISKSSTGGYTVYERVIKGDNDTEYIKTVCYPGNF
Ga0075481_1031580433300006868AqueousMLRRPDSIPSTDTIISDAILEPFFISKSSTGGFTVYERVTKGENNTQYIKTV
Ga0075477_1041389613300006869AqueousMLRNPNSIPETDTVIKDPVMEPFFITRSQNNGYTVFERVI
Ga0098051_111980743300006924MarineMLRNPDSIPAGDTIVKDKAMDPFFISRSQTGGYTVYEDVVK
Ga0070753_129513533300007346AqueousMLRRPDSIPDGDTVIEDPVMEPFFIAKSSSGGYTVYERVIKGEND
Ga0099847_112790633300007540AqueousMLRKPDSIPAGDTLIEDPVMEPFFISKSSSGGYTVYERVIKGENDTAYIKTVC
Ga0102820_101011213300007554EstuarineMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKGENNT
Ga0102820_118865313300007554EstuarineMLRKPDSIPSSDTVITDPALEPFFISRSTTGGFTLFERVIKGENDTEYI
Ga0102817_106047753300007555EstuarineMLRRPDSIPSGDTIISDPILEPFFISKSSNGGYTVYERVVKGENST
Ga0102821_101157113300007557EstuarineMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKG
Ga0102945_102603743300007609Pond WaterMLRRPDSIPSGDTVITDPVMEPFFIAKSQSGGYTVYERV
Ga0102945_110154233300007609Pond WaterMLRRPDSIPSGDTVITDPVMEPFFIAKSQSGGYTV
Ga0102824_111964313300007681EstuarineMLRRPDSIPAGDTVVQDPVMEPFFIAKSQSGGYTVYERVIKGEKNTEYIKTICYPSN
Ga0102831_128512923300008996EstuarineMLRNPKSIPSGDTIIQDPVMEPFFISKSQSGGYTVYERVTKGEKNTEYIKTVSYPATF
Ga0102960_100093813300009000Pond WaterMLRNPESIPASDTLIQDPVMEPFFITRSQTGGYTVYERVIKGDNDTEYIKNISYP
Ga0102813_122451213300009003EstuarineMLRRPDSIPAGDTVVQDPVMEPFFIAKSQSGGYTVYERVIKGEKN
Ga0102957_126315233300009027Pond WaterMLRNPNSIPSSDTIIQDPVMEPFFITRSQTGGYTVYERVIKGDNDTEYIKNISY
Ga0115003_1023071913300009512MarineMLRRPDSIPSTDTIITDPVLEPFFISKSSTGGFTVYERV
Ga0115104_1038664723300009677MarineMLRRPDSIPAGDTVIEDPIMEPFFIAKSASGGYTVYERVIKG
Ga0098061_131476833300010151MarineMLRKPDSIPASDTVIKDPSMEPFFITKSSTGGYTVYESVI
Ga0129345_130067633300010297Freshwater To Marine Saline GradientMLRNPNSVPSSDTVIQDPAMEPFFITRSQTGGYTVYQRVVKGEKNTEYIKSL
Ga0160423_1022797053300012920Surface SeawaterMLRKPDSIPSTDTVIKDKAMEPFFIAKSSSGGYTVYENVIKGENNTPYI
Ga0160423_1043818913300012920Surface SeawaterMLRRPDSIPASDTVIEDPIMEPFFIAKSSSGGYTVYERVIKGDNDT
Ga0163110_1062892333300012928Surface SeawaterMLRRPDSIPAGDTVIEDPIIEPFFIAKSSSGGYTVYERVIKGDNDTHYIK
Ga0163110_1072033333300012928Surface SeawaterMLRKPDSIPANDTVIADPSMEPFFISKSTTGGFTVYERVVK
Ga0163110_1167534213300012928Surface SeawaterMLRNPDSIPAGDTIIKDPAIEPFFITRPQVGGYVVYEKVVKGENNNNYLKT
Ga0163111_1253338833300012954Surface SeawaterMLRKPDSIPANDTIIQDPSMEPFFISKSTTGGFTVYERVVKGEN
Ga0181377_105052033300017706MarineMLRRPDSIPAGDTIIEDPIMEPFFIAKSSSGGYTLYERVVKGENDT
Ga0181412_114729113300017714SeawaterMLRNPNSVPESDTVIQDPAMEPFFITRSQNNGYTVFERVVKGENSTEYIKTVSYP
Ga0181404_108923813300017717SeawaterMLRRPDSIPATDTVIEDPAMEPFFITNSASGGYTVYERVIKGENNTPYIKTICY
Ga0181390_109103643300017719SeawaterMLRKPDSIPSSDTVITDPALEPFFICRSSTGGYTLFER
Ga0181390_112508213300017719SeawaterMLRNPDSVPASDTIIADPVMEPFFITRSQTGGYTVYERVVKGEN
