NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057460

Metagenome / Metatranscriptome Family F057460

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057460
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 49 residues
Representative Sequence CPKGKAVSYYPDEIVVEGKLNVEEKKDDGFIVSIFEVEVNSVKPAAK
Number of Associated Samples 109
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.74 %
% of genes near scaffold ends (potentially truncated) 98.53 %
% of genes from short scaffolds (< 2000 bps) 97.79 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.765 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere
(8.088 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.147 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 38.67%    Coil/Unstructured: 61.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF11736DUF3299 13.97
PF02653BPD_transp_2 0.74
PF09537DUF2383 0.74
PF00335Tetraspanin 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.76 %
UnclassifiedrootN/A13.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105865530All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae2367Open in IMG/M
3300001213|JGIcombinedJ13530_108030573All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium539Open in IMG/M
3300003324|soilH2_10426599All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300004114|Ga0062593_103164180All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium527Open in IMG/M
3300004157|Ga0062590_100868863All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium839Open in IMG/M
3300004463|Ga0063356_102479332All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium794Open in IMG/M
3300004463|Ga0063356_104003869All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium634Open in IMG/M
3300004463|Ga0063356_104289972All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium613Open in IMG/M
3300005167|Ga0066672_10654598All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium678Open in IMG/M
3300005290|Ga0065712_10249350All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium957Open in IMG/M
3300005327|Ga0070658_11831434All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae525Open in IMG/M
3300005330|Ga0070690_100578239All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium850Open in IMG/M
3300005333|Ga0070677_10891232Not Available513Open in IMG/M
3300005353|Ga0070669_101213393All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae652Open in IMG/M
3300005354|Ga0070675_100316423All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1378Open in IMG/M
3300005364|Ga0070673_101053097All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium759Open in IMG/M
3300005435|Ga0070714_101249864All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium725Open in IMG/M
3300005456|Ga0070678_102214485Not Available521Open in IMG/M
3300005457|Ga0070662_100651822All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium888Open in IMG/M
3300005530|Ga0070679_101356840All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium657Open in IMG/M
3300005535|Ga0070684_101703795All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium595Open in IMG/M
3300005554|Ga0066661_10262105All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1069Open in IMG/M
3300005561|Ga0066699_11096756All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae549Open in IMG/M
3300005843|Ga0068860_100139387All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2330Open in IMG/M
3300006237|Ga0097621_100827750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium859Open in IMG/M
3300006358|Ga0068871_101019386Not Available771Open in IMG/M
3300006755|Ga0079222_11500075Not Available632Open in IMG/M
