Basic Information | |
---|---|
Family ID | F056830 |
Family Type | Metagenome |
Number of Sequences | 137 |
Average Sequence Length | 46 residues |
Representative Sequence | LDTYHVVLYIHLLALFIGIGAASILLVCLFQLRAAQTLADAVPWGSVA |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.27 % |
% of genes near scaffold ends (potentially truncated) | 95.62 % |
% of genes from short scaffolds (< 2000 bps) | 94.16 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.562 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.598 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.358 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.204 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.26% β-sheet: 0.00% Coil/Unstructured: 44.74% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF00571 | CBS | 5.84 |
PF07992 | Pyr_redox_2 | 5.11 |
PF00753 | Lactamase_B | 5.11 |
PF00400 | WD40 | 4.38 |
PF13450 | NAD_binding_8 | 3.65 |
PF13088 | BNR_2 | 2.92 |
PF00795 | CN_hydrolase | 2.92 |
PF00118 | Cpn60_TCP1 | 2.92 |
PF00202 | Aminotran_3 | 2.92 |
PF01717 | Meth_synt_2 | 2.19 |
PF03631 | Virul_fac_BrkB | 2.19 |
PF13602 | ADH_zinc_N_2 | 1.46 |
PF00664 | ABC_membrane | 1.46 |
PF12697 | Abhydrolase_6 | 1.46 |
PF00582 | Usp | 0.73 |
PF13091 | PLDc_2 | 0.73 |
PF04151 | PPC | 0.73 |
PF04101 | Glyco_tran_28_C | 0.73 |
PF00293 | NUDIX | 0.73 |
PF10944 | DUF2630 | 0.73 |
PF12680 | SnoaL_2 | 0.73 |
PF00127 | Copper-bind | 0.73 |
PF00903 | Glyoxalase | 0.73 |
PF02036 | SCP2 | 0.73 |
PF13360 | PQQ_2 | 0.73 |
PF06925 | MGDG_synth | 0.73 |
PF01565 | FAD_binding_4 | 0.73 |
PF01895 | PhoU | 0.73 |
PF08402 | TOBE_2 | 0.73 |
PF07719 | TPR_2 | 0.73 |
PF13424 | TPR_12 | 0.73 |
PF00999 | Na_H_Exchanger | 0.73 |
PF12840 | HTH_20 | 0.73 |
PF07883 | Cupin_2 | 0.73 |
PF03006 | HlyIII | 0.73 |
PF00112 | Peptidase_C1 | 0.73 |
PF01039 | Carboxyl_trans | 0.73 |
PF04237 | YjbR | 0.73 |
PF06026 | Rib_5-P_isom_A | 0.73 |
PF02789 | Peptidase_M17_N | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.92 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.19 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 2.19 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.73 |
COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.73 |
COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.73 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.73 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.73 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.73 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.73 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.73 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.73 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.73 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.73 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.73 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.56 % |
Unclassified | root | N/A | 20.44 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig806158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
2166559005|cont_contig44597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
2166559006|FI_contig23506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
2170459002|F0B48LX02FJ9ZL | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
2189573002|GZIGXIF02HHW2B | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
3300000956|JGI10216J12902_112969154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 703 | Open in IMG/M |
3300001686|C688J18823_10468390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
3300002244|JGI24742J22300_10115198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300004081|Ga0063454_101519568 | Not Available | 574 | Open in IMG/M |