Ga0181373_100410253300017721MarineMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVTKGENNTE
Ga0181362_112539933300017723Freshwater LakeMLRNPNTIPVGDTVIEDPTLEPYFIVNSTSGGYTVFEKV
Ga0181418_107174233300017740SeawaterMLRKPDSIPSNETIVEDPVMEPFFITRSQTGGYTVYERVIKGENNTSYIKTIGYPS
Ga0181418_114737033300017740SeawaterMLRNPNSVPESDTVIQDPAMEPFFITRSQSGGFTVFENVVKG
Ga0181421_107229043300017741SeawaterMLRRPDSIPNGDTIISDPILEPFFISKSSTGGYTVYERVVKG
Ga0181402_119550413300017743SeawaterMLRRPDSIPSGDTIISDPILEPFFISKSSNGGYTVYERVVKGENSTEYIKTVCYP
Ga0181389_113131543300017746SeawaterMLRNPDSIPSSDTIIQDPVMEPFFITRSQTGGYTVYERV
Ga0181393_108713743300017748SeawaterMLRNPNSIPTTDTIIADPVMEPFFITRSPNNGYTVYERVIKGDNDTEYIKNISY
Ga0181420_115513933300017757SeawaterMLRKPDSIPSNETIVEDPVMEPFFITRSQTGGYTVYERV
Ga0187221_113194913300017769SeawaterMLRKPNSIPASDTVIKDPGMEPYFITKSSTGGYTVYENVIKGENNTP
Ga0181430_119422533300017772SeawaterMLRRPDSIPATDTVIEDPAMEPFFITNSASGGYTVYERVIKGENNTPYIKTI
Ga0181590_1060458443300017967Salt MarshMLRNPNSIPSGDTIIQDPVMEPFFITRSQTGGYTVYERVTKGENNTEY
Ga0181585_1055813913300017969Salt MarshMLRNPDSIPSSDTIIQDPVMEPYFITRSQTGGYTVYERVVKGDNNTEYIKTLGYPS
Ga0181576_1081779923300017985Salt MarshMLRKPDSIPANETIVQDPVMEPFFITRSQTGGYTVYERVIKGENDTP
Ga0181572_1052844133300018049Salt MarshMLRNPNSIPTGDTIIQDPVMEPFFITRSQTGGYTVYER
Ga0181553_1040924423300018416Salt MarshMLRNPDSVPSSDTVIQDPVMEPFFITRSQTGGYTVYERVVKG
Ga0181567_1063082223300018418Salt MarshMLRKPDSIPANQTIVQDPVMEPFFITRSQTGGYTVYERVIKG
Ga0181563_1007106413300018420Salt MarshMLRKPDSIPAGDTLIQDPVMEPFFISKSQSGGYTVYERVVKGNNDTEYIKTV
Ga0181592_1021242613300018421Salt MarshMLRKPDSIPAGDTIIQDPVMEPFFITKSQTGGYTLYERVIKGDNNTEYIKT
Ga0181592_1043887613300018421Salt MarshMLRNPNSIPTGDTIIQDPVMEPFFITRSQTGGYTVYERVIKGENNTEYIKTI
Ga0181592_1047427643300018421Salt MarshMLRRPDSIPSGDTIIQDPVMEPFSISKSQSGGYTVYERVIK
Ga0181592_1048278833300018421Salt MarshMLRNPNSVPSSDTVIQDPVMEPFFITRSQTGGYTV
Ga0181566_1121564233300018426Salt MarshMLRNPDSIPSSDTIIQDPVMEPYFITRSQTGGYTVY
Ga0194029_109732423300019751FreshwaterMLRNPNSIPSTDTIIADPVMEPFFITRSPNNGYTVYERVI
Ga0206127_124887133300020169SeawaterMLRKPDSIPAGDTLIEDPVMEPFFISKSSSGGYTLYERVVKGDNNTNYI
Ga0181605_1036719433300020188Salt MarshMLRNPNSVPSSDTVIQDPVMEPFFITRSQTGGYTVYERV
Ga0211647_1015705443300020377MarineMLRNPDSIPASDTIIADPVMEPFFITRSQTGGYTVYEKVV
Ga0211532_1009069433300020403MarineMLRNPDSLPSGDTLIQDPAMEPYFITRSQNHEYTVFERVVKGENNTPY
Ga0211576_1045910743300020438MarineMLRRPDSIPSGDTIISDPILEPFFISKSSNGGYTVYERVVKGENSTE
Ga0211695_1011428533300020441MarineMLRNPDSLPSGDTLIQDPAMEPYFITRSQNHEYTVFERVVKGENNTPYL
Ga0211559_1023908413300020442MarineMLRNPNSIPASDTIIKDPKMDPFFITRSQTGGYTVFENVIKGENNTSYIKTVSYP
Ga0211548_1044767513300020454MarineMLRKPDSIPSNETIIEDPAMEPFFITRSQTGGYTVYERVVKGENDT
Ga0211676_1038189743300020463MarineMLRRPDSIPATDTVIQDPAMEPFFITKSNSDIQYMKE
Ga0211543_1016579733300020470MarineMLRKPDSIPSNETIIEDPAMEPFFITRSQTGGYTVYERVVKGENDTPYIKTIGYP