3300006796|Ga0066665_11532700All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium522Open in IMG/M
3300006876|Ga0079217_10565817All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium727Open in IMG/M
3300006894|Ga0079215_11283396All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium564Open in IMG/M
3300006914|Ga0075436_101474384All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae516Open in IMG/M
3300006918|Ga0079216_10786661All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium696Open in IMG/M
3300007004|Ga0079218_10640278All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300009177|Ga0105248_11811386All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium692Open in IMG/M
3300009510|Ga0116230_10250634All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae1420Open in IMG/M
3300009551|Ga0105238_10927983All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium890Open in IMG/M
3300009551|Ga0105238_12230271All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium582Open in IMG/M
3300009551|Ga0105238_13064023Not Available501Open in IMG/M
3300009840|Ga0126313_11830505All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae508Open in IMG/M
3300010040|Ga0126308_10734832All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium680Open in IMG/M
3300010044|Ga0126310_10529507All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae866Open in IMG/M
3300010044|Ga0126310_10951629All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium673Open in IMG/M
3300010333|Ga0134080_10142136All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium1013Open in IMG/M
3300010364|Ga0134066_10075836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium925Open in IMG/M
3300010375|Ga0105239_12557986All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae595Open in IMG/M
3300010375|Ga0105239_13183513Not Available534Open in IMG/M
3300010396|Ga0134126_10578491All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium1287Open in IMG/M
3300010400|Ga0134122_11684377All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium661Open in IMG/M
3300011119|Ga0105246_10267354All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae1365Open in IMG/M
3300012042|Ga0136627_1305531All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium506Open in IMG/M
3300012200|Ga0137382_10272760All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1176Open in IMG/M
3300012201|Ga0137365_10335270All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1119Open in IMG/M
3300012212|Ga0150985_100156684All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium1258Open in IMG/M
3300012212|Ga0150985_109161977All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium856Open in IMG/M
3300012212|Ga0150985_110490055All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola763Open in IMG/M
3300012212|Ga0150985_111993702Not Available501Open in IMG/M
3300012212|Ga0150985_112984710All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium920Open in IMG/M
3300012212|Ga0150985_114136825All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium903Open in IMG/M
3300012212|Ga0150985_115400459All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium551Open in IMG/M
3300012212|Ga0150985_116546384All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium876Open in IMG/M
3300012212|Ga0150985_118825493All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium536Open in IMG/M
3300012212|Ga0150985_121054608All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium729Open in IMG/M
3300012356|Ga0137371_11390281All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae515Open in IMG/M
