Basic Information | |
---|---|
Family ID | F057616 |
Family Type | Metagenome |
Number of Sequences | 136 |
Average Sequence Length | 46 residues |
Representative Sequence | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKPA |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 56.62 % |
% of genes near scaffold ends (potentially truncated) | 29.41 % |
% of genes from short scaffolds (< 2000 bps) | 85.29 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.059 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.294 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF00579 | tRNA-synt_1b | 55.15 |
PF13408 | Zn_ribbon_recom | 1.47 |
PF02371 | Transposase_20 | 1.47 |
PF13414 | TPR_11 | 1.47 |
PF04828 | GFA | 1.47 |
PF13751 | DDE_Tnp_1_6 | 1.47 |
PF13191 | AAA_16 | 0.74 |
PF04392 | ABC_sub_bind | 0.74 |
PF13847 | Methyltransf_31 | 0.74 |
PF05239 | PRC | 0.74 |
PF08546 | ApbA_C | 0.74 |
PF00491 | Arginase | 0.74 |
PF05598 | DUF772 | 0.74 |
PF00135 | COesterase | 0.74 |
PF02566 | OsmC | 0.74 |
PF07978 | NIPSNAP | 0.74 |
PF01694 | Rhomboid | 0.74 |
PF00211 | Guanylate_cyc | 0.74 |
PF06568 | DUF1127 | 0.74 |
PF01135 | PCMT | 0.74 |
PF04909 | Amidohydro_2 | 0.74 |
PF13683 | rve_3 | 0.74 |
PF13649 | Methyltransf_25 | 0.74 |
PF12840 | HTH_20 | 0.74 |
PF01548 | DEDD_Tnp_IS110 | 0.74 |
PF12893 | Lumazine_bd_2 | 0.74 |
PF13340 | DUF4096 | 0.74 |
PF07366 | SnoaL | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 55.15 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 55.15 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.21 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.47 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.74 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.74 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.74 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.74 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.74 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.74 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.74 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.74 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.53 % |
Unclassified | root | N/A | 1.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c1010412 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1608 | Open in IMG/M |
2228664022|INPgaii200_c1010991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 521 | Open in IMG/M |
3300000550|F24TB_11580988 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 637 | Open in IMG/M |
3300000789|JGI1027J11758_12846824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 538 | Open in IMG/M |
3300001593|JGI12635J15846_10119695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1862 | Open in IMG/M |
3300001867|JGI12627J18819_10023878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2509 | Open in IMG/M |
3300003320|rootH2_10122299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1702 | Open in IMG/M |
3300003324|soilH2_10271994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1453 | Open in IMG/M |
3300003659|JGI25404J52841_10002183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3659 | Open in IMG/M |
3300004081|Ga0063454_100264633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1043 | Open in IMG/M |
3300004479|Ga0062595_101432234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 632 | Open in IMG/M |
3300005160|Ga0066820_1018639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
3300005165|Ga0066869_10010362 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1261 | Open in IMG/M |
3300005166|Ga0066674_10437981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 599 | Open in IMG/M |
3300005178|Ga0066688_10701336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 643 | Open in IMG/M |
3300005186|Ga0066676_11123569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 517 | Open in IMG/M |
3300005187|Ga0066675_10024217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3474 | Open in IMG/M |
3300005293|Ga0065715_10146675 | Not Available | 1729 | Open in IMG/M |
3300005343|Ga0070687_100993810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 608 | Open in IMG/M |
3300005434|Ga0070709_10044158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2759 | Open in IMG/M |
3300005434|Ga0070709_10133959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1695 | Open in IMG/M |
3300005439|Ga0070711_101629092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 565 | Open in IMG/M |
3300005445|Ga0070708_101391187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 655 | Open in IMG/M |
3300005456|Ga0070678_100728176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 896 | Open in IMG/M |
3300005458|Ga0070681_10048003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4267 | Open in IMG/M |
3300005467|Ga0070706_100142583 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 2236 | Open in IMG/M |
3300005511|Ga0077121_10223669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1477 | Open in IMG/M |
3300005513|Ga0077120_1163066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 787 | Open in IMG/M |
3300005548|Ga0070665_102467962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 522 | Open in IMG/M |
