Basic Information | |
---|---|
Family ID | F057460 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 49 residues |
Representative Sequence | CPKGKAVSYYPDEIVVEGKLNVEEKKDDGFIVSIFEVEVNSVKPAAK |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.74 % |
% of genes near scaffold ends (potentially truncated) | 98.53 % |
% of genes from short scaffolds (< 2000 bps) | 97.79 % |
Associated GOLD sequencing projects | 103 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.765 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (8.088 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.147 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 38.67% Coil/Unstructured: 61.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF11736 | DUF3299 | 13.97 |
PF02653 | BPD_transp_2 | 0.74 |
PF09537 | DUF2383 | 0.74 |
PF00335 | Tetraspanin | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.76 % |
Unclassified | root | N/A | 13.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105865530 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 2367 | Open in IMG/M |
3300001213|JGIcombinedJ13530_108030573 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 539 | Open in IMG/M |
3300003324|soilH2_10426599 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300004114|Ga0062593_103164180 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 527 | Open in IMG/M |
3300004157|Ga0062590_100868863 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 839 | Open in IMG/M |
3300004463|Ga0063356_102479332 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 794 | Open in IMG/M |
3300004463|Ga0063356_104003869 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 634 | Open in IMG/M |
3300004463|Ga0063356_104289972 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 613 | Open in IMG/M |
3300005167|Ga0066672_10654598 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 678 | Open in IMG/M |
3300005290|Ga0065712_10249350 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 957 | Open in IMG/M |
3300005327|Ga0070658_11831434 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 525 | Open in IMG/M |
3300005330|Ga0070690_100578239 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 850 | Open in IMG/M |
3300005333|Ga0070677_10891232 | Not Available | 513 | Open in IMG/M |
3300005353|Ga0070669_101213393 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 652 | Open in IMG/M |
3300005354|Ga0070675_100316423 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1378 | Open in IMG/M |
3300005364|Ga0070673_101053097 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 759 | Open in IMG/M |
3300005435|Ga0070714_101249864 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 725 | Open in IMG/M |
3300005456|Ga0070678_102214485 | Not Available | 521 | Open in IMG/M |
3300005457|Ga0070662_100651822 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 888 | Open in IMG/M |
3300005530|Ga0070679_101356840 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 657 | Open in IMG/M |
3300005535|Ga0070684_101703795 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 595 | Open in IMG/M |
3300005554|Ga0066661_10262105 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1069 | Open in IMG/M |
3300005561|Ga0066699_11096756 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 549 | Open in IMG/M |
3300005843|Ga0068860_100139387 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2330 | Open in IMG/M |
3300006237|Ga0097621_100827750 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 859 | Open in IMG/M |
3300006358|Ga0068871_101019386 | Not Available | 771 | Open in IMG/M |
3300006755|Ga0079222_11500075 | Not Available | 632 | Open in IMG/M |
3300006796|Ga0066665_11532700 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 522 | Open in IMG/M |
