NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F057429

Metagenome Family F057429

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057429
Family Type Metagenome
Number of Sequences 136
Average Sequence Length 67 residues
Representative Sequence MNARVFVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN
Number of Associated Samples 88
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 48.53 %
% of genes near scaffold ends (potentially truncated) 36.03 %
% of genes from short scaffolds (< 2000 bps) 75.00 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.971 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(59.559 % of family members)
Environment Ontology (ENVO) Unclassified
(91.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.912 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.51%    β-sheet: 12.77%    Coil/Unstructured: 78.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF137592OG-FeII_Oxy_5 41.91
PF02657SufE 10.29
PF01612DNA_pol_A_exo1 2.21
PF01832Glucosaminidase 2.21
PF00476DNA_pol_A 1.47
PF03592Terminase_2 0.74
PF13361UvrD_C 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG2166Sulfur transfer protein SufE, Fe-S cluster assemblyPosttranslational modification, protein turnover, chaperones [O] 10.29
COG0749DNA polymerase I, 3'-5' exonuclease and polymerase domainsReplication, recombination and repair [L] 1.47
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 0.74

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.91 %
UnclassifiedrootN/A8.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10051187All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101630Open in IMG/M
3300000117|DelMOWin2010_c10001640Not Available14417Open in IMG/M
3300000949|BBAY94_10052151All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101136Open in IMG/M
3300001450|JGI24006J15134_10044953All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101846Open in IMG/M
3300002231|KVRMV2_100632255All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10780Open in IMG/M
3300002231|KVRMV2_100985836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10517Open in IMG/M
3300002242|KVWGV2_10367566All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101107Open in IMG/M
3300002483|JGI25132J35274_1016891All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300002483|JGI25132J35274_1053171All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10872Open in IMG/M
3300002483|JGI25132J35274_1072773All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10718Open in IMG/M
3300002488|JGI25128J35275_1027151All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101362Open in IMG/M
3300002488|JGI25128J35275_1077716All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10685Open in IMG/M
3300002514|JGI25133J35611_10171212All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10584Open in IMG/M
3300002518|JGI25134J35505_10039358All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300005523|Ga0066865_10393011All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10527Open in IMG/M
3300006029|Ga0075466_1002320Not Available7052Open in IMG/M
3300006029|Ga0075466_1127948All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10669Open in IMG/M
3300006332|Ga0068500_1779496All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300006735|Ga0098038_1001282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria10872Open in IMG/M
3300006735|Ga0098038_1007989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales4223Open in IMG/M
3300006735|Ga0098038_1036310All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101821Open in IMG/M
3300006735|Ga0098038_1113346All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10927Open in IMG/M
3300006737|Ga0098037_1030145Not Available2002Open in IMG/M