3300012469|Ga0150984_107815996All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium552Open in IMG/M
3300012469|Ga0150984_111840806Not Available540Open in IMG/M
3300012469|Ga0150984_111904196All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium600Open in IMG/M
3300012469|Ga0150984_113462460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae574Open in IMG/M
3300012469|Ga0150984_115073406All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae550Open in IMG/M
3300012469|Ga0150984_117548480All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae504Open in IMG/M
3300012469|Ga0150984_118482765All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium871Open in IMG/M
3300012469|Ga0150984_122063306All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1268Open in IMG/M
3300013104|Ga0157370_11442766All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium619Open in IMG/M
3300013296|Ga0157374_12455518All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae549Open in IMG/M
3300013296|Ga0157374_12893173All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae507Open in IMG/M
3300013307|Ga0157372_10661234All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1216Open in IMG/M
3300013307|Ga0157372_13214540All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium521Open in IMG/M
3300014166|Ga0134079_10525242All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium575Open in IMG/M
3300014325|Ga0163163_11294548Not Available791Open in IMG/M
3300014488|Ga0182001_10587283All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae532Open in IMG/M
3300014501|Ga0182024_10116322All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium3840Open in IMG/M
3300014502|Ga0182021_11957061All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium706Open in IMG/M
3300014502|Ga0182021_12112877All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium678Open in IMG/M
3300014968|Ga0157379_12320324Not Available535Open in IMG/M
3300015245|Ga0137409_10406377All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1178Open in IMG/M
3300015372|Ga0132256_101754735All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium729Open in IMG/M
3300017658|Ga0182738_1382009All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium532Open in IMG/M
3300018020|Ga0187861_10323020All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium657Open in IMG/M
3300018481|Ga0190271_13331232All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium538Open in IMG/M
3300020070|Ga0206356_10306099All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium842Open in IMG/M
3300020080|Ga0206350_10486331All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium798Open in IMG/M
3300020146|Ga0196977_1162852Not Available504Open in IMG/M
3300020180|Ga0163155_10268302All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae818Open in IMG/M
3300021403|Ga0210397_11489386All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium525Open in IMG/M
3300021432|Ga0210384_10358796All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae1313Open in IMG/M
3300021445|Ga0182009_10374969All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium731Open in IMG/M
3300021510|Ga0222621_1096123Not Available628Open in IMG/M
3300022726|Ga0242654_10388391All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae533Open in IMG/M
3300022756|Ga0222622_10213860All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1287Open in IMG/M
3300025310|Ga0209172_10568695All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium511Open in IMG/M
3300025906|Ga0207699_10668441All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae759Open in IMG/M