3300004153|Ga0063455_100759780 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300004643|Ga0062591_102269355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
3300004643|Ga0062591_102433994 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005169|Ga0066810_10179636 | Not Available | 521 | Open in IMG/M |
3300005171|Ga0066677_10514899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300005176|Ga0066679_10524924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300005178|Ga0066688_10098755 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300005294|Ga0065705_10031234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1136 | Open in IMG/M |
3300005294|Ga0065705_10744626 | Not Available | 633 | Open in IMG/M |
3300005336|Ga0070680_101218626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
3300005356|Ga0070674_100354806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1186 | Open in IMG/M |
3300005436|Ga0070713_100126333 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
3300005436|Ga0070713_100654140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
3300005440|Ga0070705_100156435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1518 | Open in IMG/M |
3300005466|Ga0070685_10949062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300005529|Ga0070741_10711419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 885 | Open in IMG/M |
3300005529|Ga0070741_11630506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300005530|Ga0070679_100350839 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
3300005530|Ga0070679_100776463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 901 | Open in IMG/M |
3300005535|Ga0070684_102255086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300005542|Ga0070732_10814060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300005545|Ga0070695_100505095 | Not Available | 936 | Open in IMG/M |
3300005545|Ga0070695_101124214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300005560|Ga0066670_10929537 | Not Available | 530 | Open in IMG/M |
3300005607|Ga0070740_10247952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
3300005764|Ga0066903_105172839 | Not Available | 691 | Open in IMG/M |
3300005874|Ga0075288_1064482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300005894|Ga0075270_1088609 | Not Available | 502 | Open in IMG/M |
3300006046|Ga0066652_100658042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
3300006046|Ga0066652_101086572 | Not Available | 758 | Open in IMG/M |
3300006173|Ga0070716_100951036 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006797|Ga0066659_10163233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1596 | Open in IMG/M |
3300006806|Ga0079220_11191413 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300006871|Ga0075434_101127613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 797 | Open in IMG/M |
3300006903|Ga0075426_10555805 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300006954|Ga0079219_10208772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1116 | Open in IMG/M |
3300009012|Ga0066710_100519434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1797 | Open in IMG/M |
3300009176|Ga0105242_11891869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
3300009792|Ga0126374_10401809 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300010039|Ga0126309_10815442 | Not Available | 611 | Open in IMG/M |
3300010322|Ga0134084_10201767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 696 | Open in IMG/M |