3300006738|Ga0098035_1021650All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102500Open in IMG/M
3300006750|Ga0098058_1034060All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101471Open in IMG/M
3300006752|Ga0098048_1048029All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101347Open in IMG/M
3300006752|Ga0098048_1064695All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300006752|Ga0098048_1140428All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10722Open in IMG/M
3300006752|Ga0098048_1172825All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10641Open in IMG/M
3300006754|Ga0098044_1031465All Organisms → cellular organisms → Bacteria2330Open in IMG/M
3300006754|Ga0098044_1162264All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10892Open in IMG/M
3300006789|Ga0098054_1052435All Organisms → Viruses → Predicted Viral1560Open in IMG/M
3300006793|Ga0098055_1123854All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101003Open in IMG/M
3300006793|Ga0098055_1151967All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10890Open in IMG/M
3300006793|Ga0098055_1270145All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10638Open in IMG/M
3300006919|Ga0070746_10001446All Organisms → cellular organisms → Bacteria14190Open in IMG/M
3300006920|Ga0070748_1186728All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10761Open in IMG/M
3300006921|Ga0098060_1004858All Organisms → cellular organisms → Bacteria4711Open in IMG/M
3300006921|Ga0098060_1171901All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10597Open in IMG/M
3300006922|Ga0098045_1103901All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10669Open in IMG/M
3300006923|Ga0098053_1039403All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10990Open in IMG/M
3300006923|Ga0098053_1057118All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10802Open in IMG/M
3300006923|Ga0098053_1108685All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10558Open in IMG/M
3300006929|Ga0098036_1074281All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300007229|Ga0075468_10019553All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102513Open in IMG/M
3300008050|Ga0098052_1054316All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300008050|Ga0098052_1110270All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101115Open in IMG/M
3300009593|Ga0115011_11644685All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10573Open in IMG/M
3300009605|Ga0114906_1181676All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10712Open in IMG/M
3300011013|Ga0114934_10097507All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101435Open in IMG/M
3300012953|Ga0163179_10762081All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10827Open in IMG/M
3300017704|Ga0181371_1006589All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102042Open in IMG/M
3300017704|Ga0181371_1049071All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10687Open in IMG/M
3300017705|Ga0181372_1004731All Organisms → cellular organisms → Bacteria2686Open in IMG/M
3300017706|Ga0181377_1061821All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10694Open in IMG/M
3300017718|Ga0181375_1009942All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101669Open in IMG/M
3300017721|Ga0181373_1020076All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101246Open in IMG/M
3300017724|Ga0181388_1063502All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10884Open in IMG/M
3300017725|Ga0181398_1117377All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10634Open in IMG/M
3300017728|Ga0181419_1137293All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10590Open in IMG/M
3300017730|Ga0181417_1152583All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10557Open in IMG/M
