Basic Information | |
---|---|
Family ID | F057336 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 36 residues |
Representative Sequence | MADNDKEREAFLIKIGQAKPVAEKPKPTAKKDEE |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 79.41 % |
% of genes near scaffold ends (potentially truncated) | 16.18 % |
% of genes from short scaffolds (< 2000 bps) | 65.44 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (83.824 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (38.235 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.529 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (50.735 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.97% β-sheet: 0.00% Coil/Unstructured: 79.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 8.09 |
PF04860 | Phage_portal | 4.41 |
PF12850 | Metallophos_2 | 2.21 |
PF01844 | HNH | 1.47 |
PF03354 | TerL_ATPase | 0.74 |
PF03237 | Terminase_6N | 0.74 |
PF04586 | Peptidase_S78 | 0.74 |
PF00386 | C1q | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 8.09 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.74 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.38 % |
Unclassified | root | N/A | 6.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000117|DelMOWin2010_c10167181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300001267|B570J13875_102368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300002212|metazooDRAFT_1358424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300005421|Ga0068882_1662007 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300005525|Ga0068877_10004960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10288 | Open in IMG/M |
3300005525|Ga0068877_10020203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4705 | Open in IMG/M |
3300005525|Ga0068877_10084555 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
3300005525|Ga0068877_10238308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300005525|Ga0068877_10407980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300005528|Ga0068872_10016165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5118 | Open in IMG/M |
3300005581|Ga0049081_10054101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1517 | Open in IMG/M |
3300005613|Ga0074649_1014090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5157 | Open in IMG/M |
3300005758|Ga0078117_1001929 | All Organisms → cellular organisms → Bacteria | 11294 | Open in IMG/M |
3300005805|Ga0079957_1041626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2908 | Open in IMG/M |
3300005805|Ga0079957_1164943 | All Organisms → Viruses → Predicted Viral | 1108 | Open in IMG/M |
3300005805|Ga0079957_1169251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
3300006025|Ga0075474_10230557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300006030|Ga0075470_10088540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300006637|Ga0075461_10010369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3079 | Open in IMG/M |
3300006637|Ga0075461_10025995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1932 | Open in IMG/M |
3300006637|Ga0075461_10039164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1549 | Open in IMG/M |
3300006637|Ga0075461_10041666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1499 | Open in IMG/M |
3300006637|Ga0075461_10106795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300006637|Ga0075461_10204335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300006734|Ga0098073_1023621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300006802|Ga0070749_10005457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8402 | Open in IMG/M |
3300006802|Ga0070749_10035646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3077 | Open in IMG/M |
3300006802|Ga0070749_10071713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2076 | Open in IMG/M |