3300005556|Ga0066707_11004105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae | 509 | Open in IMG/M |
3300005844|Ga0068862_100618708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1042 | Open in IMG/M |
3300005981|Ga0081538_10027754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3914 | Open in IMG/M |
3300005983|Ga0081540_1015259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4871 | Open in IMG/M |
3300006028|Ga0070717_10313817 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1396 | Open in IMG/M |
3300006046|Ga0066652_100306308 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1414 | Open in IMG/M |
3300006047|Ga0075024_100033735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2103 | Open in IMG/M |
3300006057|Ga0075026_100954819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3 | 530 | Open in IMG/M |
3300006173|Ga0070716_100586106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 837 | Open in IMG/M |
3300006173|Ga0070716_101136532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 624 | Open in IMG/M |
3300006175|Ga0070712_100766176 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 826 | Open in IMG/M |
3300006806|Ga0079220_10499744 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 831 | Open in IMG/M |
3300006844|Ga0075428_100258264 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1876 | Open in IMG/M |
3300006844|Ga0075428_100635862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1138 | Open in IMG/M |
3300006846|Ga0075430_100251129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1465 | Open in IMG/M |
3300006847|Ga0075431_100279506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1690 | Open in IMG/M |
3300006852|Ga0075433_10011687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7070 | Open in IMG/M |
3300007265|Ga0099794_10076768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1643 | Open in IMG/M |
3300009147|Ga0114129_10233226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 2478 | Open in IMG/M |
3300009147|Ga0114129_10331212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2021 | Open in IMG/M |
3300009168|Ga0105104_10154849 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1240 | Open in IMG/M |
3300010043|Ga0126380_11424879 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300010043|Ga0126380_11936328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 537 | Open in IMG/M |
3300010361|Ga0126378_10945699 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 967 | Open in IMG/M |
3300010366|Ga0126379_10551824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 1232 | Open in IMG/M |
3300010375|Ga0105239_12553917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300010376|Ga0126381_100742041 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
3300011423|Ga0137436_1143243 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 639 | Open in IMG/M |
3300012096|Ga0137389_10380070 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1204 | Open in IMG/M |
3300012189|Ga0137388_10522970 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1102 | Open in IMG/M |
3300012198|Ga0137364_10146795 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1702 | Open in IMG/M |
3300012202|Ga0137363_11549213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 554 | Open in IMG/M |
3300012205|Ga0137362_11610213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus | 536 | Open in IMG/M |
3300012206|Ga0137380_11368477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300012207|Ga0137381_11487348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 569 | Open in IMG/M |
3300012209|Ga0137379_11637558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 542 | Open in IMG/M |
3300012356|Ga0137371_10419200 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1037 | Open in IMG/M |
3300012469|Ga0150984_118304192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 682 | Open in IMG/M |
3300012494|Ga0157341_1009919 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 800 | Open in IMG/M |
3300012895|Ga0157309_10008890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1977 | Open in IMG/M |
3300012897|Ga0157285_10130137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 727 | Open in IMG/M |
3300012913|Ga0157298_10230783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 614 | Open in IMG/M |
3300012923|Ga0137359_11064792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 692 | Open in IMG/M |
3300012930|Ga0137407_10697842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 956 | Open in IMG/M |
3300012957|Ga0164303_10301660 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 945 | Open in IMG/M |
3300012957|Ga0164303_10597892 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300012960|Ga0164301_11785822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 516 | Open in IMG/M |
3300012984|Ga0164309_10363281 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1067 | Open in IMG/M |
3300013096|Ga0157307_1065460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 710 | Open in IMG/M |
3300013308|Ga0157375_10272821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1854 | Open in IMG/M |