3300006876|Ga0079217_10565817 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 727 | Open in IMG/M |
3300006894|Ga0079215_11283396 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 564 | Open in IMG/M |
3300006914|Ga0075436_101474384 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 516 | Open in IMG/M |
3300006918|Ga0079216_10786661 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 696 | Open in IMG/M |
3300007004|Ga0079218_10640278 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300009177|Ga0105248_11811386 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 692 | Open in IMG/M |
3300009510|Ga0116230_10250634 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 1420 | Open in IMG/M |
3300009551|Ga0105238_10927983 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 890 | Open in IMG/M |
3300009551|Ga0105238_12230271 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 582 | Open in IMG/M |
3300009551|Ga0105238_13064023 | Not Available | 501 | Open in IMG/M |
3300009840|Ga0126313_11830505 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 508 | Open in IMG/M |
3300010040|Ga0126308_10734832 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 680 | Open in IMG/M |
3300010044|Ga0126310_10529507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 866 | Open in IMG/M |
3300010044|Ga0126310_10951629 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 673 | Open in IMG/M |
3300010333|Ga0134080_10142136 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1013 | Open in IMG/M |
3300010364|Ga0134066_10075836 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 925 | Open in IMG/M |
3300010375|Ga0105239_12557986 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 595 | Open in IMG/M |
3300010375|Ga0105239_13183513 | Not Available | 534 | Open in IMG/M |
3300010396|Ga0134126_10578491 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1287 | Open in IMG/M |
3300010400|Ga0134122_11684377 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 661 | Open in IMG/M |
3300011119|Ga0105246_10267354 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 1365 | Open in IMG/M |
3300012042|Ga0136627_1305531 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 506 | Open in IMG/M |
3300012200|Ga0137382_10272760 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1176 | Open in IMG/M |
3300012201|Ga0137365_10335270 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1119 | Open in IMG/M |
3300012212|Ga0150985_100156684 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1258 | Open in IMG/M |
3300012212|Ga0150985_109161977 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 856 | Open in IMG/M |
3300012212|Ga0150985_110490055 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola | 763 | Open in IMG/M |
3300012212|Ga0150985_111993702 | Not Available | 501 | Open in IMG/M |
3300012212|Ga0150985_112984710 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 920 | Open in IMG/M |
3300012212|Ga0150985_114136825 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 903 | Open in IMG/M |
3300012212|Ga0150985_115400459 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 551 | Open in IMG/M |
3300012212|Ga0150985_116546384 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 876 | Open in IMG/M |
3300012212|Ga0150985_118825493 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 536 | Open in IMG/M |
3300012212|Ga0150985_121054608 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 729 | Open in IMG/M |
3300012356|Ga0137371_11390281 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 515 | Open in IMG/M |
3300012469|Ga0150984_107815996 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 552 | Open in IMG/M |
3300012469|Ga0150984_111840806 | Not Available | 540 | Open in IMG/M |
3300012469|Ga0150984_111904196 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 600 | Open in IMG/M |