3300025909|Ga0207705_11084850All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae617Open in IMG/M
3300025923|Ga0207681_11265310All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium620Open in IMG/M
3300025925|Ga0207650_11131664All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium666Open in IMG/M
3300025926|Ga0207659_10245070All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1452Open in IMG/M
3300025930|Ga0207701_11723107Not Available501Open in IMG/M
3300025935|Ga0207709_10815075All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium754Open in IMG/M
3300025937|Ga0207669_11835213All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae518Open in IMG/M
3300025942|Ga0207689_10593890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales931Open in IMG/M
3300025945|Ga0207679_11035248All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium753Open in IMG/M
3300025949|Ga0207667_10421747All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae1358Open in IMG/M
3300025960|Ga0207651_11693144Not Available570Open in IMG/M
3300025972|Ga0207668_11095845All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300025986|Ga0207658_11021900All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium754Open in IMG/M
3300026142|Ga0207698_12130008All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae574Open in IMG/M
3300027773|Ga0209810_1123517All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium1121Open in IMG/M
3300027807|Ga0209208_10570080All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae516Open in IMG/M
3300028795|Ga0302227_10203378Not Available766Open in IMG/M
3300029911|Ga0311361_11060218All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium669Open in IMG/M
3300030007|Ga0311338_11403757All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium650Open in IMG/M
3300031236|Ga0302324_102596931All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium616Open in IMG/M
3300031524|Ga0302320_11639176All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium624Open in IMG/M
3300031548|Ga0307408_102126614Not Available541Open in IMG/M
3300031731|Ga0307405_12146740All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium502Open in IMG/M
3300031824|Ga0307413_11506400All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium595Open in IMG/M
3300031852|Ga0307410_11415717All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium611Open in IMG/M
3300031901|Ga0307406_11712926Not Available557Open in IMG/M
3300031903|Ga0307407_10081841All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1955Open in IMG/M
3300031903|Ga0307407_11502726All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae533Open in IMG/M
3300031938|Ga0308175_101426435All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium773Open in IMG/M
3300031995|Ga0307409_102586663All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium536Open in IMG/M
3300032002|Ga0307416_103024026All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium563Open in IMG/M
3300032002|Ga0307416_103370212All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae535Open in IMG/M
3300032005|Ga0307411_11433895Not Available633Open in IMG/M
3300032012|Ga0310902_10835668All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium630Open in IMG/M
3300032515|Ga0348332_10909903All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium555Open in IMG/M