3300006802|Ga0070749_10129641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1477 | Open in IMG/M |
3300006802|Ga0070749_10140325 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
3300006802|Ga0070749_10256423 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300006802|Ga0070749_10317983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300006802|Ga0070749_10332227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300006802|Ga0070749_10636956 | Not Available | 573 | Open in IMG/M |
3300006802|Ga0070749_10647021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300006802|Ga0070749_10651583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300006802|Ga0070749_10725634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300006869|Ga0075477_10134308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
3300006874|Ga0075475_10338764 | Not Available | 614 | Open in IMG/M |
3300006917|Ga0075472_10324714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300006919|Ga0070746_10114806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
3300007177|Ga0102978_1163140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2575 | Open in IMG/M |
3300007234|Ga0075460_10020439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2598 | Open in IMG/M |
3300007363|Ga0075458_10243862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300007534|Ga0102690_1735139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300007538|Ga0099851_1009408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4030 | Open in IMG/M |
3300007538|Ga0099851_1125975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300007538|Ga0099851_1163244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300007539|Ga0099849_1094374 | All Organisms → Viruses → Predicted Viral | 1197 | Open in IMG/M |
3300007541|Ga0099848_1004425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6459 | Open in IMG/M |
3300007541|Ga0099848_1005921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5586 | Open in IMG/M |
3300007541|Ga0099848_1174698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300007541|Ga0099848_1295158 | Not Available | 557 | Open in IMG/M |
3300007640|Ga0070751_1193945 | Not Available | 793 | Open in IMG/M |
3300007734|Ga0104986_1493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15847 | Open in IMG/M |
3300007960|Ga0099850_1057523 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
3300008055|Ga0108970_11061839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3979 | Open in IMG/M |
3300008107|Ga0114340_1007100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5800 | Open in IMG/M |
3300008117|Ga0114351_1006621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14603 | Open in IMG/M |
3300008117|Ga0114351_1377651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300008120|Ga0114355_1136039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300008266|Ga0114363_1002163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11164 | Open in IMG/M |
3300008266|Ga0114363_1025217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2571 | Open in IMG/M |
3300008266|Ga0114363_1067005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
3300008266|Ga0114363_1098440 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
3300008266|Ga0114363_1146001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300008266|Ga0114363_1241933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300008448|Ga0114876_1001551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16871 | Open in IMG/M |
3300008450|Ga0114880_1046705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1850 | Open in IMG/M |
3300008450|Ga0114880_1090028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1207 | Open in IMG/M |
3300008450|Ga0114880_1205487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300008450|Ga0114880_1238234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300009149|Ga0114918_10062385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2443 | Open in IMG/M |