3300010325|Ga0134064_10284054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300010337|Ga0134062_10627189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300010360|Ga0126372_10438288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
3300010376|Ga0126381_100284562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2257 | Open in IMG/M |
3300010376|Ga0126381_102650225 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300010396|Ga0134126_10900042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
3300010397|Ga0134124_10327495 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300011119|Ga0105246_11095569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300011119|Ga0105246_11177159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
3300011987|Ga0120164_1044422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
3300012010|Ga0120118_1079122 | Not Available | 808 | Open in IMG/M |
3300012198|Ga0137364_10902530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
3300012199|Ga0137383_10412303 | Not Available | 990 | Open in IMG/M |
3300012206|Ga0137380_11200851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300012209|Ga0137379_11343560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300012211|Ga0137377_10646871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
3300012212|Ga0150985_115431868 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300012285|Ga0137370_10098372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1645 | Open in IMG/M |
3300012356|Ga0137371_10753511 | Not Available | 743 | Open in IMG/M |
3300012508|Ga0157315_1049352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300012948|Ga0126375_11932275 | Not Available | 519 | Open in IMG/M |
3300012958|Ga0164299_10698815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 709 | Open in IMG/M |
3300012960|Ga0164301_10766666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
3300012977|Ga0134087_10508456 | Not Available | 608 | Open in IMG/M |
3300012977|Ga0134087_10819066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300012985|Ga0164308_10730524 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300013102|Ga0157371_11294134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300013296|Ga0157374_11080354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
3300014166|Ga0134079_10048450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1488 | Open in IMG/M |
3300014325|Ga0163163_13230411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300014497|Ga0182008_10714426 | Not Available | 574 | Open in IMG/M |
3300015356|Ga0134073_10214510 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300015357|Ga0134072_10132058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 803 | Open in IMG/M |
3300015372|Ga0132256_103124508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
3300017961|Ga0187778_10802110 | Not Available | 642 | Open in IMG/M |
3300018431|Ga0066655_10828420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 630 | Open in IMG/M |
3300018468|Ga0066662_12272771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300019362|Ga0173479_10162212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
3300020005|Ga0193697_1014508 | Not Available | 1929 | Open in IMG/M |
3300021080|Ga0210382_10531517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300022756|Ga0222622_10844987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
3300024055|Ga0247794_10333889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300024254|Ga0247661_1093349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300024323|Ga0247666_1114497 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300025906|Ga0207699_10347605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