3300017742|Ga0181399_1166621All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10525Open in IMG/M
3300017744|Ga0181397_1010295Not Available2890Open in IMG/M
3300017752|Ga0181400_1142259All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10684Open in IMG/M
3300017757|Ga0181420_1205588All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10570Open in IMG/M
3300017760|Ga0181408_1028665All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101525Open in IMG/M
3300017764|Ga0181385_1056321All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101221Open in IMG/M
3300017767|Ga0181406_1077204All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101016Open in IMG/M
3300017768|Ga0187220_1240227All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10543Open in IMG/M
3300017773|Ga0181386_1101894All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10895Open in IMG/M
3300020349|Ga0211511_1066867All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10868Open in IMG/M
3300020428|Ga0211521_10124309All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101224Open in IMG/M
3300020428|Ga0211521_10181323All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10970Open in IMG/M
3300020471|Ga0211614_10432312All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10583Open in IMG/M
3300020472|Ga0211579_10037344All Organisms → cellular organisms → Bacteria3071Open in IMG/M
3300020473|Ga0211625_10000885Not Available33990Open in IMG/M
3300022053|Ga0212030_1001073All Organisms → cellular organisms → Bacteria2355Open in IMG/M
3300022072|Ga0196889_1107696All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10504Open in IMG/M
3300022074|Ga0224906_1061485All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101176Open in IMG/M
3300022178|Ga0196887_1030944All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101494Open in IMG/M
3300022178|Ga0196887_1045989All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101135Open in IMG/M
(restricted) 3300024052|Ga0255050_10081237All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10728Open in IMG/M
3300024344|Ga0209992_10030708All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102745Open in IMG/M
3300024344|Ga0209992_10049070All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102029Open in IMG/M
3300024344|Ga0209992_10292722All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10666Open in IMG/M
3300025066|Ga0208012_1003507All Organisms → Viruses → Predicted Viral3442Open in IMG/M
3300025066|Ga0208012_1007429All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102067Open in IMG/M
3300025066|Ga0208012_1011160All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101588Open in IMG/M
3300025079|Ga0207890_1002424Not Available4672Open in IMG/M
3300025084|Ga0208298_1072619All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10646Open in IMG/M
3300025086|Ga0208157_1130918All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10572Open in IMG/M
3300025096|Ga0208011_1000962Not Available10637Open in IMG/M
3300025096|Ga0208011_1067456All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10801Open in IMG/M
3300025098|Ga0208434_1045173All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10981Open in IMG/M
3300025098|Ga0208434_1085371All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10637Open in IMG/M
3300025099|Ga0208669_1002343Not Available6564Open in IMG/M
3300025099|Ga0208669_1004014All Organisms → cellular organisms → Bacteria4718Open in IMG/M
3300025099|Ga0208669_1014161All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102154Open in IMG/M
3300025099|Ga0208669_1018933All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101794Open in IMG/M
3300025099|Ga0208669_1050378All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300025102|Ga0208666_1028002All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101726Open in IMG/M