3300010299|Ga0129342_1104172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
3300010318|Ga0136656_1123279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300010354|Ga0129333_10009817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9039 | Open in IMG/M |
3300010354|Ga0129333_10010249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8868 | Open in IMG/M |
3300010354|Ga0129333_10049473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3940 | Open in IMG/M |
3300010354|Ga0129333_10075477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3131 | Open in IMG/M |
3300010354|Ga0129333_10112517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2511 | Open in IMG/M |
3300010354|Ga0129333_10426960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
3300010354|Ga0129333_10477632 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300010354|Ga0129333_10700192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300010354|Ga0129333_11118119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300010354|Ga0129333_11210429 | Not Available | 627 | Open in IMG/M |
3300011113|Ga0151517_1250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21365 | Open in IMG/M |
3300012666|Ga0157498_1023160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1066969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
3300019784|Ga0181359_1012354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3088 | Open in IMG/M |
3300019784|Ga0181359_1119210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300019784|Ga0181359_1199670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300020570|Ga0208465_1000595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9385 | Open in IMG/M |
3300021960|Ga0222715_10139175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
3300021961|Ga0222714_10024748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4590 | Open in IMG/M |
3300021961|Ga0222714_10039404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3399 | Open in IMG/M |
3300022063|Ga0212029_1002839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1720 | Open in IMG/M |
3300022063|Ga0212029_1010790 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
3300022063|Ga0212029_1070908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300022176|Ga0212031_1051542 | Not Available | 692 | Open in IMG/M |
3300022198|Ga0196905_1006243 | All Organisms → Viruses → Predicted Viral | 4161 | Open in IMG/M |
3300022198|Ga0196905_1008863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3391 | Open in IMG/M |
3300022198|Ga0196905_1023828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1892 | Open in IMG/M |
3300022198|Ga0196905_1063486 | Not Available | 1027 | Open in IMG/M |
3300022200|Ga0196901_1004483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6326 | Open in IMG/M |
3300024262|Ga0210003_1356115 | Not Available | 543 | Open in IMG/M |
3300024289|Ga0255147_1036598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300024500|Ga0255143_1009524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1657 | Open in IMG/M |
3300024514|Ga0255177_1030525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300024536|Ga0256338_1063312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300024555|Ga0255280_1033771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300024561|Ga0255288_1092190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300024565|Ga0255273_1085901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300024570|Ga0255276_1094806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300024864|Ga0255271_1093932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300025445|Ga0208424_1002737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