3300014157|Ga0134078_10667225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300014969|Ga0157376_12977355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 513 | Open in IMG/M |
3300015168|Ga0167631_1062888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → gamma proteobacterium NOR5-3 | 610 | Open in IMG/M |
3300015242|Ga0137412_11164550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 543 | Open in IMG/M |
3300015371|Ga0132258_10702188 | Not Available | 2546 | Open in IMG/M |
3300015372|Ga0132256_102582517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 609 | Open in IMG/M |
3300015372|Ga0132256_103007333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 567 | Open in IMG/M |
3300015373|Ga0132257_102042007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
3300015373|Ga0132257_103337233 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 584 | Open in IMG/M |
3300015374|Ga0132255_101849833 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300016357|Ga0182032_11052254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 697 | Open in IMG/M |
3300017792|Ga0163161_10139121 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1837 | Open in IMG/M |
3300017792|Ga0163161_11139318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 672 | Open in IMG/M |
3300017997|Ga0184610_1244590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 597 | Open in IMG/M |
3300018000|Ga0184604_10151719 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 765 | Open in IMG/M |
3300018051|Ga0184620_10227472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 624 | Open in IMG/M |
3300018073|Ga0184624_10355576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 656 | Open in IMG/M |
3300018074|Ga0184640_10495002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 539 | Open in IMG/M |
3300018432|Ga0190275_10080671 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
3300018476|Ga0190274_11750697 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 716 | Open in IMG/M |
3300020581|Ga0210399_10442557 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1083 | Open in IMG/M |
3300020583|Ga0210401_10760665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 829 | Open in IMG/M |
3300021088|Ga0210404_10367353 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 801 | Open in IMG/M |
3300021171|Ga0210405_10351685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1163 | Open in IMG/M |
3300021180|Ga0210396_11552448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 542 | Open in IMG/M |
3300021363|Ga0193699_10182862 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 868 | Open in IMG/M |
3300021377|Ga0213874_10314780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 592 | Open in IMG/M |
3300021479|Ga0210410_10094951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2630 | Open in IMG/M |
3300021560|Ga0126371_10174722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2227 | Open in IMG/M |
3300025254|Ga0209148_1010412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1766 | Open in IMG/M |
3300025261|Ga0209233_1087917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 538 | Open in IMG/M |
3300025297|Ga0209758_1055385 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1347 | Open in IMG/M |
3300025885|Ga0207653_10008713 | All Organisms → cellular organisms → Bacteria | 3164 | Open in IMG/M |
3300025900|Ga0207710_10572903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 589 | Open in IMG/M |
3300025906|Ga0207699_10176900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1432 | Open in IMG/M |
3300025910|Ga0207684_10197866 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1733 | Open in IMG/M |
3300025912|Ga0207707_10038532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4176 | Open in IMG/M |
3300025916|Ga0207663_11325469 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300026023|Ga0207677_11506354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 621 | Open in IMG/M |
3300026041|Ga0207639_11547474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 622 | Open in IMG/M |
3300026315|Ga0209686_1106194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 966 | Open in IMG/M |
3300026496|Ga0257157_1062051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141 | 635 | Open in IMG/M |
3300027521|Ga0209524_1017281 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1480 | Open in IMG/M |
3300027535|Ga0209734_1010503 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1669 | Open in IMG/M |
3300027537|Ga0209419_1029385 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1032 | Open in IMG/M |
3300027591|Ga0209733_1029896 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1467 | Open in IMG/M |
3300027603|Ga0209331_1021647 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1664 | Open in IMG/M |
3300027660|Ga0209736_1042797 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1309 | Open in IMG/M |
3300027671|Ga0209588_1042623 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha | 1466 | Open in IMG/M |
3300027727|Ga0209328_10016212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2262 | Open in IMG/M |
3300027915|Ga0209069_10135263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1214 | Open in IMG/M |