3300012469|Ga0150984_113462460 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 574 | Open in IMG/M |
3300012469|Ga0150984_115073406 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 550 | Open in IMG/M |
3300012469|Ga0150984_117548480 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 504 | Open in IMG/M |
3300012469|Ga0150984_118482765 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 871 | Open in IMG/M |
3300012469|Ga0150984_122063306 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1268 | Open in IMG/M |
3300013104|Ga0157370_11442766 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 619 | Open in IMG/M |
3300013296|Ga0157374_12455518 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 549 | Open in IMG/M |
3300013296|Ga0157374_12893173 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 507 | Open in IMG/M |
3300013307|Ga0157372_10661234 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1216 | Open in IMG/M |
3300013307|Ga0157372_13214540 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 521 | Open in IMG/M |
3300014166|Ga0134079_10525242 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 575 | Open in IMG/M |
3300014325|Ga0163163_11294548 | Not Available | 791 | Open in IMG/M |
3300014488|Ga0182001_10587283 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 532 | Open in IMG/M |
3300014501|Ga0182024_10116322 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 3840 | Open in IMG/M |
3300014502|Ga0182021_11957061 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 706 | Open in IMG/M |
3300014502|Ga0182021_12112877 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 678 | Open in IMG/M |
3300014968|Ga0157379_12320324 | Not Available | 535 | Open in IMG/M |
3300015245|Ga0137409_10406377 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1178 | Open in IMG/M |
3300015372|Ga0132256_101754735 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 729 | Open in IMG/M |
3300017658|Ga0182738_1382009 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 532 | Open in IMG/M |
3300018020|Ga0187861_10323020 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 657 | Open in IMG/M |
3300018481|Ga0190271_13331232 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 538 | Open in IMG/M |
3300020070|Ga0206356_10306099 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 842 | Open in IMG/M |
3300020080|Ga0206350_10486331 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 798 | Open in IMG/M |
3300020146|Ga0196977_1162852 | Not Available | 504 | Open in IMG/M |
3300020180|Ga0163155_10268302 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 818 | Open in IMG/M |
3300021403|Ga0210397_11489386 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 525 | Open in IMG/M |
3300021432|Ga0210384_10358796 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 1313 | Open in IMG/M |
3300021445|Ga0182009_10374969 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 731 | Open in IMG/M |
3300021510|Ga0222621_1096123 | Not Available | 628 | Open in IMG/M |
3300022726|Ga0242654_10388391 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 533 | Open in IMG/M |
3300022756|Ga0222622_10213860 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1287 | Open in IMG/M |
3300025310|Ga0209172_10568695 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 511 | Open in IMG/M |
3300025906|Ga0207699_10668441 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 759 | Open in IMG/M |
3300025909|Ga0207705_11084850 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 617 | Open in IMG/M |
3300025923|Ga0207681_11265310 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 620 | Open in IMG/M |
3300025925|Ga0207650_11131664 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 666 | Open in IMG/M |
3300025926|Ga0207659_10245070 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1452 | Open in IMG/M |