3300025630|Ga0208004_1075442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300025818|Ga0208542_1048264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1332 | Open in IMG/M |
3300025848|Ga0208005_1086367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300025889|Ga0208644_1002954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13326 | Open in IMG/M |
3300025889|Ga0208644_1003127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12956 | Open in IMG/M |
3300025889|Ga0208644_1016716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4756 | Open in IMG/M |
3300026566|Ga0256334_1050247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300026571|Ga0255289_1037122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
3300029930|Ga0119944_1000859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5448 | Open in IMG/M |
3300029933|Ga0119945_1000830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4682 | Open in IMG/M |
3300031565|Ga0307379_11104020 | Not Available | 666 | Open in IMG/M |
3300031758|Ga0315907_10005104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14450 | Open in IMG/M |
3300031758|Ga0315907_10380103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300031787|Ga0315900_10379200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300031951|Ga0315904_11303226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300032116|Ga0315903_10917982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300033521|Ga0316616_100067909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2923 | Open in IMG/M |
3300034072|Ga0310127_014163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5363 | Open in IMG/M |
3300034073|Ga0310130_0001392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13259 | Open in IMG/M |
3300034073|Ga0310130_0010883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3177 | Open in IMG/M |
3300034103|Ga0335030_0276904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 38.24% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 8.82% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.09% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.09% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.35% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.41% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.68% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.21% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.21% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.47% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.47% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.47% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.47% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.47% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.74% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.74% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.74% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.74% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.74% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.74% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.74% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001267 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007534 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOWin2010_101671812 | 3300000117 | Marine | LELVMADNDKEREAFLIKIGQVKPKAEAPKPKPTVKKDEE* |
B570J13875_1023683 | 3300001267 | Freshwater | MADNDKEREAFLIKIGQVEPSEKAPKPTTKKDEE* |
metazooDRAFT_13584241 | 3300002212 | Lake | MADNDKEREAFLIKIGQIKPADATPKPTAKKDEE* |
Ga0068882_16620073 | 3300005421 | Freshwater Lake | IGANMAEVDKEREAFLAKIGQVKPVAEKKETKPTKKDEE* |
Ga0068877_100049607 | 3300005525 | Freshwater Lake | MAEVDKEREAFLAKIGQVKPVAEKKETKPTKKDEE* |
Ga0068877_100202036 | 3300005525 | Freshwater Lake | MADNDKEREAFLIKIGQVAPSAEKKEPKPTKKDEE* |
Ga0068877_100845554 | 3300005525 | Freshwater Lake | MAEVDKEREAFLAKIGQVKPAEKKETKQPKKDEE* |