Ga0206687_109386513300021169SeawaterMLRNPDSIPSSDTIIQDPVMEPFFITRSQTGGYTVYERVVKGD
Ga0206693_170731723300021353SeawaterMLRRPDSIPATDTVIEDPAMEPFFITNSASGGYTVYERVIKGENNTPYIK
Ga0213860_1033936513300021368SeawaterMLRRPDSIPASDTLIEDKVMEPFFISRSTSGSYTVYERVVKGDNDTEYIKT
Ga0222717_1014362613300021957Estuarine WaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYE
Ga0222718_1002382653300021958Estuarine WaterMLRRPDSIPSTDTIISDPLLEPFFISKSSTGGYTVYERVIKG
Ga0222716_1006480813300021959Estuarine WaterMLRKPDSIPSNETIVEDPVMEPFFITRSQTGGYTVYERVIKGENK
Ga0222716_1011618213300021959Estuarine WaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYER
Ga0222716_1034325013300021959Estuarine WaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVY
Ga0222716_1070934413300021959Estuarine WaterMLRNPNSIPSGDTIIQDPVMEPFFVSRSQTGGYTVYERVIKGENNTEY
Ga0222716_1071662713300021959Estuarine WaterMLRRPDSIPAGDTVIKDPAMEPFFIAKSQTGGYTVYEDVIKGDNNTRYIKTI
Ga0222716_1077140613300021959Estuarine WaterMLRNPNSIPTGDTIIQDPVMEPFFITRSQTGGYTVYERVIKGENNTEYIKTISYP
Ga0222715_1014472453300021960Estuarine WaterMLRNPNSIPSSDTIIQDPVMEPFFITRSQTGGYTV
Ga0222719_1034930143300021964Estuarine WaterMLRRPDSIPDGDTVIEDPVMEPFFIAKSSSGGYTVYERVIKGDNDTPY
Ga0222719_1070117913300021964Estuarine WaterMLRRPDSIPAGDTVITDPVMEPFFIAKSQSGGYTVYERVIKGEKNTEYIKTVCY
Ga0181351_117648313300022407Freshwater LakeMLRNPNTIPAGDTVIEDSTLEPYFIVNSSSGGYTVFEK
Ga0255754_1018393313300022939Salt MarshMLRKPDSIPVKDVIIKDPVMEPFFITRSQTGGYTVFENVVKGENNT
Ga0255766_1026356353300023172Salt MarshMLRNPNSIPETDTVIKDPVLDPFFITRSQTGGYTVFEQVVKGDND
Ga0255768_1028356713300023180Salt MarshMLRNPNSIPETDTVIKDPVLDPFFITRSQTGGYTVFEQVVKGD
Ga0228633_107451913300024228SeawaterMLRKPDSIPSGDTVIQDPVMEPFFITKSQSGGYTVYERVIKGENNTE
Ga0228633_115796233300024228SeawaterMLRNPDSVPASDTIIADPVMEPFFITRSQTGGYTVY
Ga0228673_104063243300024242SeawaterMLRRPDSIPNGDTIISDPILEPFFISKSSTGGYTVYERVVKGENNTEYIKTVC
Ga0228673_108772313300024242SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGEN
Ga0228677_108886723300024250SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVTKGENNTEYIKTVC
Ga0228661_111450633300024266SeawaterMLRNPDSIPAGDTIVKDPAMEPFFISKSQSGGYTVFERVVKGENKTEYIKTISYPSTF
Ga0228660_102479953300024291SeawaterMLRRPDSIPAGDTIIEDAVMEPFFIAKSTSGGYTLYERVIKGENNTH
Ga0228657_106244033300024314SeawaterMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKGE
Ga0228654_106475413300024316SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVI
Ga0228672_113466413300024335SeawaterMLRKPDSIPSGDTIIQDPVMEPFFITRSQSGGYTVYERVV
Ga0244776_1080215713300024348EstuarineMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKGENN
Ga0208434_107935013300025098MarineMLRRPDSIPAGDTIIEDSVMEPFFIAKSTSGGYTLYERVIKGENNTHYIKTICYP
Ga0208793_106590633300025108MarineMLRKPDSIPSNETIVEDPVMEPYFITRSQTGGYTVYE