3300025103|Ga0208013_1001833Not Available9353Open in IMG/M
3300025103|Ga0208013_1014734All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102407Open in IMG/M
3300025103|Ga0208013_1047225All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101179Open in IMG/M
3300025103|Ga0208013_1079221All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10852Open in IMG/M
3300025108|Ga0208793_1032208All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101736Open in IMG/M
3300025108|Ga0208793_1033220All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101700Open in IMG/M
3300025114|Ga0208433_1025874All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101644Open in IMG/M
3300025118|Ga0208790_1052728All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101274Open in IMG/M
3300025118|Ga0208790_1091915All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10892Open in IMG/M
3300025120|Ga0209535_1216369All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10520Open in IMG/M
3300025128|Ga0208919_1010968All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED103691Open in IMG/M
3300025128|Ga0208919_1105165All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10906Open in IMG/M
3300025132|Ga0209232_1101167All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10972Open in IMG/M
3300025132|Ga0209232_1118405All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10876Open in IMG/M
3300025132|Ga0209232_1134004All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10806Open in IMG/M
3300025132|Ga0209232_1141108All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10777Open in IMG/M
3300025132|Ga0209232_1148567All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10750Open in IMG/M
3300025132|Ga0209232_1153088All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10735Open in IMG/M
3300025133|Ga0208299_1183280All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10633Open in IMG/M
3300025141|Ga0209756_1022666All Organisms → Viruses3577Open in IMG/M
3300025141|Ga0209756_1066144All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101683Open in IMG/M
3300025151|Ga0209645_1037267All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101763Open in IMG/M
3300025151|Ga0209645_1063759All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101260Open in IMG/M
3300025769|Ga0208767_1003579Not Available11245Open in IMG/M
3300025806|Ga0208545_1030539All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101736Open in IMG/M
3300028022|Ga0256382_1106360All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10674Open in IMG/M
3300029309|Ga0183683_1005436All Organisms → cellular organisms → Bacteria3872Open in IMG/M
3300029319|Ga0183748_1071283All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10892Open in IMG/M
3300029448|Ga0183755_1004497Not Available6683Open in IMG/M
3300029448|Ga0183755_1017961All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED102437Open in IMG/M
3300029448|Ga0183755_1064650All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10846Open in IMG/M
3300029787|Ga0183757_1002877All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED106547Open in IMG/M
3300029787|Ga0183757_1034563All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101018Open in IMG/M
3300032073|Ga0315315_10537651All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED101081Open in IMG/M