Ga0068877_102383082 | 3300005525 | Freshwater Lake | MADVDKEREAFLAKIGQVELSEKAPKPTTKKDEE* |
Ga0068877_104079802 | 3300005525 | Freshwater Lake | MADIDKEREAFLAKIGQVEPSEKAPKPTTKKDEE* |
Ga0068872_100161655 | 3300005528 | Freshwater Lake | MADNDKEREAFLIKIGQVKPAAKKEEKQPKKDEE* |
Ga0049081_100541013 | 3300005581 | Freshwater Lentic | MADADKEREAFLAKIGQVKPAEPKPTPTAKKDEE* |
Ga0074649_10140906 | 3300005613 | Saline Water And Sediment | MADNDKEREAFLIKIGQVTPSAEKKEPKPTKKDEE* |
Ga0078117_100192920 | 3300005758 | Lake Water | MAEVDKEREAFLIKIGQVEPVAKAEAKPTAKKDEE* |
Ga0079957_10416263 | 3300005805 | Lake | MADHDKDRERFLVKIGQVTPADKAQPKPTAKKDEE* |
Ga0079957_11649433 | 3300005805 | Lake | MAEVDKEREAFLAKIGQVKPAEKKQEKQPKKDEE* |
Ga0079957_11692513 | 3300005805 | Lake | MADIDKEREAFLAKIGQVEPSEKAPKPTTKKEEE* |
Ga0075474_102305572 | 3300006025 | Aqueous | LELNMADNDKERERFLTKIGQVKPVEKKEAKPTAKKDEE* |
Ga0075470_100885402 | 3300006030 | Aqueous | MAEVDKEREAFLAKIGQVKPVVKKEQAKPTQKDEE* |
Ga0075461_100103692 | 3300006637 | Aqueous | MADQDKKREAFLVKIGQKKPTAEAPKPKPTAKKDEE* |
Ga0075461_100259953 | 3300006637 | Aqueous | MADQDKTRERFLIKIGQVKPAEKKEPKPTAKKDEE* |
Ga0075461_100391644 | 3300006637 | Aqueous | MADNDKERERFLTKIGQVKPVEKKEAKPTAKKDEE* |
Ga0075461_100416662 | 3300006637 | Aqueous | MADNDKEREAFLIKIGQVKPKAEAPKPKPTVKKDEE* |
Ga0075461_101067953 | 3300006637 | Aqueous | MAENDKEREAFLAKIGQVKPVAKPDPKPTAKKDEE* |
Ga0075461_102043351 | 3300006637 | Aqueous | LELNMADNDKERERFLIKIGQVKPVEKKETKPTAKKDEE* |
Ga0098073_10236213 | 3300006734 | Marine | MADNDKERERFLIKIGQAKAAEKKEAKPTAKKDEE* |
Ga0070749_100054574 | 3300006802 | Aqueous | MADNDKERERFLIKIGQAKPAEKKEPKPTAKKDEE* |
Ga0070749_100356465 | 3300006802 | Aqueous | MADNDKERERFLTKIGQVKPAEEAPKPKPTAKKDEE* |
Ga0070749_100717134 | 3300006802 | Aqueous | LELIMADQDKKREAFLVKIGQKKPTAEAPKPKPTAKKDEE* |
Ga0070749_101296413 | 3300006802 | Aqueous | MADQDKARERFLIKIGQVKPAEKAKPEPKTTAKKDEE* |
Ga0070749_101403253 | 3300006802 | Aqueous | LELVMTDNKERDAFLKKIGQVKPIAETPKPKPTAKKDEE* |
Ga0070749_102564232 | 3300006802 | Aqueous | MAEVDKEREAFLAKIGQVKPVAKKEQAKPTQKDEE* |
Ga0070749_103179833 | 3300006802 | Aqueous | MADNDKEREAFLIKIGQVKPVADKPKPTATAKKDEE* |
Ga0070749_103322272 | 3300006802 | Aqueous | MAEVDNEREAFLAKIGQVKPVEKKEQKQPKKDEE* |
Ga0070749_106369562 | 3300006802 | Aqueous | LELTMADHDKDRERFLIKICQVTPAEKAQPKPTAKKDEE* |
Ga0070749_106470212 | 3300006802 | Aqueous | MAENDKERERFLTKIGQIKPAEEKAKPIAKKDEE* |
Ga0070749_106515831 | 3300006802 | Aqueous | QRSIRLELIMADNKEREAFLIKIGQVKPVAEKPKPTAKKDEE* |
Ga0070749_107256342 | 3300006802 | Aqueous | MADNDKKRERFLVKIGQVKPAVVAPKPTAKKDEE* |
Ga0075477_101343081 | 3300006869 | Aqueous | IGVNMADNDKEREAFLIKIGQVTPTAQKKEPKPTKKDEE* |
Ga0075475_103387642 | 3300006874 | Aqueous | MADNDKEREAFLIKIGQVTPSAQKKEPKPTKKDEE* |
Ga0075472_103247143 | 3300006917 | Aqueous | MADNDKERERFLVKIGQVAPAVAAPKPTAKKDEE* |
Ga0070746_101148063 | 3300006919 | Aqueous | MADNDKEREAFLIKIGQVTPTAQKKEPKPTKKDEE* |
Ga0102978_11631405 | 3300007177 | Freshwater Lake | MADNDKEREAFLIKIGQVKPAEATPKPTAKKDEE* |
Ga0075460_100204395 | 3300007234 | Aqueous | MADNDKERERFLIKIGQVKPVEKKETKPTAKKDEE* |
Ga0075458_102438622 | 3300007363 | Aqueous | MADNDKEREAFLIKIGQAKPVAEKPKPTAKKDEE* |
Ga0102690_17351394 | 3300007534 | Freshwater Lake | VNMADNDKEREAFLIKIGQVAPSAEKKEPKPTKKDEE* |
Ga0099851_10094086 | 3300007538 | Aqueous | MADQDKKREAFLIKIGQIKPTAEAPKPKPTAKKDEE* |
Ga0099851_11259753 | 3300007538 | Aqueous | MADVNKEREAFLAKIGQVELSEKAPKPTTKKDEE* |
Ga0099851_11632443 | 3300007538 | Aqueous | GVNMADNDKEREAFLIKIGQVAPSAEKKEPKPTKKDEE* |
Ga0099849_10943741 | 3300007539 | Aqueous | NMADNDKEREAFLIKIGQVIPTAQKKEPKPTKKDEE* |
Ga0099848_10044259 | 3300007541 | Aqueous | MADNDKAREAFLIKIGQITPSAEKKEPKPTKKDEE* |
Ga0099848_10059212 | 3300007541 | Aqueous | MADNKEREAFLIKIGQIKPTAEAPKPKPTAKKDEE* |
Ga0099848_11746982 | 3300007541 | Aqueous | MADIDKEREAFLAKIGQVEPSEKAAKPTTKKEEE* |