3300025930|Ga0207701_11723107 | Not Available | 501 | Open in IMG/M |
3300025935|Ga0207709_10815075 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 754 | Open in IMG/M |
3300025937|Ga0207669_11835213 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 518 | Open in IMG/M |
3300025942|Ga0207689_10593890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 931 | Open in IMG/M |
3300025945|Ga0207679_11035248 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 753 | Open in IMG/M |
3300025949|Ga0207667_10421747 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 1358 | Open in IMG/M |
3300025960|Ga0207651_11693144 | Not Available | 570 | Open in IMG/M |
3300025972|Ga0207668_11095845 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300025986|Ga0207658_11021900 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 754 | Open in IMG/M |
3300026142|Ga0207698_12130008 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 574 | Open in IMG/M |
3300027773|Ga0209810_1123517 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1121 | Open in IMG/M |
3300027807|Ga0209208_10570080 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 516 | Open in IMG/M |
3300028795|Ga0302227_10203378 | Not Available | 766 | Open in IMG/M |
3300029911|Ga0311361_11060218 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 669 | Open in IMG/M |
3300030007|Ga0311338_11403757 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 650 | Open in IMG/M |
3300031236|Ga0302324_102596931 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 616 | Open in IMG/M |
3300031524|Ga0302320_11639176 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 624 | Open in IMG/M |
3300031548|Ga0307408_102126614 | Not Available | 541 | Open in IMG/M |
3300031731|Ga0307405_12146740 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 502 | Open in IMG/M |
3300031824|Ga0307413_11506400 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 595 | Open in IMG/M |
3300031852|Ga0307410_11415717 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 611 | Open in IMG/M |
3300031901|Ga0307406_11712926 | Not Available | 557 | Open in IMG/M |
3300031903|Ga0307407_10081841 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1955 | Open in IMG/M |
3300031903|Ga0307407_11502726 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 533 | Open in IMG/M |
3300031938|Ga0308175_101426435 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 773 | Open in IMG/M |
3300031995|Ga0307409_102586663 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 536 | Open in IMG/M |
3300032002|Ga0307416_103024026 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 563 | Open in IMG/M |
3300032002|Ga0307416_103370212 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae | 535 | Open in IMG/M |
3300032005|Ga0307411_11433895 | Not Available | 633 | Open in IMG/M |
3300032012|Ga0310902_10835668 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 630 | Open in IMG/M |
3300032515|Ga0348332_10909903 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 555 | Open in IMG/M |
3300034644|Ga0370548_142256 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 513 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 8.09% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 7.35% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 5.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.15% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.21% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.21% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.21% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.21% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.47% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.47% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.47% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.74% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.74% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.74% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.74% |
Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.74% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017658 | Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2) | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
3300020180 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1058655305 | 3300000364 | Soil | FGQPPQIQHTIVCKAPAGKAISYYPDELTVEGKLKVEEKKDDGFIISIFELDVSSVKPAVK* |
JGIcombinedJ13530_1080305731 | 3300001213 | Wetland | PQIQHTIVCNTPRGKAVSYYPDEITVEGDLKVAEKKDEGFIVSIFEVQVSSVKPAAR* |
soilH2_104265991 | 3300003324 | Sugarcane Root And Bulk Soil | QPPQIQHQIVVHTPKGKAVGYFPDEIVVEGTLVVNEKKEDGLVISVFEVNCNSVKPMAK* |
Ga0062593_1031641802 | 3300004114 | Soil | VSYFPDEIAVEGTLKVDEKKEDGFIVSIFEMECSSVKPVAK* |
Ga0062590_1008688631 | 3300004157 | Soil | GQPPQIQHTVVVNCPKGKAVSYYPDEIVVEGKLNVEEKKDDGFIVSIFEVEVNSVKPAAK |
Ga0063356_1024793321 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KSVSYFPDEIEVAGTLKVDEKKDEGFIVSIFEIECSSVKPSK* |
Ga0063356_1040038691 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VATTPPGKSVTYYPDELVVEGTLAVQEKKEDGFIISLFEMQVSSVKPTAK* |
Ga0063356_1042899721 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KGKSVSYYPDELVVEGKLKVQEIKDEGFIVSIFQMDVTSVKPAAK* |
Ga0066672_106545981 | 3300005167 | Soil | KAVGYFPDEIIVEGTLKVDEKKEDGLIVSVFEMDCNSVKPMAK* |
Ga0065712_102493503 | 3300005290 | Miscanthus Rhizosphere | TVICKAPTGKAVGYYPDELVVEGKLKVEEKKDEGFIVSVFELEAASVKPATK* |
Ga0070658_118314342 | 3300005327 | Corn Rhizosphere | QIQHQIVVHTPKGKAVGYYPDEIVCEGTLKVEEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0070690_1005782391 | 3300005330 | Switchgrass Rhizosphere | QVQHTIVCATPKGKSVSYYPDEISVEGTLKVAEKRDEGFIVSVFEMDVNSVKPAVK* |
Ga0070677_108912321 | 3300005333 | Miscanthus Rhizosphere | GKAVSYYPDELVVEGTLKVDEKKEDGFIVSLFEMQVSSVKPAAK* |
Ga0070669_1012133931 | 3300005353 | Switchgrass Rhizosphere | GKAVGYSPDEIVVEGKLNVDEKKDDGYIISLFEVTVTSVKAAPK* |
Ga0070675_1003164231 | 3300005354 | Miscanthus Rhizosphere | QPPQVQHTIVVHLPQGKGVSYFPDEITVQGKLTVDEKKEDGFIVSVFEVEASSVKPAAK* |
Ga0070673_1010530971 | 3300005364 | Switchgrass Rhizosphere | PQIQHTVICKAPTGKAVGYYPDELVVEGKLKVEEKKDEGFIVSVFELEAASVKPATK* |
Ga0070714_1012498642 | 3300005435 | Agricultural Soil | QIQHTIVANCPKGKAVSYVPDEIVVEGKLHVEEKKDDGYIVSIFEVGVSSVKPAPK* |
Ga0070678_1022144851 | 3300005456 | Miscanthus Rhizosphere | IVVHLPQGKGVSYFPDEITVQGKLTVDEKKEDGFIVSVFEVEASSVKPAAK* |
Ga0070662_1006518221 | 3300005457 | Corn Rhizosphere | TIVVTCPKGKSLAYVPDEITVQGKLTVQEKKDDGYVISLFELGADSVKVVK* |
Ga0070679_1013568402 | 3300005530 | Corn Rhizosphere | CPAGKAVAYYPDEITVEGTLKVQEKKDDGFIISIFEMNASSVKPAAK* |
Ga0070684_1017037952 | 3300005535 | Corn Rhizosphere | VVSTPKGKAVSYYPDEIVCEGTLKVEEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0066661_102621051 | 3300005554 | Soil | VGYFPDEIIVEGTLKVDEKKEDGLIVSVFEMDCNSVKPMAK* |
Ga0066699_110967562 | 3300005561 | Soil | QIVVHCPKGKAVSYFPDEIICEGTLKVEEKKDDGYIVSVFEMEVNSVKPAAK* |
Ga0068860_1001393871 | 3300005843 | Switchgrass Rhizosphere | DELQIEGKLTVEEKKEDDVITSIYEVQTSSVKPAAK* |
Ga0097621_1008277502 | 3300006237 | Miscanthus Rhizosphere | IQHMVVASCPPGKAVGYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVTSVKAAPK* |
Ga0068871_1010193863 | 3300006358 | Miscanthus Rhizosphere | DEIVCEGTLKVEEKKDDGYIVSVFELDVQSVKPAAK* |
Ga0079222_115000752 | 3300006755 | Agricultural Soil | VHCPKGKAVSYFPDEITVEGTLKVEEKKDDGYIVSVFEIDASSVKPAPK* |
Ga0066665_115327002 | 3300006796 | Soil | LLVEGKLKVEEKKDDGFIVSIFEVDVTSVKPAAK* |
Ga0079217_105658171 | 3300006876 | Agricultural Soil | QCALVPSMFACCLGQASQVQHTSIVNTPKGEAVSYFPEEIIVEGVLRVNEKKEDGLVISVFEMECMSVKPAPK* |
Ga0079215_112833962 | 3300006894 | Agricultural Soil | APAGKAVGYYPDELVVEGKLKVEEKKDDGFIISVFEIDVTSVKPAVK* |