Ga0209136_115337333300025636MarineMLRRPDSIPAGDTVITDPVMEPFFISKSQSGGYTVYERVIKGDNDTEYIKTVSYP
Ga0208795_102875073300025655AqueousMLRRPDSIPDGDTVIEDPVMEPFFISKSQSGGYTVYERVI
Ga0208427_118728313300025771AqueousMLRNPNSIPTGDTIIQDPVMEPFFITRSQTGGYTVYERVIKGEN
Ga0209425_1046578413300025897Pelagic MarineMLRNPNSIPETDTVIKDPVMEPFFITRSQNNGFTVFERVIKGENNNQSIK
Ga0209953_100984353300026097Pond WaterMLRRPDSIPSGDTVITDPVMEPFFIAKSQSGGYTVYERVVK
Ga0209932_102253513300026183Pond WaterMLRNPESIPASDTLIQDPVMEPFFITRSQTGGYTVY
Ga0209929_106826353300026187Pond WaterMLRNPNSIPSSDTIIQDPVMEPFFITRSQTGGYTVY
Ga0247599_106258333300026470SeawaterMLRRPDSIPAGDTIIEDSVMEPFFIAKSSSGGYTVYE
Ga0247592_109860913300026500SeawaterMLRRPDSIPAGDTIIEDSVMEPFFIAKSSSGGYTVYERVIKGDNNTHYIKTICYP
Ga0247605_116433013300026503SeawaterMLRRPDSIPATDTVIEDPAMEPFFITNSASGGYTVYE
Ga0228647_109877843300026505SeawaterMLRKPDSIPSSDTLIKDSVMEPFFIAKSASGGFTVYENVIKGDNNTPYIKT
Ga0208921_100446013300027188EstuarineMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKGENNTE
Ga0208673_102403513300027192EstuarineMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYER
Ga0208163_104985633300027198EstuarineMLRRPDSIPAGDTVVQDPVMEPFFIAKSQSGGYTVYERVIKGEKNTEYIKTI
Ga0208970_106518633300027298MarineMLRKPDSIPSSDTVITDPALEPFFICRSSTGGYTLFERVIK
Ga0208950_100672313300027413MarineMLRNPDSVPASDTIIADPVMEPFFITRSQTGGYTVYERVVKGENNT
Ga0208973_111243023300027506MarineMLRNPNSIPEGDTVIEDPVLEPFFISKSQSGGYTVYERVIKGENNTHYIK
Ga0208897_116269813300027571EstuarineMLRNPKSIPSGDTIIQDPVMEPFFISKSQSGGYTVYERVTKGEKNTEYIK
Ga0209383_119665213300027672MarineMLRNPDSLPAGDTVISDPAMEPYFITRSQNHEYTVFEKVIKGDNDTPYLRTV
Ga0209492_129551833300027721Freshwater SedimentMLRNPNTIPEGDTIIEDPIMEPFFIVKATSGGYTIYERVTRGEKDR
Ga0208671_1021418733300027757EstuarineMLRKPDSIPAGDTVITDPVMEPFFISKSQSGGYTVYERVIKGNNDTEY
Ga0233397_104334513300028111SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERV
Ga0257114_116284113300028196MarineMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVIKGENNTEYIKTVCY
Ga0228640_102848213300028273SeawaterMLRKPDSIPSSDTVITDPALEPFFICRSSTGGYTLF
Ga0228640_106047743300028273SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNTEYIKTIC
Ga0228646_104936313300028280SeawaterMLRQPDSIPASDTVITDPALEPFFITRSQTGGFTLYERVVKGVNDTEYIKTIC
Ga0304729_113681513300028392Freshwater LakeMLRNPNTIPAGDTVIEDPLMEPFFITHSKSGGYAVYEKVNR
Ga0307488_1055208933300031519Sackhole BrineMLRRPDSIPSTDTIITDPVLEPFFISKSSTGGFTVYERVIKGD
Ga0315322_1015908453300031766SeawaterMLRNPNSVPESDTVIQDPAMEPFFITRSQNNGYTVFERVVKGENN
Ga0315330_1005640913300032047SeawaterMLRKPDSIPASDTVIKDPGMEPYFITKSSTGGYTVYEN
Ga0335003_0379768_2_1123300033995FreshwaterMLRNPNTIPAGDTVIEDPQMEPFFITHSSSGGYTVYE
Ga0335049_0486650_1_1443300034272FreshwaterMLRNPDTIPAGDTIIEDPIMEPFFITHSSSGGYTVYERVNRGKDDKAY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.