Ga0099848_12951582 | 3300007541 | Aqueous | MADDKEREAFLKKIGQVKPVAEAPKPKPTAKKDEE* |
Ga0070751_11939452 | 3300007640 | Aqueous | MADNKEREAFLIKIGQVKPVAEKPKPTATAKKDEE* |
Ga0104986_149318 | 3300007734 | Freshwater | MADVDKEREAFLAKIGQVEPSEKAPKPTTKKDEE* |
Ga0099850_10575232 | 3300007960 | Aqueous | MADNKEREAFLFKIGQIKPTAEAPKPKPTAKKDEE* |
Ga0108970_110618394 | 3300008055 | Estuary | MADNDKEREAFLIKIGQIKPNEPKSTPTAKKDEE* |
Ga0114340_10071004 | 3300008107 | Freshwater, Plankton | MAENDKEREAFLIKIGQIKPNEPKSTPTAKKDEE* |
Ga0114351_100662118 | 3300008117 | Freshwater, Plankton | MADNDKEREAFLIKIGQITPSAEKPKPTTAKKDEE* |
Ga0114351_13776512 | 3300008117 | Freshwater, Plankton | QRSLRLELNMADADKEREAFLAKIGQVKPAEPKPTAKKDEE* |
Ga0114355_11360393 | 3300008120 | Freshwater, Plankton | MADIDKEREAFLAKIGQVELSEKAPKPTTKKDEE* |
Ga0114363_100216320 | 3300008266 | Freshwater, Plankton | MAEVDKEREAFLIKIGQVEPVAKPEKSTAKKDEE* |
Ga0114363_10252175 | 3300008266 | Freshwater, Plankton | MADNDKEREAFLIKIGQAKPIVEKPKPTAKKDEE* |
Ga0114363_10670052 | 3300008266 | Freshwater, Plankton | MAEVDKEREAFLAKIGQVKPIVEAPKPKPTAKKDEE* |
Ga0114363_10984403 | 3300008266 | Freshwater, Plankton | MMADADKEREAFLIKIGQIKPVVEKKEPKPTAKKDEE* |
Ga0114363_11460012 | 3300008266 | Freshwater, Plankton | MAEVDKEREAFLAKIGQVKPVAKKEEAKPTKKDEE* |
Ga0114363_12419332 | 3300008266 | Freshwater, Plankton | MTDKDRERFLIKVGQIQPKPKAQPKAEPKTQPTAKKDEE* |
Ga0114876_100155120 | 3300008448 | Freshwater Lake | MADNDKKRERFLTKIGQVKPAEETPKPKPTAKKDEE* |
Ga0114880_10467053 | 3300008450 | Freshwater Lake | MADNDKERERFLTKIGQVKPAEEAKPKPTAKKDEE* |
Ga0114880_10900283 | 3300008450 | Freshwater Lake | MADNDKERERFLTKIGQVKPAEKPKPTTTAKKDEE* |
Ga0114880_12054873 | 3300008450 | Freshwater Lake | MADVDKEREAFLAKIGQVKPIVEAPKPKPTAKKDEE* |
Ga0114880_12382341 | 3300008450 | Freshwater Lake | MAENDKERERFLVKIGQIKPAEEKAKPIAKKDEE* |
Ga0114918_100623852 | 3300009149 | Deep Subsurface | MADNDKEREAFLIKIGQITPSAEKKEPKPTKKDEE* |
Ga0129342_11041722 | 3300010299 | Freshwater To Marine Saline Gradient | MADNDKEREAFLIKIGQITPTAEKKEPKPTKKDEE* |
Ga0136656_11232793 | 3300010318 | Freshwater To Marine Saline Gradient | MADNDKEREAFLIKIGQVTPTAQKKEPKPTKKDED* |
Ga0129333_100098173 | 3300010354 | Freshwater To Marine Saline Gradient | MADNDKEREAFLIKIGQVAPSASTPKPTAKKDEE* |
Ga0129333_100102495 | 3300010354 | Freshwater To Marine Saline Gradient | MADADKEREAFLAKIGQVKPAEPKSTPTAKKDEE* |
Ga0129333_100494736 | 3300010354 | Freshwater To Marine Saline Gradient | NMADNDKERERFLTKIGQVKPVEKKEAKPTAKKDEE* |
Ga0129333_100754775 | 3300010354 | Freshwater To Marine Saline Gradient | MADNDKEREAFLIKIGQAASSAPKPAPTAKKDEE* |
Ga0129333_101125174 | 3300010354 | Freshwater To Marine Saline Gradient | MADHDKDRERFLIKIGQVTPAEKAQPKPTAKKDEE* |
Ga0129333_104269603 | 3300010354 | Freshwater To Marine Saline Gradient | MTDNKERDAFLKKIGQVKPIAETPKPKPTAKKDEE* |
Ga0129333_104776324 | 3300010354 | Freshwater To Marine Saline Gradient | MADVEKEREAFLAKIGQVKPTEPKPTATAKKDEE* |
Ga0129333_107001923 | 3300010354 | Freshwater To Marine Saline Gradient | MAENDKERERFLVKIGQIKPAEEKAKPIAKKDED* |
Ga0129333_111181193 | 3300010354 | Freshwater To Marine Saline Gradient | MADQDKDRERFLIKIGQVTPAEKAQPKPTAKKDEE* |
Ga0129333_112104292 | 3300010354 | Freshwater To Marine Saline Gradient | MAENDKEREAFLAKIGQVKPVAKKEEAKPTKKDEE* |
Ga0151517_125019 | 3300011113 | Freshwater | MADVDKEREAFLAKIGQAELSEKAPKPTTKKDEE* |
Ga0157498_10231602 | 3300012666 | Freshwater, Surface Ice | MADVDKEREAFLAKIGQVELSEKAPKPTSKKDEE* |
(restricted) Ga0172374_10669693 | 3300013122 | Freshwater | MADNDKEREAFLIKIGQVKPADATPKPTAKKDEE* |
Ga0181359_10123542 | 3300019784 | Freshwater Lake | MAEVDKEREAFLAKIGQVKPVAKKEEAKPTKKDEE |
Ga0181359_11192102 | 3300019784 | Freshwater Lake | MADNDKEREAFLIKIGQVAPSAEKKEPKPTKKDEE |
Ga0181359_11996701 | 3300019784 | Freshwater Lake | MAEVDKEREAFLAKIGQVKPVAKKEQAKPTQKDEE |