3300025913|Ga0207695_10426795 | Not Available | 1210 | Open in IMG/M |
3300025916|Ga0207663_10107117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1890 | Open in IMG/M |
3300025917|Ga0207660_10893386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
3300025924|Ga0207694_10526039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 991 | Open in IMG/M |
3300025928|Ga0207700_11019673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
3300025941|Ga0207711_10990885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
3300025949|Ga0207667_10499089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1235 | Open in IMG/M |
3300026023|Ga0207677_11594823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
3300026308|Ga0209265_1013078 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
3300026308|Ga0209265_1046857 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300026308|Ga0209265_1241083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
3300026335|Ga0209804_1109111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
3300026523|Ga0209808_1292194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300026542|Ga0209805_1368392 | Not Available | 549 | Open in IMG/M |
3300027787|Ga0209074_10181292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 779 | Open in IMG/M |
3300027821|Ga0209811_10056730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1348 | Open in IMG/M |
3300028716|Ga0307311_10058629 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300028717|Ga0307298_10029110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
3300028784|Ga0307282_10030045 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
3300028784|Ga0307282_10448482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300028807|Ga0307305_10218714 | Not Available | 873 | Open in IMG/M |
3300028810|Ga0307294_10074297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
3300028811|Ga0307292_10261338 | Not Available | 720 | Open in IMG/M |
3300028875|Ga0307289_10357047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300028875|Ga0307289_10454775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
3300028884|Ga0307308_10398212 | Not Available | 660 | Open in IMG/M |
3300031170|Ga0307498_10191498 | Not Available | 708 | Open in IMG/M |
3300031170|Ga0307498_10224003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300031170|Ga0307498_10475971 | Not Available | 506 | Open in IMG/M |
3300031199|Ga0307495_10038294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 924 | Open in IMG/M |
3300031572|Ga0318515_10645189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300031720|Ga0307469_12474210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300031910|Ga0306923_10146957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2689 | Open in IMG/M |
3300031939|Ga0308174_10782055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
3300032013|Ga0310906_10888636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
3300032074|Ga0308173_11257651 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300032074|Ga0308173_11673399 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300032076|Ga0306924_11902238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300032089|Ga0318525_10722281 | Not Available | 507 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.65% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.19% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.19% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.46% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.46% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.46% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.46% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.46% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.73% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.73% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.73% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.73% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_00758320 | 2124908045 | Soil | MDTYHVVLYIHLLALFLGLGAASVLLACLTQLRKAQ |