3300034644|Ga0370548_142256All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium513Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere8.09%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere7.35%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere5.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.21%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.21%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.21%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.21%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.47%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.47%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.47%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.47%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.74%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.74%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.74%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.74%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.74%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.74%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012042Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017658Enriched Miracle-Growth compost microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig MG (version 2)EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020180Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.SP4.G1EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10586553053300000364SoilFGQPPQIQHTIVCKAPAGKAISYYPDELTVEGKLKVEEKKDDGFIISIFELDVSSVKPAVK*
JGIcombinedJ13530_10803057313300001213WetlandPQIQHTIVCNTPRGKAVSYYPDEITVEGDLKVAEKKDEGFIVSIFEVQVSSVKPAAR*
soilH2_1042659913300003324Sugarcane Root And Bulk SoilQPPQIQHQIVVHTPKGKAVGYFPDEIVVEGTLVVNEKKEDGLVISVFEVNCNSVKPMAK*
Ga0062593_10316418023300004114SoilVSYFPDEIAVEGTLKVDEKKEDGFIVSIFEMECSSVKPVAK*
Ga0062590_10086886313300004157SoilGQPPQIQHTVVVNCPKGKAVSYYPDEIVVEGKLNVEEKKDDGFIVSIFEVEVNSVKPAAK
Ga0063356_10247933213300004463Arabidopsis Thaliana RhizosphereKSVSYFPDEIEVAGTLKVDEKKDEGFIVSIFEIECSSVKPSK*
Ga0063356_10400386913300004463Arabidopsis Thaliana RhizosphereVATTPPGKSVTYYPDELVVEGTLAVQEKKEDGFIISLFEMQVSSVKPTAK*
Ga0063356_10428997213300004463Arabidopsis Thaliana RhizosphereKGKSVSYYPDELVVEGKLKVQEIKDEGFIVSIFQMDVTSVKPAAK*
Ga0066672_1065459813300005167SoilKAVGYFPDEIIVEGTLKVDEKKEDGLIVSVFEMDCNSVKPMAK*
Ga0065712_1024935033300005290Miscanthus RhizosphereTVICKAPTGKAVGYYPDELVVEGKLKVEEKKDEGFIVSVFELEAASVKPATK*
Ga0070658_1183143423300005327Corn RhizosphereQIQHQIVVHTPKGKAVGYYPDEIVCEGTLKVEEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0070690_10057823913300005330Switchgrass RhizosphereQVQHTIVCATPKGKSVSYYPDEISVEGTLKVAEKRDEGFIVSVFEMDVNSVKPAVK*
Ga0070677_1089123213300005333Miscanthus RhizosphereGKAVSYYPDELVVEGTLKVDEKKEDGFIVSLFEMQVSSVKPAAK*
Ga0070669_10121339313300005353Switchgrass RhizosphereGKAVGYSPDEIVVEGKLNVDEKKDDGYIISLFEVTVTSVKAAPK*
Ga0070675_10031642313300005354Miscanthus RhizosphereQPPQVQHTIVVHLPQGKGVSYFPDEITVQGKLTVDEKKEDGFIVSVFEVEASSVKPAAK*
Ga0070673_10105309713300005364Switchgrass RhizospherePQIQHTVICKAPTGKAVGYYPDELVVEGKLKVEEKKDEGFIVSVFELEAASVKPATK*
Ga0070714_10124986423300005435Agricultural SoilQIQHTIVANCPKGKAVSYVPDEIVVEGKLHVEEKKDDGYIVSIFEVGVSSVKPAPK*
Ga0070678_10221448513300005456Miscanthus RhizosphereIVVHLPQGKGVSYFPDEITVQGKLTVDEKKEDGFIVSVFEVEASSVKPAAK*
Ga0070662_10065182213300005457Corn RhizosphereTIVVTCPKGKSLAYVPDEITVQGKLTVQEKKDDGYVISLFELGADSVKVVK*
Ga0070679_10135684023300005530Corn RhizosphereCPAGKAVAYYPDEITVEGTLKVQEKKDDGFIISIFEMNASSVKPAAK*
Ga0070684_10170379523300005535Corn RhizosphereVVSTPKGKAVSYYPDEIVCEGTLKVEEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0066661_1026210513300005554SoilVGYFPDEIIVEGTLKVDEKKEDGLIVSVFEMDCNSVKPMAK*
Ga0066699_1109675623300005561SoilQIVVHCPKGKAVSYFPDEIICEGTLKVEEKKDDGYIVSVFEMEVNSVKPAAK*
Ga0068860_10013938713300005843Switchgrass RhizosphereDELQIEGKLTVEEKKEDDVITSIYEVQTSSVKPAAK*