Ga0075436_1014743841 | 3300006914 | Populus Rhizosphere | PQVQHTVVVNCPKGKAVSYCPEELVIEGKLSVDEKKDDGFVTSIFQVDVTSVKPAPK* |
Ga0079216_107866611 | 3300006918 | Agricultural Soil | DEILVEGKLKVEEKKDEGYVISLFEMEVGSVKMAPK* |
Ga0079218_106402781 | 3300007004 | Agricultural Soil | QPPQVQHTIVCKAPAGKSISYYPDELTVEGKLKVEEKKDEGFIVSVFEIEAVSVKPAAK* |
Ga0105248_118113862 | 3300009177 | Switchgrass Rhizosphere | ITVEGTLKVDEKKDEGFVISLFEIDCTSVKPAAK* |
Ga0116230_102506344 | 3300009510 | Host-Associated | VVTCPKGKAVSYYPDEIIVQGKLTVQVQKDDGFIVAIFAMEASSVKPAPK* |
Ga0105238_109279832 | 3300009551 | Corn Rhizosphere | QHQIVVHTPKGKAVGYYPDEIICEGTLKVEEKKDDGSIVSVFEMDVQSVKPAAK* |
Ga0105238_122302712 | 3300009551 | Corn Rhizosphere | KGKAVGYYPDEIVCEGTLKVEEKKDDGYIVSVFELDVQSVKPAAK* |
Ga0105238_130640231 | 3300009551 | Corn Rhizosphere | KAVSYFADEILVEGKLKVEEKKDDGFIVSVFEVDISSVKPAPK* |
Ga0126313_118305051 | 3300009840 | Serpentine Soil | PDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR* |
Ga0126308_107348322 | 3300010040 | Serpentine Soil | YFPDEIVVEGNLVVNEKKEDGVVISVFEVNCLSVKPMAK* |
Ga0126310_105295072 | 3300010044 | Serpentine Soil | YYPDEIVCEGTLKVEEKKDDGYIISVFEMDVLSVKPAAK* |
Ga0126310_109516291 | 3300010044 | Serpentine Soil | GKAVSYFPDEINVEGKLKVEEKKEDGFIVSIFEIVCDSVKPVAK* |
Ga0134080_101421363 | 3300010333 | Grasslands Soil | CPTGKAVSYSPDEILVEGKLNVEEKKDDGYIISIFEVSVTSVKAAPR* |
Ga0134066_100758363 | 3300010364 | Grasslands Soil | QPPQVQHTMVVHTPKGKAVGYFPDEIIVEGTLVVNEKKEDGIIVSVFEVNCNSVKPMAK* |
Ga0105239_125579862 | 3300010375 | Corn Rhizosphere | ANCPKGKAVPYTPDELQVEGIIKVQEKKDDGYIISVFEMEVSSVKLAPKG* |
Ga0105239_131835132 | 3300010375 | Corn Rhizosphere | YPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0134126_105784911 | 3300010396 | Terrestrial Soil | NITQFALVPSLFSCCQFGQPPQIQHTIVAACPKGKAVGYCPDEIVIEGALKVQEKKEDGYIVSIFELEVSSVKPAPK* |
Ga0134122_116843772 | 3300010400 | Terrestrial Soil | VSYFPDEINVEGKLKVEEKKEDGFIVSIFEIECSSVKPVAK* |
Ga0105246_102673543 | 3300011119 | Miscanthus Rhizosphere | YFPDEIVCEGILKVEEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0136627_13055311 | 3300012042 | Polar Desert Sand | AYYPDQLVVEGKLNVEEKKDEGFIISIFEVEVANVQPAAK* |
Ga0137382_102727601 | 3300012200 | Vadose Zone Soil | PPQVQHTMVVHTPKGKAVGYFPDEIVVEGTLKVDEKKEDGLIISVFEVDCLSVKPMAK* |
Ga0137365_103352701 | 3300012201 | Vadose Zone Soil | GKAVGYFPDEIIIEGNLVVNEKKEDGIIVSVFEVNCNSVKPMAK* |
Ga0150985_1001566841 | 3300012212 | Avena Fatua Rhizosphere | PQIQHMVVANCPQGKAVGYSPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR* |
Ga0150985_1091619771 | 3300012212 | Avena Fatua Rhizosphere | YFADEILVEGKLKVEERKDDGFIVSVFEVDISSVKPAPK* |
Ga0150985_1104900551 | 3300012212 | Avena Fatua Rhizosphere | NCPKGKAVGYSPDELLVEGTLKVEEKKDEGYVVSVFEMQVNSVKLAPK* |
Ga0150985_1119937021 | 3300012212 | Avena Fatua Rhizosphere | EIWVEGTLKVDEKKEDGFILSIFEVDVSSVKPAPK* |
Ga0150985_1129847101 | 3300012212 | Avena Fatua Rhizosphere | CPKGKAVGYVPDEIVVEGILKVQEKKDDGYVVSIFDMEITSVKPAPK* |
Ga0150985_1141368252 | 3300012212 | Avena Fatua Rhizosphere | SYFPDEIQVEGTLKVNEKKEDGFIVSIFEMDCQSVKPAAR* |
Ga0150985_1154004592 | 3300012212 | Avena Fatua Rhizosphere | FPDEIQVEGTLKVDEKKEDGFIVSIFEMDCQSVKPAAR* |
Ga0150985_1165463842 | 3300012212 | Avena Fatua Rhizosphere | SNCPKGKAVSYCPDEIVVEGNLKVQEKKDDGYVVSLFEMEVTSVKPAAK* |
Ga0150985_1188254931 | 3300012212 | Avena Fatua Rhizosphere | QHTIVVSCPKGKAVGYSPDEIVCEGTLKVQEKKDDGYIVSLFEMEVISVKPAPK* |
Ga0150985_1210546082 | 3300012212 | Avena Fatua Rhizosphere | FASCVGQAPQIQHMVVVHTPKGKAVPYFPDEITCEGTIKVEERKDDGYIVSVFEMDVTSVKPTAK* |
Ga0137371_113902811 | 3300012356 | Vadose Zone Soil | YSPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR* |
Ga0150984_1078159961 | 3300012469 | Avena Fatua Rhizosphere | KGKNVSYYPDEISVEGKLTVDEKKEDGFIVSIFEVECSSVKPAAK* |
Ga0150984_1118408062 | 3300012469 | Avena Fatua Rhizosphere | AVSYYPDEITVEGNLKVAEKKDEGFIISIFEMEVTSVKPSSK* |