cont_0597.00003310 | 2166559005 | Simulated | LNTYHAILFLHLMFLFVGIGAGAVLLVCLFQLRVARTLEQAVPWGGVAG |
FI_00259750 | 2166559006 | Grass Soil | LNTYHAILFLHLMFLFVGVGAGAVLLVCLFQLRAARTLEQAVP |
E1_03566280 | 2170459002 | Grass Soil | LNTYHYVLYVHLLALFVGIGAGSVLLTCLFQIRAAGTVEQAVPWGSCPAGWRAS |
FE1_03816110 | 2189573002 | Grass Soil | MDTYHVVLYIHLLALLLGIGAGSVLLTCLFQLRAARTVEQAVPWGIVSG |
JGI10216J12902_1129691541 | 3300000956 | Soil | MDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAE |
C688J14111_100296664 | 3300001305 | Soil | LDTYHVVLYIHLLSLFVGVGAASVLIVCLFQLRGAAELSDAIPWGRVAGKIGRLFG |
C688J18823_104683902 | 3300001686 | Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMLAAKV |
JGI24742J22300_101151982 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADAIPWGRVAGKISRAFPIA |
Ga0063454_1015195682 | 3300004081 | Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMGKLF |
Ga0063455_1007597801 | 3300004153 | Soil | LDTYHAVLYIHLLSLFIGIGAASILMVCLFQLRKAQTLMEAAPWGGVAAKIGRAFPVA |
Ga0062591_1022693551 | 3300004643 | Soil | LDTYHVVLYVHLLSLFIGIGAASILMVCLFQLRAAQTLAEAVPWGMVAGKIGR |
Ga0062591_1024339941 | 3300004643 | Soil | VSTYTVVLYLHLLSLFIGIGAASVLMACLFRLRAAQTLADAAPW |
Ga0066810_101796361 | 3300005169 | Soil | LNTYHYVLYVHLLALFIGIGAGSVLLTCLFQLKAARTVEQAMPWGI |
Ga0066677_105148992 | 3300005171 | Soil | LTTQGEALNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLRAARTLE |
Ga0066679_105249241 | 3300005176 | Soil | LNTYHSVLYVHLLALFVGIGAGSVLLACLLQLRAASTVEQAAPWGM |
Ga0066688_100987551 | 3300005178 | Soil | LNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLRAARTLEQAVPWGIVSG |
Ga0065705_100312342 | 3300005294 | Switchgrass Rhizosphere | LDTYHVVLYIHLLSLLVGXGXASVLVVCLFQLRGARELADAIPWGSVAGKIA |
Ga0065705_107446261 | 3300005294 | Switchgrass Rhizosphere | VLYIHLLALFIGIGAASVLLVCLFQLRAAQTLAEAVPWGMVAGKTGRAFPIA |
Ga0070680_1012186261 | 3300005336 | Corn Rhizosphere | MDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAG |
Ga0070674_1003548061 | 3300005356 | Miscanthus Rhizosphere | LDTYHVVLYIHLLSLFVGIGAASVLIVCLFQLRGARELMEAVPWGM |
Ga0070713_1001263334 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LDTYHVVLYVHFLSVFIGLGAASVLMACLFRLRASETLADAAPWGMMAGKIGRAFPVAV |
Ga0070713_1006541404 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTYHYVLYVHLMSLFVGIGAGSVLLACLLQLRAARTVEAAAPWGMLSGKVAK |
Ga0070705_1001564352 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VDTYHYVLYIHLLSLIVGIGAAAVLSVCLFQLRGARELADALPWG |
Ga0070685_109490622 | 3300005466 | Switchgrass Rhizosphere | LDTYHVVLYIHLLSLFVGIGAASVLVVCLFQLRKATEFADAVPFGRVAGKVG |
Ga0070741_107114192 | 3300005529 | Surface Soil | LDTYHVVLYIHLLSLFVGIGAASILTLCLFQLRASRTL* |
Ga0070741_116305062 | 3300005529 | Surface Soil | VNTYHYVLFIHFLALFVGIGAGSVLLACLLQLRAAR |
Ga0070679_1003508392 | 3300005530 | Corn Rhizosphere | VNTYHYVLYVHLMSLFVGIGAGSVLLVCLLQLRAARTVEQAAPWGMMAGKVGKLFPVAIL |
Ga0070679_1007764633 | 3300005530 | Corn Rhizosphere | LNTYHGVLYFHLLFLFVGIGAGAVLLVCLFQLRAARTLEQAVPWGTVAG |
Ga0070684_1022550861 | 3300005535 | Corn Rhizosphere | LDTYHVVLYIHLLSLFVGIGAAAVLVVCLFQLRGANELMQAVPFGMVA |
Ga0070732_108140602 | 3300005542 | Surface Soil | VNTYHDVLYVHLLSLFIGIGAASVLLVSLFQLRAARTLEAAAPWGRVAGKV |