Ga0097621_10082775023300006237Miscanthus RhizosphereIQHMVVASCPPGKAVGYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVTSVKAAPK*
Ga0068871_10101938633300006358Miscanthus RhizosphereDEIVCEGTLKVEEKKDDGYIVSVFELDVQSVKPAAK*
Ga0079222_1150007523300006755Agricultural SoilVHCPKGKAVSYFPDEITVEGTLKVEEKKDDGYIVSVFEIDASSVKPAPK*
Ga0066665_1153270023300006796SoilLLVEGKLKVEEKKDDGFIVSIFEVDVTSVKPAAK*
Ga0079217_1056581713300006876Agricultural SoilQCALVPSMFACCLGQASQVQHTSIVNTPKGEAVSYFPEEIIVEGVLRVNEKKEDGLVISVFEMECMSVKPAPK*
Ga0079215_1128339623300006894Agricultural SoilAPAGKAVGYYPDELVVEGKLKVEEKKDDGFIISVFEIDVTSVKPAVK*
Ga0075436_10147438413300006914Populus RhizospherePQVQHTVVVNCPKGKAVSYCPEELVIEGKLSVDEKKDDGFVTSIFQVDVTSVKPAPK*
Ga0079216_1078666113300006918Agricultural SoilDEILVEGKLKVEEKKDEGYVISLFEMEVGSVKMAPK*
Ga0079218_1064027813300007004Agricultural SoilQPPQVQHTIVCKAPAGKSISYYPDELTVEGKLKVEEKKDEGFIVSVFEIEAVSVKPAAK*
Ga0105248_1181138623300009177Switchgrass RhizosphereITVEGTLKVDEKKDEGFVISLFEIDCTSVKPAAK*
Ga0116230_1025063443300009510Host-AssociatedVVTCPKGKAVSYYPDEIIVQGKLTVQVQKDDGFIVAIFAMEASSVKPAPK*
Ga0105238_1092798323300009551Corn RhizosphereQHQIVVHTPKGKAVGYYPDEIICEGTLKVEEKKDDGSIVSVFEMDVQSVKPAAK*
Ga0105238_1223027123300009551Corn RhizosphereKGKAVGYYPDEIVCEGTLKVEEKKDDGYIVSVFELDVQSVKPAAK*
Ga0105238_1306402313300009551Corn RhizosphereKAVSYFADEILVEGKLKVEEKKDDGFIVSVFEVDISSVKPAPK*
Ga0126313_1183050513300009840Serpentine SoilPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR*
Ga0126308_1073483223300010040Serpentine SoilYFPDEIVVEGNLVVNEKKEDGVVISVFEVNCLSVKPMAK*
Ga0126310_1052950723300010044Serpentine SoilYYPDEIVCEGTLKVEEKKDDGYIISVFEMDVLSVKPAAK*
Ga0126310_1095162913300010044Serpentine SoilGKAVSYFPDEINVEGKLKVEEKKEDGFIVSIFEIVCDSVKPVAK*
Ga0134080_1014213633300010333Grasslands SoilCPTGKAVSYSPDEILVEGKLNVEEKKDDGYIISIFEVSVTSVKAAPR*
Ga0134066_1007583633300010364Grasslands SoilQPPQVQHTMVVHTPKGKAVGYFPDEIIVEGTLVVNEKKEDGIIVSVFEVNCNSVKPMAK*
Ga0105239_1255798623300010375Corn RhizosphereANCPKGKAVPYTPDELQVEGIIKVQEKKDDGYIISVFEMEVSSVKLAPKG*
Ga0105239_1318351323300010375Corn RhizosphereYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0134126_1057849113300010396Terrestrial SoilNITQFALVPSLFSCCQFGQPPQIQHTIVAACPKGKAVGYCPDEIVIEGALKVQEKKEDGYIVSIFELEVSSVKPAPK*
Ga0134122_1168437723300010400Terrestrial SoilVSYFPDEINVEGKLKVEEKKEDGFIVSIFEIECSSVKPVAK*
Ga0105246_1026735433300011119Miscanthus RhizosphereYFPDEIVCEGILKVEEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0136627_130553113300012042Polar Desert SandAYYPDQLVVEGKLNVEEKKDEGFIISIFEVEVANVQPAAK*
Ga0137382_1027276013300012200Vadose Zone SoilPPQVQHTMVVHTPKGKAVGYFPDEIVVEGTLKVDEKKEDGLIISVFEVDCLSVKPMAK*
Ga0137365_1033527013300012201Vadose Zone SoilGKAVGYFPDEIIIEGNLVVNEKKEDGIIVSVFEVNCNSVKPMAK*
Ga0150985_10015668413300012212Avena Fatua RhizospherePQIQHMVVANCPQGKAVGYSPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR*
Ga0150985_10916197713300012212Avena Fatua RhizosphereYFADEILVEGKLKVEERKDDGFIVSVFEVDISSVKPAPK*
Ga0150985_11049005513300012212Avena Fatua RhizosphereNCPKGKAVGYSPDELLVEGTLKVEEKKDEGYVVSVFEMQVNSVKLAPK*
Ga0150985_11199370213300012212Avena Fatua RhizosphereEIWVEGTLKVDEKKEDGFILSIFEVDVSSVKPAPK*
Ga0150985_11298471013300012212Avena Fatua RhizosphereCPKGKAVGYVPDEIVVEGILKVQEKKDDGYVVSIFDMEITSVKPAPK*
Ga0150985_11413682523300012212Avena Fatua RhizosphereSYFPDEIQVEGTLKVNEKKEDGFIVSIFEMDCQSVKPAAR*
Ga0150985_11540045923300012212Avena Fatua RhizosphereFPDEIQVEGTLKVDEKKEDGFIVSIFEMDCQSVKPAAR*
Ga0150985_11654638423300012212Avena Fatua RhizosphereSNCPKGKAVSYCPDEIVVEGNLKVQEKKDDGYVVSLFEMEVTSVKPAAK*
Ga0150985_11882549313300012212Avena Fatua RhizosphereQHTIVVSCPKGKAVGYSPDEIVCEGTLKVQEKKDDGYIVSLFEMEVISVKPAPK*