3300032073|Ga0315315_11523553All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10579Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine59.56%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.29%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.56%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.09%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface2.94%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment2.21%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.47%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.47%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.74%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.74%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.74%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.74%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.74%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006923Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300020473Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025114Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1005118713300000115MarineSKSLRHGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
DelMOWin2010_10001640113300000117MarineMKNLQMNVKVCVEYDSKSLRHGPEFLCSECGLWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS*
BBAY94_1005215123300000949Macroalgal SurfaceVEYDKSSVRPGPEFKCSVCGNWFKKLLYWLDKKFNPDQEYKMMFLCGPKCATENHGRNNS
JGI24006J15134_1004495323300001450MarineMNAKVCVEYDSKSVRHGPEFLCSECDSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS*
KVRMV2_10063225523300002231Marine SedimentVEYDKSTVRPGPEFKCSQCGAWFKNLLYWTSKRFNPEQVYQMVFLCGAGCSLKADGKSRIK*
KVRMV2_10098583623300002231Marine SedimentMKNLQMNVKVCVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERRNS*
KVWGV2_1036756623300002242Marine SedimentVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERRNS
JGI25132J35274_101689123300002483MarineMNVKVFVEFDKSSLRPGPEFKCSICGKWFKRLLYWIDKKFNPDLEYDMVFLCGPKCATENHGRNNS*
JGI25132J35274_105317113300002483MarineVKHLMKNLRMNARVFVEYDKSSVRPGPEFKCSVCGNWFKRLLYWLDKKFNPDQEYKMIFFCGPKCATENYDRNNS*
JGI25132J35274_107277313300002483MarineVEYDTSALRPGPEFKCSICGKWFKRLLYWLDKKFNPDQEYKMIXLCGPKCATENHDRNNS
JGI25128J35275_102715113300002488MarineLVKHLMKNLQMNVRVFVEYDKSSVRPGPEFKCSECDTWFKKLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS*
JGI25128J35275_107771623300002488MarineMKNLQMNVRVFVEYDKSSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERESTNNIS*
JGI25133J35611_1017121213300002514MarineNVKVFVEFDKSSLRPGPEFKCSICGKWFKRLLYWIDKKFNPDLEYDMVFLCGPKCATENHGRNNS*
JGI25134J35505_1003935833300002518MarineVRGFVEYDKXSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET*
Ga0066865_1039301123300005523MarineVEYDKSSVRPGPEFKCSICGKWFKRLLYWLDKKFNPDQEYKMIFLCGPKCATENHDRNNS
Ga0075466_1002320153300006029AqueousMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN*
Ga0075466_112794823300006029AqueousVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQN
Ga0068500_177949623300006332MarineVEYDKSSVRPGPEFKCSVCGKWFKRLLYWLDKKFNPDQEYKLVFLCGPKCATENHDRNNS
Ga0098038_1001282133300006735MarineMKNLQMNVRDFVEYDKSSVRPGPEFKCSECGNWFSRLLYWLDKKFNPDQKYNLIFFCGPK
Ga0098038_100798923300006735MarineMNARVFVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN*
Ga0098038_103631013300006735MarineICLVKHLMKNLQMNVKVCVEYDKSSVRPGPEFLCSECNTWFKKLIYWKSKKFNPDQQYQMVFLCGPKCATENYDRNNS*
Ga0098038_111334613300006735MarineRPGPEFKCSECGNWFSRLLYWLDKKFNPDQKYNLIFFCGPKCATEKYERSNK*
Ga0098037_103014573300006737MarineLVKHLMKNLQMNVKVCVEYDSKSVRHGPEFLCSECGSWFKKLIYWASKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS*
Ga0098035_102165023300006738MarineVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET*
Ga0098058_103406023300006750MarineMKNFQMNVRDFVEYDKSTVRPGPEFKCTQCGRWFKKLLYWTSKKFNPEQKYDIMMLCGPKCSLKSYGESRIK*
Ga0098048_104802943300006752MarineMKNLQMNVRVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERDSTRNVS*
Ga0098048_106469523300006752MarineVEYDKESVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET*
Ga0098048_114042823300006752MarineHYLVKHLMKSLRTNAKVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCSTEKYERDSTRNVS*
Ga0098048_117282513300006752MarineGPEFKCAECGTWFKKLLYWLDKQFHPEQEYKLIFLCGPKCATENYDRNNS*