Ga0070695_1005050952 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LDTYHYVLYIHLLSLFVGIGAATLLAVCLFQLRGARELTDALPWG |
Ga0070695_1011242141 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCLFQLRSAQTLADAIPW |
Ga0066670_109295371 | 3300005560 | Soil | LDTYHIVLYIHLLAVFIGVGAASVLMVCLFQLRAAKTLADAVPWGVVAGKTEHA |
Ga0070740_102479521 | 3300005607 | Surface Soil | LDTYHVVLYIHLLALFVGIGAGTVLLVCLLQLRAAETLDTAVPWGVLAGRTEKAFP |
Ga0066903_1051728391 | 3300005764 | Tropical Forest Soil | LNTYHYVLYVHLLALFIGIGAGSVLLTCLFQLKGASTVEQAVPWGIVSGKVARLFPVA |
Ga0075288_10644822 | 3300005874 | Rice Paddy Soil | LDTYHVVLYIHLLSLFVGIGAASVLVVCLFQLRGARELTDAI |
Ga0075270_10886091 | 3300005894 | Rice Paddy Soil | LNTYHYVLYVHLLALFVGIGAGSVLLTCLFQLRAARTLEQAAPWGIVAGK |
Ga0066652_1006580421 | 3300006046 | Soil | LDTYHVVLYIHLLALFVGVGAGSVLLVCLFQLRAAQTLADAVPWGAVAGKTERAFPIAI |
Ga0066652_1010865721 | 3300006046 | Soil | VDTYLTVKYIHLLSLFIGIGAGAVLAACLFQLRAAGTLEQAVPWGMMAGK |
Ga0070716_1009510361 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LDTYHVVLYIHFLALFVGIGAAAVLVTCLFQLRGAGTLADALPWG |
Ga0066659_101632333 | 3300006797 | Soil | LDTYHVVLYIHLLALFVGIGAGAILLVCLFQLRGAQTLADAVPWGSVAGKTARAFP |
Ga0066660_105926273 | 3300006800 | Soil | LDTYHVVLYIHFMSLFVGIGAGAVLVVCLFQLRAAQTLADAVPWGRVAGKAGRTFPIAI |
Ga0079220_111914131 | 3300006806 | Agricultural Soil | LDTYHVVLYIHLLALFVGIGAGAILVLCLFQLRAARTLEAAAPWGAVA* |
Ga0075434_1011276132 | 3300006871 | Populus Rhizosphere | MDTYHVVLYLHFLSLFIGIGAASVLLACLIQLRAAQTLMDAVPWGMVAGRSPRRSPSR* |
Ga0075426_105558051 | 3300006903 | Populus Rhizosphere | LNTYHYVLYVHLLSLFVGIGAGSVLLACLLQLRAARTVEQ |
Ga0079219_102087723 | 3300006954 | Agricultural Soil | MDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAGK |
Ga0066710_1005194341 | 3300009012 | Grasslands Soil | LDTYHVVLYVHLLAVFIGVGAASVLMVCLFQLKAAKTLADAVPWGAVAGKTERAFPVAIL |
Ga0105242_118918692 | 3300009176 | Miscanthus Rhizosphere | LDTYSVVLYLHLLSLFIGLGAASVLMECLFRLRAA |
Ga0126374_104018091 | 3300009792 | Tropical Forest Soil | LNTYHYVLYLHLLSIFIGIGAGSVILACLLQLRAARTVEQAAPWGMMAGKV |
Ga0126309_108154422 | 3300010039 | Serpentine Soil | VDTYHVVLYIHILSMLLGIGAASVLFACLFGLRGAQTLAD |
Ga0134084_102017672 | 3300010322 | Grasslands Soil | LNTYHYVLYVHLLSLFLGIGAGSVLLTCLFQLRAAGTVEQAVPWG |
Ga0134064_102840541 | 3300010325 | Grasslands Soil | LDRYHVALYIHFVSLLIGIGAASVLTVCAFQFRSARTLADAAPWGRVAAKVGRL |
Ga0134062_106271892 | 3300010337 | Grasslands Soil | LNTYHYVLYVHLLSLFIGIGAGSVLLACLFQLRAARTLETAVPWGMLSG |
Ga0126372_104382881 | 3300010360 | Tropical Forest Soil | VKTLNTYHYVLYVHLLSLFIGIGAGSVILVCLFQLRAARTL |
Ga0126381_1002845621 | 3300010376 | Tropical Forest Soil | VDTYHVVLYLHLLSLFIGLGAASILMACLFRLRASQTLADAAPWGM |
Ga0126381_1026502251 | 3300010376 | Tropical Forest Soil | LNTYHYVLYVHLLSLFVGIGAGSVILTCLLQLRAARTVEQAAPWGMMAGKVGK |
Ga0134126_109000422 | 3300010396 | Terrestrial Soil | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSAQTLADAIPWGRVAGKIGRAF |
Ga0134124_103274951 | 3300010397 | Terrestrial Soil | MDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAGKVSRLFPIAI |
Ga0105246_110955691 | 3300011119 | Miscanthus Rhizosphere | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSALTLADAIPWGRVAGK |
Ga0105246_111771591 | 3300011119 | Miscanthus Rhizosphere | LDTYHYVLYVHLLSLFVGIGAAAVLSVCLFQLRGARELTDALP |
Ga0120164_10444221 | 3300011987 | Permafrost | LDTYHVVLYVHLLALFIGIGAASILLICLFQLRAAQTLAEAVPWGS |
Ga0120118_10791222 | 3300012010 | Permafrost | LDTYHVILYVHLMALFIGIGAGSVLLTCLFQLRAAGTLEEALPWGRVSGQ |
Ga0137364_109025301 | 3300012198 | Vadose Zone Soil | VNTYHYVLYVHLLSLFVGIGAGAVVLACLLQLRAARTLEQAVPWG |