Ga0150985_12105460823300012212Avena Fatua RhizosphereFASCVGQAPQIQHMVVVHTPKGKAVPYFPDEITCEGTIKVEERKDDGYIVSVFEMDVTSVKPTAK*
Ga0137371_1139028113300012356Vadose Zone SoilYSPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR*
Ga0150984_10781599613300012469Avena Fatua RhizosphereKGKNVSYYPDEISVEGKLTVDEKKEDGFIVSIFEVECSSVKPAAK*
Ga0150984_11184080623300012469Avena Fatua RhizosphereAVSYYPDEITVEGNLKVAEKKDEGFIISIFEMEVTSVKPSSK*
Ga0150984_11190419613300012469Avena Fatua RhizosphereIVCEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0150984_11346246023300012469Avena Fatua RhizosphereIVVNCPKGKAVGYYPDEITVEGSLKVAEKKDEGFIISIFEIDVSSVKPSAK*
Ga0150984_11507340613300012469Avena Fatua RhizosphereSLFACCVGQPPQIQHQVVVHTPKGKSVGYFPDEIVCEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0150984_11754848023300012469Avena Fatua RhizospherePPQIQHTIVVNCPKGKSVGYCPDEIVVEGTLKVDEKKDDGYVVSLFEMQVSSVKPAPK*
Ga0150984_11848276523300012469Avena Fatua RhizosphereRCFGQPPQIQHMVVASCPDGKAVSYSPDEIVVEGKLNVDEKKDDGYIISIFEVSVTSVKAAPR*
Ga0150984_12206330633300012469Avena Fatua RhizosphereDEISVEGKLIVDEKKEDGFIVSLFEIDATSVKPATK*
Ga0157370_1144276623300013104Corn RhizosphereFPDEIEVSGKLTVEEKKDEGFIVSIFEVECSSVKPVGK*
Ga0157374_1245551813300013296Miscanthus RhizosphereIVVHTPKGTAVGYYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK*
Ga0157374_1289317323300013296Miscanthus RhizosphereQLQHMVVATCPPGKAVGYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVTSVKAAPK*
Ga0157372_1066123413300013307Corn RhizosphereKGKSVSYYPDEIEVSGALKVDEKKDEGFIVSIFEVECSSVKPVGK*
Ga0157372_1321454013300013307Corn RhizosphereKAVGYTADEILVEGTLKVQQKKDDGYIISVFEMEVSSVKLAPQG*
Ga0134079_1052524213300014166Grasslands SoilCFGQPPQIQHTIVVHVPKGKAVSYYPEEIMVEGKLTVDEKKEDGFIVSLFEMDCSSVKPSVK*
Ga0163163_1129454813300014325Switchgrass RhizosphereEQITVEGKLKVEEKKDDGFIVSIFEVSCTSVKPSPK*
Ga0182001_1058728323300014488SoilGQPPQIQHTVVANCPKGKAVGYFPDELVVEGKLKVEEKKDDGYIVSVFEMEVSSVKVAAK
Ga0182024_1011632253300014501PermafrostDEIVVEGALKVEEKKDDGYIVSIFQLETSSVKPAPK*
Ga0182021_1195706123300014502FenFGQPPQVQHTVVVNCPKGKAVSYYPDQITVEGTLKVAERRDEGFIVSLFEVQVLSVKPSGK*
Ga0182021_1211287713300014502FenAVSYYPDEITVEGNLKVAEKRDEGFIVSIFEVQVTSVKPSPR*
Ga0157379_1232032413300014968Switchgrass RhizospherePQVQHTIVCKAPSGKSVSYYPDELVVEGKLKVEEKKDDGFIVSIFEVDVTSVQPATK*
Ga0137409_1040637733300015245Vadose Zone SoilQVQHTMVVRTPKGKAVGYFPDEIVVEGALRVDEKKEDGLIVSVFEIDCTSVKPMAK*
Ga0132256_10175473513300015372Arabidopsis RhizosphereKAVSYYPDEIVVEGKLLVDEKKEDGFIVSIFEVDCSSVKPAAK*
Ga0182738_138200923300017658CompostGQPPQIQHTVLVQTPKGKAVSYCPDEISVEGKLTVREKKEDGFIISIFELEAGSVKPVAP
Ga0187861_1032302013300018020PeatlandTLVVRTPKGKAVSYFPDEILIEGTLTVKERTEDGMVVSLFEIACTSVKPAPAQKP
Ga0190271_1333123213300018481SoilTIVVHVVGGKSVSYYPDEIVVEGKLIVEEKKEDGFIVSIFEMESSKVQSAAK
Ga0206356_1030609923300020070Corn, Switchgrass And Miscanthus RhizosphereFGQPPQIQHTIVANCPKGKALSYVPDEIVVEGKLHVEEKKDDGYIVSIFEVGVSSVKPAP
Ga0206350_1048633113300020080Corn, Switchgrass And Miscanthus RhizosphereNCPKGKAVSYVPDEIVVEGKLHVEEKKDDGYIVSIFEVGVSSVKPAPK
Ga0196977_116285213300020146SoilPQVQHTLVVHAPKGKAVTYYPDEIYVEGELKVNEKKEDGIIVSVFEVNCTSVKPTPK
Ga0163155_1026830223300020180Freshwater Microbial MatVSYYGDEIIVDGVLNVEEKKDDGYIVSVFEITCNSVRPAPR
Ga0210397_1148938623300021403SoilNCPKGKAVNYYQDEIIVEGYLTVQEKKDDGFIISIYDMECTSVKPAPK
Ga0210384_1035879613300021432SoilVNCPKGKAVSYCPDEIFVEGDLKVDEKRDDGYVVSIFELTAKSVKPAPGAGK
Ga0182009_1037496923300021445SoilPDEIEVSGTLKVDEKKDEGFIVSIFEVECSSVKPVGK
Ga0222621_109612323300021510Groundwater SedimentKAVSYFPDEITVEGKLKVEEKKDDGFIVSIFEIACTSVKPAAK
Ga0242654_1038839113300022726SoilQPPQIQHTIVVNCPKGKALAYCPDEILVQGGLTVQEKRDDGYVISIFEVRADSVKVAK
Ga0222622_1021386033300022756Groundwater SedimentDELVVEGKLKVEEKKDDGFIVSVFEVDVSSVKPAVK