Ga0150984_1119041961 | 3300012469 | Avena Fatua Rhizosphere | IVCEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0150984_1134624602 | 3300012469 | Avena Fatua Rhizosphere | IVVNCPKGKAVGYYPDEITVEGSLKVAEKKDEGFIISIFEIDVSSVKPSAK* |
Ga0150984_1150734061 | 3300012469 | Avena Fatua Rhizosphere | SLFACCVGQPPQIQHQVVVHTPKGKSVGYFPDEIVCEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0150984_1175484802 | 3300012469 | Avena Fatua Rhizosphere | PPQIQHTIVVNCPKGKSVGYCPDEIVVEGTLKVDEKKDDGYVVSLFEMQVSSVKPAPK* |
Ga0150984_1184827652 | 3300012469 | Avena Fatua Rhizosphere | RCFGQPPQIQHMVVASCPDGKAVSYSPDEIVVEGKLNVDEKKDDGYIISIFEVSVTSVKAAPR* |
Ga0150984_1220633063 | 3300012469 | Avena Fatua Rhizosphere | DEISVEGKLIVDEKKEDGFIVSLFEIDATSVKPATK* |
Ga0157370_114427662 | 3300013104 | Corn Rhizosphere | FPDEIEVSGKLTVEEKKDEGFIVSIFEVECSSVKPVGK* |
Ga0157374_124555181 | 3300013296 | Miscanthus Rhizosphere | IVVHTPKGTAVGYYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK* |
Ga0157374_128931732 | 3300013296 | Miscanthus Rhizosphere | QLQHMVVATCPPGKAVGYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVTSVKAAPK* |
Ga0157372_106612341 | 3300013307 | Corn Rhizosphere | KGKSVSYYPDEIEVSGALKVDEKKDEGFIVSIFEVECSSVKPVGK* |
Ga0157372_132145401 | 3300013307 | Corn Rhizosphere | KAVGYTADEILVEGTLKVQQKKDDGYIISVFEMEVSSVKLAPQG* |
Ga0134079_105252421 | 3300014166 | Grasslands Soil | CFGQPPQIQHTIVVHVPKGKAVSYYPEEIMVEGKLTVDEKKEDGFIVSLFEMDCSSVKPSVK* |
Ga0163163_112945481 | 3300014325 | Switchgrass Rhizosphere | EQITVEGKLKVEEKKDDGFIVSIFEVSCTSVKPSPK* |
Ga0182001_105872832 | 3300014488 | Soil | GQPPQIQHTVVANCPKGKAVGYFPDELVVEGKLKVEEKKDDGYIVSVFEMEVSSVKVAAK |
Ga0182024_101163225 | 3300014501 | Permafrost | DEIVVEGALKVEEKKDDGYIVSIFQLETSSVKPAPK* |
Ga0182021_119570612 | 3300014502 | Fen | FGQPPQVQHTVVVNCPKGKAVSYYPDQITVEGTLKVAERRDEGFIVSLFEVQVLSVKPSGK* |
Ga0182021_121128771 | 3300014502 | Fen | AVSYYPDEITVEGNLKVAEKRDEGFIVSIFEVQVTSVKPSPR* |
Ga0157379_123203241 | 3300014968 | Switchgrass Rhizosphere | PQVQHTIVCKAPSGKSVSYYPDELVVEGKLKVEEKKDDGFIVSIFEVDVTSVQPATK* |
Ga0137409_104063773 | 3300015245 | Vadose Zone Soil | QVQHTMVVRTPKGKAVGYFPDEIVVEGALRVDEKKEDGLIVSVFEIDCTSVKPMAK* |
Ga0132256_1017547351 | 3300015372 | Arabidopsis Rhizosphere | KAVSYYPDEIVVEGKLLVDEKKEDGFIVSIFEVDCSSVKPAAK* |
Ga0182738_13820092 | 3300017658 | Compost | GQPPQIQHTVLVQTPKGKAVSYCPDEISVEGKLTVREKKEDGFIISIFELEAGSVKPVAP |
Ga0187861_103230201 | 3300018020 | Peatland | TLVVRTPKGKAVSYFPDEILIEGTLTVKERTEDGMVVSLFEIACTSVKPAPAQKP |
Ga0190271_133312321 | 3300018481 | Soil | TIVVHVVGGKSVSYYPDEIVVEGKLIVEEKKEDGFIVSIFEMESSKVQSAAK |
Ga0206356_103060992 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | FGQPPQIQHTIVANCPKGKALSYVPDEIVVEGKLHVEEKKDDGYIVSIFEVGVSSVKPAP |
Ga0206350_104863311 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | NCPKGKAVSYVPDEIVVEGKLHVEEKKDDGYIVSIFEVGVSSVKPAPK |
Ga0196977_11628521 | 3300020146 | Soil | PQVQHTLVVHAPKGKAVTYYPDEIYVEGELKVNEKKEDGIIVSVFEVNCTSVKPTPK |
Ga0163155_102683022 | 3300020180 | Freshwater Microbial Mat | VSYYGDEIIVDGVLNVEEKKDDGYIVSVFEITCNSVRPAPR |
Ga0210397_114893862 | 3300021403 | Soil | NCPKGKAVNYYQDEIIVEGYLTVQEKKDDGFIISIYDMECTSVKPAPK |
Ga0210384_103587961 | 3300021432 | Soil | VNCPKGKAVSYCPDEIFVEGDLKVDEKRDDGYVVSIFELTAKSVKPAPGAGK |
Ga0182009_103749692 | 3300021445 | Soil | PDEIEVSGTLKVDEKKDEGFIVSIFEVECSSVKPVGK |
Ga0222621_10961232 | 3300021510 | Groundwater Sediment | KAVSYFPDEITVEGKLKVEEKKDDGFIVSIFEIACTSVKPAAK |
Ga0242654_103883911 | 3300022726 | Soil | QPPQIQHTIVVNCPKGKALAYCPDEILVQGGLTVQEKRDDGYVISIFEVRADSVKVAK |
Ga0222622_102138603 | 3300022756 | Groundwater Sediment | DELVVEGKLKVEEKKDDGFIVSVFEVDVSSVKPAVK |
Ga0209172_105686951 | 3300025310 | Hot Spring Sediment | QHTVIVHCPKGKAVSYYPDEIIVQGTLNVQEKKDEGFIVSIFELEASSVKPAAK |
Ga0207699_106684411 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | HTIVADCPKGKAVGYVPDEIVVEGTLNVAEKKDDGYIVSIFEVNVSSVKPAPK |