Ga0098044_103146563300006754MarineSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET*
Ga0098044_116226423300006754MarineMNVRVFVEYDKSSVRPGPEFKCSECGGWFKKLIYWTSKQFNPDQKYDIIMLCGPRCALEAYGKSRT*
Ga0098054_105243533300006789MarineMNVRVFVEYDKLSVRPGPEFKCAECGTWFKKLLYWLDKQFHPEQEYKLIFLCGPKCATENYDRNNS*
Ga0098055_112385413300006793MarineLAKHLMKNLQMNAKVFVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPHCATEKYERESTNNVS*
Ga0098055_115196713300006793MarineGPEFKCVECGTWFKRLLYWIDRKFNPDQKYKMIFLCGPKCATENYGRNNS*
Ga0098055_127014523300006793MarineLAKHLMKNLQMNAKVFVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERESTSNVS*
Ga0070746_1000144683300006919AqueousMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNK*
Ga0070748_118672813300006920AqueousMKNLQMNARVFVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN*
Ga0098060_100485823300006921MarineMNVKVCVEYDKSSVRPGPEFLCSECNTWFKKLIYWKSKKFNPDQQYQMVFLCGPKCATENYDRNNS*
Ga0098060_117190123300006921MarineMKNLQMNAKVFVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPHCATEKYERESTNNVS*
Ga0098045_110390113300006922MarineQKHKATCLVRHLMKNLQMNVRVFVEYDKSSVRPGPEFKCSECGKWFKKLIYWKSKKFNPDQQYQMVFLCGPKCATENYDRNNS*
Ga0098053_103940333300006923MarineQMNVRVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCSTEKYERDSTRNVS*
Ga0098053_105711823300006923MarineMKNFQMNVRDFVEYDKSTVRPGPEFKCSQCGTWFKKLLYWTSKKFNPDQEYQMVFLCGAECSLKVYGESRIK*
Ga0098053_110868523300006923MarineMKNLQMNVRVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPHCATEKYERESTNNVS*
Ga0098036_107428123300006929MarineMNVRVSVEYDKQSVRQGPEFKCSECDTWFKNLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS*
Ga0075468_1001955323300007229AqueousVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN
Ga0098052_105431613300008050MarineFVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET*
Ga0098052_111027013300008050MarineEFKCSICGKWFKRLLYWIDKKFNPDLEYDMVFLCGPKCATENHGRNNS*
Ga0115011_1164468523300009593MarineVEFDKSFVRPGPEFKCVECGIWFKRLLYWIDRKFNPDQKYKMIFLCGPKCATENYGRNNS
Ga0114906_118167623300009605Deep OceanVEYDKRSVRQGPEFKCSVCGKWFKKLLYWLDRKFNPDQEYKMIFLCGPKCATENHGRNNS
Ga0114934_1009750743300011013Deep SubsurfaceGPEFKCSECGNWFSRLLYWLDKKFNPDQEYKLIFFCGPKCATEKYERNNK*
Ga0163179_1076208113300012953SeawaterKAICLVKHLMKSLQMNVREFVEYDKKTVRQGPEFLCSECNTWFKKLIYWTSKKFNPDQEYQMVFLCGPKCATENYDRRNS*
Ga0181371_100658913300017704MarineNVRDFVEYDKSTVRPGPEFKCSQCGTWFKKLLYWTSKKFNPDQEYQMVFLCGAECSLKVYGESRIK
Ga0181371_104907123300017704MarineKHLMRNLPMNVRVFVEYDKSSVRPGPEFKCSECGGWFKKLIYWTSKQFNPDQKYDIIMLCGPRCALEAYGKSRTSET
Ga0181372_100473123300017705MarineMKNLQMNAKVFVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERESTSNVS
Ga0181377_106182123300017706MarineVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPQCATEKYERQNK
Ga0181375_100994233300017718MarineMKNFQMNVRDFVEYDKSTVRPGPEFKCSQCGTWFKKLLYWTSKKFNPEQKYDIMMLCGPKCSLKSYGESRIK
Ga0181373_102007623300017721MarineMNVKVYVEYDSKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQGYQMVFLCGPQCATEKYERESTSNVS
Ga0181388_106350223300017724SeawaterMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPQCATEKYERQNN
Ga0181398_111737723300017725SeawaterHYLVKHLMKSLQMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN
Ga0181419_113729323300017728SeawaterMNARVSVEYDKKTVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERQNN
Ga0181417_115258323300017730SeawaterLQMNVRVFVEYDKRSVRPGPEFKCSECGKWFKKLLYWLDRKFNPDQEYRMIFLCGPQCATENYDRNNS
Ga0181399_116662123300017742SeawaterMKSLQMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPQCATEK
Ga0181397_1010295103300017744SeawaterMKSLQMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPQCATEKYERQNK
Ga0181400_114225923300017752SeawaterMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERQNK
Ga0181420_120558813300017757SeawaterNLQMNVRVFVEYDKSSVRPGPEFKCSECDTWFKKLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS
Ga0181408_102866523300017760SeawaterMKNLQMNVRVFVEYDKSSVRPGPEFKCSECDTWFKNLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS
Ga0181385_105632123300017764SeawaterMNVRVFVEYDKRSVRPGPEFKCSECDTWFKNLKYWKSKKFNPDQEYQMVFLCGPKCATENYERNNS
Ga0181406_107720423300017767SeawaterMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQDK
Ga0187220_124022723300017768SeawaterMNARVFVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEK
Ga0181386_110189423300017773SeawaterMNVRVFVEYDKSSVRPGPEFKCSVCGNWFKKLLYWLDKKFNPDQQYKIIFLCGPKCATENHGRNNS
Ga0211511_106686723300020349MarineLVKHLMKSLQMNAKVCVEYDSKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0211521_1012430933300020428MarineMKNLRMNVKVYVEYDSKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0211521_1018132323300020428MarineVEYDKKTVRQGPEFLCSECNTWFKKLIYWTSKKFNPDQEYQMVFLCGPKCATENYDRRNS
Ga0211614_1043231223300020471MarineVEYDTSALRPGPEFKCSICGKWFKRLLYWLDKKFNPDQEYKMIFFCGPKCATENYDRNNS
Ga0211579_1003734443300020472MarineMNVRVFVEYDKSSVRPGPEFKCSVCGNWFKKLLYWLDKKFNPDQEYKMIFLCGPKCATENHGRNNS
Ga0211625_10000885303300020473MarineMKNLRMNARVFVEYDKSSVRPGPKFKCSICGKWFKKLLYWLDKKFNPDQEYKMIFLCGPKCATENHDRNNS
Ga0212030_100107333300022053AqueousMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN
Ga0196889_110769623300022072AqueousKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN
Ga0224906_106148523300022074SeawaterMKNLQMNVKVCVEYDKSSVRPGPEFLCSECNTWFKKLIYWKSKKFNPDQQYQMVFLCGPKCATENYDRNNS
Ga0196887_103094433300022178AqueousMKNLQMNVKVCVEYDSKSLRHGPEFLCSECGLWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0196887_104598923300022178AqueousMKNLQMNARVFVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNK
(restricted) Ga0255050_1008123723300024052SeawaterMKNFQMNVRDFVEYDKSTVRPGPEFKCSQCGTWFKKLLYWTSKKFNPEQEYQMVFLCGAECSLKVYGESRIK
Ga0209992_1003070853300024344Deep SubsurfaceMNVREFVEYDKKTVRQGPEFLCSECNTWFKKLIYWTSKKFNPDQEYQMVFLCGPKCATENYDRRNS
Ga0209992_1004907023300024344Deep SubsurfaceVEYDTSALRPGPEFKCSICGNWFKKLLYWLDKKFNPDQKYRMIFFCGPKCATENHDRNNS
Ga0209992_1029272223300024344Deep SubsurfaceVEYDKSSVRSGPEFKCSVCGNWFKKLLYWLDKKFNPDQEYKMIFLCGPKCATENHGRNNS
Ga0208012_100350723300025066MarineMKNLQMNVRVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERDSTRNVS
Ga0208012_100742943300025066MarineKVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCSTEKYERDSTRNVS
Ga0208012_101116033300025066MarineNKVYLVKHLTKNLRMNVRGFVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET
Ga0207890_1002424123300025079MarineMKSLQMNAKVCVEYDSKSVRHGPEFLCSECDSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0208298_107261913300025084MarineGPEFKCAECGTWFKKLLYWLDKQFHPEQEYKLIFLCGPKCATENYDRNNS
Ga0208157_113091813300025086MarineKNLQMNVKVCVEYDSKSVRHGPEFLCSECGSWFKKLIYWASKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0208011_1000962103300025096MarineMKNSQMNARVFVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPDQKYGIIMLCGPRCALEAYGKSRTSET
Ga0208011_106745623300025096MarineMKNFQMNVRDFVEYDKSTVRPGPEFKCTQCGRWFKKLLYWTSKKFNPEQKYDIMMLCGPKCSLKSYGESRIK
Ga0208434_104517313300025098MarineRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERDSTRNVS
Ga0208434_108537123300025098MarineMKNLQMNAKVFVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCAT
Ga0208669_100234363300025099MarineMKNLQMNVKVCVEYDSKSVRHGPEFLCSECGSWFKKLIYWASKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0208669_100401423300025099MarineMNVKVCVEYDKSSVRPGPEFLCSECNTWFKKLIYWKSKKFNPDQQYQMVFLCGPKCATENYDRNNS
Ga0208669_101416123300025099MarineVEYDKRSVRQGPEFKCSECDTWFKNLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS
Ga0208669_101893353300025099MarineMKNLQMNARDFVEYDKSSVRPGPEFKCSECGNWFSRLLYWLDKKFNPDQKYNLIFFCGPKCATEKYERSNK
Ga0208669_105037823300025099MarineMNARVFVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNN
Ga0208666_102800213300025102MarineLVKHLMKNLQMNVKVCVEYDKSSVRPGPEFLCSECNTWFKKLIYWKSKKFNPDQQYQMVFLCGPKCATENYDRNNS
Ga0208013_100183323300025103MarineVEYDKLSVRPGPEFKCAECGTWFKKLLYWLDKQFHPEQEYKLIFLCGPKCATENYDRNNS
Ga0208013_101473453300025103MarineVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET
Ga0208013_104722523300025103MarineVEFDKSSLRPGPEFKCSICGKWFKRLLYWIDKKFNPDLEYDMVFLCGPKCATENHGRNNS
Ga0208013_107922123300025103MarineMKNLQMNAKVFVEYDTKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPHCATEKYERE
Ga0208793_103220833300025108MarineRMNVRGFVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPDQKYGIIMLCGPRCALEAYGKSRTSET
Ga0208793_103322023300025108MarineMNVRVFVEYDKLSVRPGPEFKCAECGTWFKKLLYWLDKQFHPEQEYKLIFLCGPKCATENYDRNNS
Ga0208433_102587433300025114MarineGFVEYDKGSVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET
Ga0208790_105272823300025118MarineMKNLQMNVRVFVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCSTEKYERDSTRNVS
Ga0208790_109191523300025118MarineMNVRVFVEYDKSSVRPGPEFKCSECGGWFKKLIYWTSKQFNPDQKYDIIMLCGPRCALEAYGKSRT
Ga0209535_121636923300025120MarineMNAKVCVEYDSKSVRHGPEFLCSECDSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0208919_101096823300025128MarineVEYDKSSVRPGPEFKCSECGNWFSRLLYWLDKKFNPDQKYNLIFFCGPKCATEKYERSNK
Ga0208919_110516523300025128MarineMKNLQMNVRVFVEYDKRSVRQGPEFKCSECDTWFKNLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS
Ga0209232_110116723300025132MarineMKNLQMNVKVCVEYDKSAVRPGPEFKCSECGKWFKKLIYWTSKKFNPEQKYGIIMLCGAKCSLKSYGKGRT
Ga0209232_111840513300025132MarineVKHLMKNLQMNVRVFVEYDKSSVRPGPEFKCSECDTWFKKLKYWKSKKFNPDQEYQMVFLCGPKCATENYDRNNS
Ga0209232_113400423300025132MarineVKHLMKNLQMNVRVFVEYDKSSVRPGPEFKCSVCGKWFKKLLYWLDKKFNPDQEYRMIFLCGPKCATENHDRNNS
Ga0209232_114110823300025132MarineVEYDKRSVRPGPEFKCSECDTWFKNLKYWKSKKFNPDQEYQMVFLCGPKCATENYERNNS
Ga0209232_114856723300025132MarineMKNLQMNVRVFVEYDKSSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQEYQMVFLCGPQCATEKYERESTNNIS
Ga0209232_115308823300025132MarineVEFDKSFVRPGPEFKCVECGTWFKRLLYWIDRKFNPDQKYKMIFLCGPKCATENYGRNNS
Ga0208299_118328023300025133MarineMKSLRTNAKVCVEYDKRSVRQGPEFLCSECGSWFKKLIYWTSKKFNLDQEYQMVFLCGPQCATEKYERDST
Ga0209756_102266633300025141MarineMKNSQMNARVFVEYDKESVRPGPEFKCSECGTWFKKLIYWTSKKFNPNQKYGIIMLCGPRCALEAYGKSRTSET
Ga0209756_106614413300025141MarineRPGPEFKCSECGKWFKKLIYWTSKKFNPEQKYGIIMLCGAKCSLKSYGKGRT
Ga0209645_103726723300025151MarineMNVKVFVEFDKSSLRPGPEFKCSICGKWFKRLLYWIDKKFNPDLEYDMVFLCGPKCATENHGRNNS
Ga0209645_106375923300025151MarineVEYDKSSVRPGPEFKCSVCGKWFKKLLYWLDKKFNPDQEYRMIFLCGPKCATENHDRNNS
Ga0208767_100357983300025769AqueousMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPKCATEKYERQNK
Ga0208545_103053923300025806AqueousMKNLQMNVKVCVEYDSKSLRHGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0256382_110636023300028022SeawaterVEYDKSSVRPGPEFKCSVCGNWFKRLLYWLDKKFNPDQEYKMMFLCGPKCATENHGRNNS
Ga0183683_100543643300029309MarineMKNLLMNVRVCVEYNKSCVREGPQYKCYVCKQWFDKLVYWLDKKFNPDQKYRIIFLCGPQCATEKYERSNR
Ga0183748_107128333300029319MarineLTKNLQMNARVFVEYDKSSVRPGPEFKCSICGKWFKRLLYWLDKKFNPDQEYKMIFLCGPKCATENHDRNNS
Ga0183755_100449743300029448MarineMNAKVCVEYDSKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0183755_101796183300029448MarineVEYDKSSVRPGPEFKCSECGKWFKKLLYWLDRKFNPDQEYKMIFLCGPQCATEKYERRNS
Ga0183755_106465043300029448MarineSVRPGPEFKCSVCGNWFKKLLYWLDKKFNPDQEYKMIFLCGPKCATENHGRNNS
Ga0183757_100287723300029787MarineMNVKVCVEYDSKSVRHGPEFLCSECGSWFKKLIYWTSKKFNPDQKYQMVFLCGPQCATEKYERESTSNVS
Ga0183757_103456323300029787MarineVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQEYQMVFLCGPKCATEKYERESTSNVS
Ga0315315_1053765123300032073SeawaterMNARVSVEYDKKTVRQGPEFLCSECDTWFKKLVYWTSKKFNPDQKYQMVFLCGPQCATEKYERQNK
Ga0315315_1152355323300032073SeawaterMKNLQMNVRVFVEYDKSSVRPGPEFKCSECDTWFKKLKYWKSKKFNPDQEYQMVFLCGPKCATENYERNNS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.