Ga0209172_1056869513300025310Hot Spring SedimentQHTVIVHCPKGKAVSYYPDEIIVQGTLNVQEKKDEGFIVSIFELEASSVKPAAK
Ga0207699_1066844113300025906Corn, Switchgrass And Miscanthus RhizosphereHTIVADCPKGKAVGYVPDEIVVEGTLNVAEKKDDGYIVSIFEVNVSSVKPAPK
Ga0207705_1108485013300025909Corn RhizosphereQIVVHTPKGKAVGYYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK
Ga0207681_1126531023300025923Switchgrass RhizosphereIQHTIIVNCPKGKAVSYYPDEISVEGKLKVEEKKDDGFIVSIFDIECMSVKPVAK
Ga0207650_1113166423300025925Switchgrass RhizosphereYPDELMVEGKLKVEEKKDDGFIVSVFEVDVSSVKPAVK
Ga0207659_1024507033300025926Miscanthus RhizosphereQHTIVVHLPQGKGVSYFPDEITVQGKLTVDEKKEDGFIVSVFEVEASSVKPAAK
Ga0207701_1172310713300025930Corn, Switchgrass And Miscanthus RhizosphereVCATPKGKSVTYYPDELVVEGTLKVEEKKDEGFIVSVFEMEVSSVKPAAK
Ga0207709_1081507523300025935Miscanthus RhizospherePDEILVEGKLNVEEKKDDGYIISIFEVTVSSVKAAPR
Ga0207669_1183521323300025937Miscanthus RhizosphereSGKAVSYSPDEILVEGKLNVEEKKDDGYIISIFEVSVSSVKAAPR
Ga0207689_1059389033300025942Miscanthus RhizosphereCPKGKAVSYYPDEIVVEGKLNVEEKKDDGFIVSIFEVEVNSVKPAAK
Ga0207679_1103524813300025945Corn RhizospherePDDIGVEGKLNVEEKKDDGYIISIFEVTVTSVKAAPK
Ga0207667_1042174713300025949Corn RhizospherePQIQHTIVVTCPKGKSLAYVPDEITVQGKLTVQEKKDDGYVISIFEMGADSVKVAK
Ga0207651_1169314423300025960Switchgrass RhizosphereHTVVCKAPAGKAVGYYPDELVVEGKLKVEEKKDEGFIVSVFELEAASVKPATK
Ga0207668_1109584513300025972Switchgrass RhizosphereGQPPQIQHVIIVDCPAGKAVSYYPDELVVEGKLTVDEKKDDDIITSIFQVQTSSVKPAAK
Ga0207658_1102190023300025986Switchgrass RhizosphereSCPKGKAVGYSPDEIVCEGTLKVQEKKDDGYIVSLFEMEVISVKPAPK
Ga0207698_1213000823300026142Corn RhizosphereYYPDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK
Ga0209810_112351733300027773Surface SoilKAVDYCPDEIVVEGELKVDEKKDDGFVVSLFEVTAASVKPAPK
Ga0209208_1057008023300027807Host-AssociatedPPQIQHTIVVTCPKGKAVSYYPDEIIVQGKLTVQVQKDDGFIVAIFAMEASSVKPAPK
Ga0302227_1020337823300028795PalsaKGKAISYFPDQIVVEGTLKVEENKDEGYIISIFEIDAKSVKPAPK
Ga0311361_1106021813300029911BogNCCYGQPPQVQHTIVVTCPKGKAVSYYPDEIVVEGKLNVDVMKDDGFVVGIFSVETTSVKPAPK
Ga0311338_1140375723300030007PalsaAVSYYPDEIVVQGKLTVEEKKDDGFIVSLFEVEANSVKPAAK
Ga0302324_10259693113300031236PalsaYPDEIVVQGKLTVEEKKDDGFIVSLFEVEANSVKPAAK
Ga0302320_1163917623300031524BogDEISVEGTLHVEEKKEDGFIVSIFEVDTTSVKPAPK
Ga0307408_10212661423300031548RhizosphereCQEGKAVSYFPEQIQVEGKLKVEEKKDDGFIVSIFEVTCTSVKPAPK
Ga0307405_1214674023300031731RhizosphereVQHSIIVSCQEGKAVSYFPEQIQVEGKLKVEEKKDDGFIVSIFEVTCTSVKPAPK
Ga0307413_1150640023300031824RhizosphereYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVSSVKSAPR
Ga0307410_1141571723300031852RhizosphereAVSYYPDELVVEGKLKVEEKKEDGFIVSLFELEVASVKPAAK
Ga0307406_1171292613300031901RhizosphereSCQDGKAVSYFPEQIQVEGKLKVEEKKDDGFIVSIFEVTCTSVKPAPK
Ga0307407_1008184133300031903RhizosphereIVASCPPGKSVTYYPDELVVEGTLKVQEKKEDGFIISLFEMQVSSVKPTAK
Ga0307407_1150272613300031903RhizosphereTIVANCPKGKAVGYSADEIVVEGTLKVQEKKDDGYLISVFEMEVSSVKMAPK
Ga0308175_10142643523300031938SoilDEIICEGTLKVDEKKDDGYIVSVFEMDVQSVKPAAK
Ga0307409_10258666313300031995RhizosphereTIVVNCPKGKAVSYYPDEIVVEGVLKVEEKKEDGFIVSVFEMDVNSVKPAAK
Ga0307416_10302402613300032002RhizosphereYPDEIQVEGTLKVQEKRDEGFIVSVFEMNVASVKPAVK
Ga0307416_10337021223300032002RhizosphereSPDEIVVEGKLNVEEKKDDGYIVSLFEVSVSSVKAAPR
Ga0307411_1143389513300032005RhizosphereQHSVTVVCPPGKAVNYYPEEILVEGTLKVDEKKEDGFILSIFEVDVSSVKPAPK
Ga0310902_1083566823300032012SoilMVVANCPQGKAVGYSPDEIVVEGKLNVEEKKDDGYIISIFEVTVSSVKAAPR
Ga0348332_1090990313300032515Plant LitterPQVQHTVVVNCPKGKAVSYYQDEIIVEGFLTVEEKKDDGFIVSIFDMECTSVKPAPK
Ga0370548_142256_362_5113300034644SoilCKAPNGKAVGYYPDELVVEGKLKVEEKKDDGFIVSVFEVDVSSVKPAVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.