Ga0207705_110848501 | 3300025909 | Corn Rhizosphere | QIVVHTPKGKAVGYYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK |
Ga0207681_112653102 | 3300025923 | Switchgrass Rhizosphere | IQHTIIVNCPKGKAVSYYPDEISVEGKLKVEEKKDDGFIVSIFDIECMSVKPVAK |
Ga0207650_111316642 | 3300025925 | Switchgrass Rhizosphere | YPDELMVEGKLKVEEKKDDGFIVSVFEVDVSSVKPAVK |
Ga0207659_102450703 | 3300025926 | Miscanthus Rhizosphere | QHTIVVHLPQGKGVSYFPDEITVQGKLTVDEKKEDGFIVSVFEVEASSVKPAAK |
Ga0207701_117231071 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VCATPKGKSVTYYPDELVVEGTLKVEEKKDEGFIVSVFEMEVSSVKPAAK |
Ga0207709_108150752 | 3300025935 | Miscanthus Rhizosphere | PDEILVEGKLNVEEKKDDGYIISIFEVTVSSVKAAPR |
Ga0207669_118352132 | 3300025937 | Miscanthus Rhizosphere | SGKAVSYSPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR |
Ga0207689_105938903 | 3300025942 | Miscanthus Rhizosphere | CPKGKAVSYYPDEIVVEGKLNVEEKKDDGFIVSIFEVEVNSVKPAAK |
Ga0207679_110352481 | 3300025945 | Corn Rhizosphere | PDDIGVEGKLNVEEKKDDGYIISIFEVTVTSVKAAPK |
Ga0207667_104217471 | 3300025949 | Corn Rhizosphere | PQIQHTIVVTCPKGKSLAYVPDEITVQGKLTVQEKKDDGYVISIFEMGADSVKVAK |
Ga0207651_116931442 | 3300025960 | Switchgrass Rhizosphere | HTVVCKAPAGKAVGYYPDELVVEGKLKVEEKKDEGFIVSVFELEAASVKPATK |
Ga0207668_110958451 | 3300025972 | Switchgrass Rhizosphere | GQPPQIQHVIIVDCPAGKAVSYYPDELVVEGKLTVDEKKDDDIITSIFQVQTSSVKPAAK |
Ga0207658_110219002 | 3300025986 | Switchgrass Rhizosphere | SCPKGKAVGYSPDEIVCEGTLKVQEKKDDGYIVSLFEMEVISVKPAPK |
Ga0207698_121300082 | 3300026142 | Corn Rhizosphere | YYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK |
Ga0209810_11235173 | 3300027773 | Surface Soil | KAVDYCPDEIVVEGELKVDEKKDDGFVVSLFEVTAASVKPAPK |
Ga0209208_105700802 | 3300027807 | Host-Associated | PPQIQHTIVVTCPKGKAVSYYPDEIIVQGKLTVQVQKDDGFIVAIFAMEASSVKPAPK |
Ga0302227_102033782 | 3300028795 | Palsa | KGKAISYFPDQIVVEGTLKVEENKDEGYIISIFEIDAKSVKPAPK |
Ga0311361_110602181 | 3300029911 | Bog | NCCYGQPPQVQHTIVVTCPKGKAVSYYPDEIVVEGKLNVDVMKDDGFVVGIFSVETTSVKPAPK |
Ga0311338_114037572 | 3300030007 | Palsa | AVSYYPDEIVVQGKLTVEEKKDDGFIVSLFEVEANSVKPAAK |
Ga0302324_1025969311 | 3300031236 | Palsa | YPDEIVVQGKLTVEEKKDDGFIVSLFEVEANSVKPAAK |
Ga0302320_116391762 | 3300031524 | Bog | DEISVEGTLHVEEKKEDGFIVSIFEVDTTSVKPAPK |
Ga0307408_1021266142 | 3300031548 | Rhizosphere | CQEGKAVSYFPEQIQVEGKLKVEEKKDDGFIVSIFEVTCTSVKPAPK |
Ga0307405_121467402 | 3300031731 | Rhizosphere | VQHSIIVSCQEGKAVSYFPEQIQVEGKLKVEEKKDDGFIVSIFEVTCTSVKPAPK |
Ga0307413_115064002 | 3300031824 | Rhizosphere | YSPDEIVVEGKLNVEEKKDDGYIISIFEVTVSSVKSAPR |
Ga0307410_114157172 | 3300031852 | Rhizosphere | AVSYYPDELVVEGKLKVEEKKEDGFIVSLFELEVASVKPAAK |
Ga0307406_117129261 | 3300031901 | Rhizosphere | SCQDGKAVSYFPEQIQVEGKLKVEEKKDDGFIVSIFEVTCTSVKPAPK |
Ga0307407_100818413 | 3300031903 | Rhizosphere | IVASCPPGKSVTYYPDELVVEGTLKVQEKKEDGFIISLFEMQVSSVKPTAK |
Ga0307407_115027261 | 3300031903 | Rhizosphere | TIVANCPKGKAVGYSADEIVVEGTLKVQEKKDDGYLISVFEMEVSSVKMAPK |
Ga0308175_1014264352 | 3300031938 | Soil | DEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK |
Ga0307409_1025866631 | 3300031995 | Rhizosphere | TIVVNCPKGKAVSYYPDEIVVEGVLKVEEKKEDGFIVSVFEMDVNSVKPAAK |
Ga0307416_1030240261 | 3300032002 | Rhizosphere | YPDEIQVEGTLKVQEKRDEGFIVSVFEMNVASVKPAVK |
Ga0307416_1033702122 | 3300032002 | Rhizosphere | SPDEIVVEGKLNVEEKKDDGYIVSLFEVSVSSVKAAPR |
Ga0307411_114338951 | 3300032005 | Rhizosphere | QHSVTVVCPPGKAVNYYPEEILVEGTLKVDEKKEDGFILSIFEVDVSSVKPAPK |
Ga0310902_108356682 | 3300032012 | Soil | MVVANCPQGKAVGYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVSSVKAAPR |
Ga0348332_109099031 | 3300032515 | Plant Litter | PQVQHTVVVNCPKGKAVSYYQDEIIVEGFLTVEEKKDDGFIVSIFDMECTSVKPAPK |
Ga0370548_142256_362_511 | 3300034644 | Soil | CKAPNGKAVGYYPDELVVEGKLKVEEKKDDGFIVSVFEVDVSSVKPAVK |
⦗Top⦘ |