Ga0208465_10005956 | 3300020570 | Freshwater | MAEVDKEREAFLAKIGQVKPVVKKEQAKPTQKDEE |
Ga0222715_101391753 | 3300021960 | Estuarine Water | MADNDKEREAFLIKIGQVIPTAQKKEPKPTKKDEE |
Ga0222714_100247486 | 3300021961 | Estuarine Water | FYPIGVNIMADNDKEREAFLIKIGQVTPSAEKKEPKPTKKDEE |
Ga0222714_100394042 | 3300021961 | Estuarine Water | MADNDKEREAFLIKIGQVTPTAQKKEPKPTKKDEE |
Ga0212029_10028393 | 3300022063 | Aqueous | MADNDKEREAFLIKIGQVKPKAEAPKPKPTVKKDEE |
Ga0212029_10107901 | 3300022063 | Aqueous | MTDNKERDAFLKKIGQVKPIAETPKPKPTAKKDEE |
Ga0212029_10709081 | 3300022063 | Aqueous | MADNDKERERFLTKIGQVKPVEKKEAKPTAKKDEE |
Ga0212031_10515422 | 3300022176 | Aqueous | MADNKEREAFLIKIGQIKPTAEAPKPKPTAKKDEE |
Ga0196905_10062432 | 3300022198 | Aqueous | MADNDKAREAFLIKIGQITPSAEKKEPKPTKKDEE |
Ga0196905_10088634 | 3300022198 | Aqueous | MADQDKKREAFLIKIGQIKPTAEAPKPKPTAKKDEE |
Ga0196905_10238282 | 3300022198 | Aqueous | MADNDKEREAFLIKIGQVTPSAQKKEPKPTKKDEE |
Ga0196905_10634862 | 3300022198 | Aqueous | MADNDKERERFLIKIGQAKAAEKKEAKPTAKKDEE |
Ga0196901_10044839 | 3300022200 | Aqueous | ELNMADNDKERERFLTKIGQVKPVEKKEAKPTAKKDEE |
Ga0210003_13561152 | 3300024262 | Deep Subsurface | MADNDKEREAFLIKIGQITPSAEKKEPKPTKKDEE |
Ga0255147_10365981 | 3300024289 | Freshwater | MADADKEREAFLIKIGQIKPVVEKKETKPTVKKDEE |
Ga0255143_10095244 | 3300024500 | Freshwater | MADADKEREAFLIKIGQIKPVVEKKETKPTVKKDE |
Ga0255177_10305253 | 3300024514 | Freshwater | NTMADNDKERERFLTKIGQVKPAEEAPKPKPTAKKDEE |
Ga0256338_10633123 | 3300024536 | Freshwater | ADNDKERERFLTKIGQVKPAEEAPKPKPTAKKDEE |
Ga0255280_10337714 | 3300024555 | Freshwater | PIGANTMADNDKERERFLTKIGQVKPAEEAPKPKPTAKKDEE |
Ga0255288_10921902 | 3300024561 | Freshwater | AEMADADKEREAFLIKIGQIKPVVEKKETKPTVKKDEE |
Ga0255273_10859011 | 3300024565 | Freshwater | ADADKEREAFLIKIGQIKPVVEKKETKPTVKKDEE |
Ga0255276_10948061 | 3300024570 | Freshwater | IGANTMADNDKERERFLTKIGQVKPAEEAPKPKPTAKKDEE |
Ga0255271_10939322 | 3300024864 | Freshwater | EMADADKEREAFLIKIGQIKPVVEKKETKPTVKKDEE |
Ga0208424_10027372 | 3300025445 | Aqueous | MAENDKEREAFLAKIGQVKPVAKPDPKPTAKKDEE |
Ga0208004_10754423 | 3300025630 | Aqueous | MADQDKKREAFLVKIGQKKPTAEAPKPKPTAKKDEE |
Ga0208542_10482641 | 3300025818 | Aqueous | MADNDKERERFLIKIGQVKPVEKKETKPTAKKDEE |
Ga0208005_10863672 | 3300025848 | Aqueous | MADNDKEREAFLIKIGQVKPVADKPKPTATAKKDEE |
Ga0208644_100295419 | 3300025889 | Aqueous | MADNDKERERFLIKIGQAKPAEKKEPKPTAKKDEE |
Ga0208644_100312717 | 3300025889 | Aqueous | MAEVDKEREAFLAKIGQVKPVAKKEETKQPKKDEE |
Ga0208644_10167166 | 3300025889 | Aqueous | MADQDKARERFLIKIGQVKPAEKAKPEPKTTAKKDEE |
Ga0256334_10502471 | 3300026566 | Freshwater | IGAEMADADKEREAFLIKIGQIKPVVEKKETKPTVKKDEE |
Ga0255289_10371221 | 3300026571 | Freshwater | QIGAEMADADKEREAFLIKIGQIKPVVEKKETKPTVKKDEE |
Ga0119944_10008595 | 3300029930 | Aquatic | MAENDKEREAFLAKIGQVKPIAKPEPKTTAKKDEE |
Ga0119945_10008306 | 3300029933 | Aquatic | MAEVDKEREAFLIKIGQVEPVAKAEAKPTAKKDEE |
Ga0307379_111040202 | 3300031565 | Soil | MADNDKEREAFLIKIGQITPNAQKKEPKPTKKDEE |
Ga0315907_100051046 | 3300031758 | Freshwater | MADNDKEREAFLIKIGQITPSAEKPKPTTAKKDEE |
Ga0315907_103801032 | 3300031758 | Freshwater | MAEVDKEREAFLAKIGQVKPIVEAPKPKPTAKKDEE |
Ga0315900_103792003 | 3300031787 | Freshwater | MMADADKEREAFLIKIGQIKPVVEKKEPKPTAKKDEE |
Ga0315904_113032262 | 3300031951 | Freshwater | MADNDKERERFLTKIGQVKPAEKPKPTTTAKKDEE |
Ga0315903_109179821 | 3300032116 | Freshwater | IRLELIMADNDKEREAFLIKIGQIAPAPKATAKKEEE |
Ga0316616_1000679095 | 3300033521 | Soil | MADNKEREAFLIKIGQIKPVAETPKPKPTAKKDEE |
Ga0310127_014163_2811_2918 | 3300034072 | Fracking Water | MADHDKDRERFLVKIGQVTPADKAQPKPTAKKDEE |
Ga0310130_0001392_3718_3825 | 3300034073 | Fracking Water | MADDKEREAFLKKIGQVKPVAEAPKPKPTAKKDEE |
Ga0310130_0010883_2695_2805 | 3300034073 | Fracking Water | MADNKERERFLTKIGQVKPVAETPKPKPTTAKKDEE |
Ga0335030_0276904_888_998 | 3300034103 | Freshwater | MMADADKEREAFLIKIGQIKPIVEKKEPKQTKKDEE |
⦗Top⦘ |