Ga0137383_104123031 | 3300012199 | Vadose Zone Soil | LDTYHVVLYIHLLALFVGVGAAGVLLVCLFQLRSAQTVSD |
Ga0137380_112008511 | 3300012206 | Vadose Zone Soil | LTTQGEALNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLR |
Ga0137379_113435601 | 3300012209 | Vadose Zone Soil | LTTQGEALNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQL |
Ga0137377_106468713 | 3300012211 | Vadose Zone Soil | LNTYHYVLYIHLLSLFVGIGAGSVLLTCLFQLRAARTLEQAVPWGIV |
Ga0150985_1154318681 | 3300012212 | Avena Fatua Rhizosphere | LDTYHAVLYIHLLSLFIGIGAASILMVCLFQLRKAQTLMEAAPWGGVAGKIGRAFP |
Ga0137370_100983722 | 3300012285 | Vadose Zone Soil | LDTYHYVLYVHLLSLFVGIGAAAVLSVCLFQLRGARE |
Ga0137371_107535111 | 3300012356 | Vadose Zone Soil | LDTYHVVLYIHFLALFIGIGAGSVLLVCLFQLRDAQTLADAVPW |
Ga0157315_10493522 | 3300012508 | Arabidopsis Rhizosphere | LDTYHVVLYLHLLSLFIGIGAASILLVCTYQLRAAQTL |
Ga0126375_119322751 | 3300012948 | Tropical Forest Soil | LDTYHVVLYIHLVSLLIGIGAASVLTVCAVQLRGARTLADAAPWGR |
Ga0164299_106988151 | 3300012958 | Soil | LNTYHYVLYVHLLSLFVGIGAGSVLLACLLQLRAARTVEQAGPWGMM |
Ga0164301_107666662 | 3300012960 | Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMGKFFPIA |
Ga0134087_105084562 | 3300012977 | Grasslands Soil | VDTYHYVLYIHLLSLFVGIGAAAVLSLCLFQLRDARELADALPWGRVA |
Ga0134087_108190661 | 3300012977 | Grasslands Soil | LDTYHVVLYIHFMALFVGIGAGAVLLVCLFQLRAAQTLAEAVP |
Ga0164308_107305242 | 3300012985 | Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWG |
Ga0157371_112941342 | 3300013102 | Corn Rhizosphere | LDTYHYVLYVHLLSLFVGIGAASVLVVCLFQLRKATEFADA |
Ga0157374_110803542 | 3300013296 | Miscanthus Rhizosphere | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSALTLADAI |
Ga0134079_100484503 | 3300014166 | Grasslands Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMG |
Ga0163163_132304111 | 3300014325 | Switchgrass Rhizosphere | LDTYHVVLYLHLLSLFVGIGAASVLVVCLFQLRKATEFADAVPFGRVA |
Ga0182008_107144262 | 3300014497 | Rhizosphere | VNTYHSILYVHLLSLFVGIGAGSVLLACLFQLRAARAVEQAAP |
Ga0134073_102145101 | 3300015356 | Grasslands Soil | LDTYHAVLYVHLLSLFIGVGAASILMVCLFQLRKAQTLMEAAP |
Ga0134072_101320581 | 3300015357 | Grasslands Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAG |
Ga0132256_1031245081 | 3300015372 | Arabidopsis Rhizosphere | LNTYHYVLYVHLLSLFVGIGAGPVLLACLLQLRAA |
Ga0187778_108021101 | 3300017961 | Tropical Peatland | LNTYHYVLYVHLLSLFLGIGAGSVLLTCLFQLRAARTVEQAVPWGIV |
Ga0066655_108284201 | 3300018431 | Grasslands Soil | LNTYHYVLYVHLLSLFLGIGAGSVRLTCLSQLRAAGTVAQARPWGTVSGRVARPLPVASL |
Ga0066662_122727711 | 3300018468 | Grasslands Soil | MDTYHVVLYIHLFALFIGIGAASVLLACLLQLRRAQTLAEAGPWGMVAGKGSRLFPI |
Ga0173479_101622123 | 3300019362 | Soil | VNTYHYVLYVHLLALFVGIGAGAVLLACLLQLRAARTLEQAVPWG |
Ga0193697_10145081 | 3300020005 | Soil | LDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLSD |
Ga0210382_105315172 | 3300021080 | Groundwater Sediment | LDTYHVVLYIHLLALFIGIGAASILLVCLFQLRAAQTLADAVPWGSVA |
Ga0222622_108449872 | 3300022756 | Groundwater Sediment | LDTYHVVLYIHLLSLFVGIGAASVLIVCLFQLRGARELTDAIPWG |
Ga0247794_103338892 | 3300024055 | Soil | LDTYHVVLYIHLLSLLVGIGAASVLVVCLFQLRGARELMEAV |
Ga0247661_10933491 | 3300024254 | Soil | LNTYHGVLYFHLLFLFVGIGAGAVLLVCLFQLRAA |
Ga0247666_11144971 | 3300024323 | Soil | LNTYHYVLYVHLLALFVGIGAGSVLLACLLQLRAARTVEQAAPWGI |
Ga0207699_103476053 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTYHVVLYIHLLALFIGIGAASVLLACLLQLRKAQTLAEAGPWGMVAGKVSRLFP |
Ga0207695_104267951 | 3300025913 | Corn Rhizosphere | VNTYHYVLYVHLMSLFVGIGAGSVLLVCLLQLRAARTVEQA |
Ga0207663_101071172 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCLFQLRSAQT |
Ga0207660_108933861 | 3300025917 | Corn Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCLFQLRSAQTLAD |
Ga0207694_105260392 | 3300025924 | Corn Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCTYQLRSA |
Ga0207700_110196731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VNTYHDVLYVHLLSLFIGIGAASVLLVSLFQLRAAR |
Ga0207711_109908851 | 3300025941 | Switchgrass Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADAIPWGRVAGKIS |
Ga0207667_104990892 | 3300025949 | Corn Rhizosphere | LDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADAIP |
Ga0207677_115948232 | 3300026023 | Miscanthus Rhizosphere | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSALTLADAIPWGRVAGKI |
Ga0209265_10130781 | 3300026308 | Soil | LDKYHVALYIHFLSLLIGIGAASVLTVCAFQLRAART |
Ga0209265_10468574 | 3300026308 | Soil | LDTYHVVLYIHFLALFVGIGAGAVLLVCLFQLRTAQTLAD |
Ga0209265_12410832 | 3300026308 | Soil | LTTYHYVLYVHLLALFIGIGAGSVLLACLLQLRAARTVEQAGPWGMMAGKMGKL |
Ga0209804_11091113 | 3300026335 | Soil | LDTYHVVLYIHLLALFVGIGAGAVLLVCLFQLRGAQTLANAVPWGRVAG |
Ga0209808_12921941 | 3300026523 | Soil | LNTYHYVLYVHLLSLFLGIGAGSVLLTCLFQLRAAGTVEQAV |
Ga0209805_13683922 | 3300026542 | Soil | VDTYHYVLYIHLLSLFVGIGAAAVLSLCLFQLRGAR |
Ga0209074_101812922 | 3300027787 | Agricultural Soil | MDTYQVVLYIHLLALFIGIGAASVLLSCLLQLRKA |
Ga0209811_100567301 | 3300027821 | Surface Soil | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSA |
Ga0307311_100586292 | 3300028716 | Soil | LDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGKVAG |
Ga0307298_100291101 | 3300028717 | Soil | LDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGKVAGKT |
Ga0307316_100410582 | 3300028755 | Soil | LDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGKVAGKTARVFPIAIL |
Ga0307282_100300451 | 3300028784 | Soil | LDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRAAGTLADALPWGK |
Ga0307282_104484821 | 3300028784 | Soil | LDTYHVVLYIHLLSLFVGIGAAAVLSVCLFQLRAAR |
Ga0307305_102187141 | 3300028807 | Soil | LDTYHVVLYIHLLALFVGVGAAGVLLVCLFQLRGAQTVSDAAPWGAVAGKTGRFF |
Ga0307294_100742972 | 3300028810 | Soil | LDTYHVVLYIHLLSLFVGIGAAAVLSVCLFQLRAARELTDAVPWGMVAGKTGRM |
Ga0307292_102613381 | 3300028811 | Soil | LDTYHYVLYVHLLSLFVGIGAAAVLSVCLFQLRSARELTDALPWGRVA |
Ga0307289_103570471 | 3300028875 | Soil | LDTYHVVLYIHFLALFVGIGAAGVLVTCLFQLRGAGT |
Ga0307289_104547751 | 3300028875 | Soil | LDTYHVVLYIHLLSLFVGIGAASVLVVCLFQLRDARELTDAIPWGRVAGKIGRL |
Ga0307308_103982122 | 3300028884 | Soil | LDTYHVVLYIHLLALFVGVGAAGVLLVCLFQLRGAQTVSDAAPWGAVAGKTGRF |
Ga0307498_101914982 | 3300031170 | Soil | LDTYHVVLYLHLLALFIGIGAASILLVCIFQLRSAQTLADA |
Ga0307498_102240031 | 3300031170 | Soil | MHLLALFLGIGAGSVLLVCLLQLRAARTLADAVPWG |
Ga0307498_104759711 | 3300031170 | Soil | LDTYHVVLYLHLLSLLIGIGASSILLVCTFQLRSAQTLAD |
Ga0307495_100382941 | 3300031199 | Soil | MDTYHVVLYIHLLSLFIGIGAGAVLLTCLFQLRAARTVEQAVPWGIVSGKV |
Ga0318515_106451892 | 3300031572 | Soil | VDTYHVVLYLHLLSLFIGLGAASVLMACLFRLRVAQTLTDAAP |
Ga0307469_124742101 | 3300031720 | Hardwood Forest Soil | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSAQTLADAIPWGRV |
Ga0306923_101469571 | 3300031910 | Soil | LDTYHVVLYVHLLSLLLGIGAGSVLLTCLFQLRAAPTVEQAAPWGIVS |
Ga0308174_107820551 | 3300031939 | Soil | LDTYHVVLYLHLLSLFIGIGAGSVLLTCLFQLKAAGTVEQAVPWG |
Ga0310906_108886362 | 3300032013 | Soil | LDTYHVVLYLHLLALFIGIGAGSILLVCIFQLRSAQTLADAIPW |
Ga0308173_112576511 | 3300032074 | Soil | MDTYHVVLYVHLLALFVGVGAGAVLSVCLFQLRSAQTLGDAVP |
Ga0308173_116733993 | 3300032074 | Soil | MDTYHVVLYLHLISLFIGIGAGSVLLACLFQLRAARTVEQAVPWGI |
Ga0306924_119022381 | 3300032076 | Soil | LDTYHVVLYVHLLSLLLGIGAGSVLLTCLFQLRAAPTVEQAAPWGIVSGKVA |
Ga0318525_107222811 | 3300032089 | Soil | LNTYHYVLYVHLLSLFIGIGAGSVVLACLLQLRAA |
⦗Top⦘ |