3300028380|Ga0268265_10578969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1070 | Open in IMG/M |
3300030019|Ga0311348_10766765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 719 | Open in IMG/M |
3300031521|Ga0311364_10439930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1322 | Open in IMG/M |
3300031726|Ga0302321_101386790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 808 | Open in IMG/M |
3300032205|Ga0307472_100084190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2127 | Open in IMG/M |
3300034819|Ga0373958_0213402 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.62% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.15% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.15% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.41% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 3.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.21% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.21% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.47% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.47% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.74% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.74% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.74% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.74% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.74% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.74% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) | Host-Associated | Open in IMG/M |
3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) | Host-Associated | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_10104123 | 2228664022 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAADIDETSKESKPT |
INPgaii200_10109911 | 2228664022 | Soil | RKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAADIDETSKESKPT |
F24TB_115809882 | 3300000550 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMNETCEQSKPP* |
JGI1027J11758_128468242 | 3300000789 | Soil | MNGGDGWVNDKAVPLLXGAPPQVREXDHDDSHAADIDETSKESKPT* |
JGI12635J15846_101196953 | 3300001593 | Forest Soil | MNGGDGWVNDKAVPLLRGAPPQVRERDHDGSHAADIDEAPEESKPA* |
JGI12627J18819_100238783 | 3300001867 | Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDETSEESKPA* |
rootH2_101222993 | 3300003320 | Sugarcane Root And Bulk Soil | MNGGDGWVNDKAVPLLRGAPPQVRKRDHDDSHTADIDETSEESKSA* |
soilH2_102719942 | 3300003324 | Sugarcane Root And Bulk Soil | MNGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDESSEESKTA* |
JGI25404J52841_100021836 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVGERDHDDSHATDIDETSEESKPA* |
Ga0063454_1002646333 | 3300004081 | Soil | MNGGDGWVNDKAVPLLRGGPPQVRERDHDDSHAVDIDETSKESKPT* |
Ga0062595_1014322342 | 3300004479 | Soil | MNGGDGWVNDKAVPLLRGAPPQVRERDHDESHARDIDETSKKSKPT* |
Ga0066820_10186391 | 3300005160 | Soil | MNGGDGWVNDKAVPLLRGAPPQVRERDHDDSHAADIDETSKESKPT* |
Ga0066869_100103622 | 3300005165 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA* |
Ga0066674_104379812 | 3300005166 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKSA* |
Ga0066688_107013362 | 3300005178 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDAVSEENKPACN* |
Ga0066676_111235691 | 3300005186 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEEGKPA* |
Ga0066675_100242175 | 3300005187 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDAVSEENKPACN* |
Ga0065715_101466752 | 3300005293 | Miscanthus Rhizosphere | GWMNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA* |
Ga0070687_1009938102 | 3300005343 | Switchgrass Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP* |
Ga0070709_100441582 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWSNDKAVPLLSGAPPQVREGDYDVSHVGDIDETSEESKSA* |
Ga0070709_101339592 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAAPLLRGAPPQVRERDHDESHARDIDETSEKSKPA* |
Ga0070711_1016290922 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA* |
Ga0070708_1013911872 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKPA* |
Ga0070678_1007281763 | 3300005456 | Miscanthus Rhizosphere | DGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA* |
Ga0070681_100480033 | 3300005458 | Corn Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVLERDHDDSHAADIDETSEESKPA* |
Ga0070706_1001425833 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEEGKPV* |
Ga0077121_102236692 | 3300005511 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQIRERDHGDSHAADIDQVSEESKPA* |
Ga0077120_11630662 | 3300005513 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAVDIDQTSKESKPT* |
Ga0070665_1024679622 | 3300005548 | Switchgrass Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHVADTDETSKESKPT* |
Ga0066707_110041052 | 3300005556 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRGCDHDDSHADDIDETSEESKSA* |
Ga0068862_1006187083 | 3300005844 | Switchgrass Rhizosphere | MNGGDGCVNDKAVPLLNGAPPQVRERDHDGSHAAVIDETLEESNPA* |
Ga0081538_100277544 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MNDGDGCVNDKAVPLLNGAPPQVRERDHDDCHAAVIDETSEESNPA* |
Ga0081540_10152593 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNGGDGWVNDKAVPLLGGAPPQVRKRGRDDSHAADFDETSEESKPA* |
Ga0070717_103138172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSKESKPT* |
Ga0066652_1003063082 | 3300006046 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKLA* |
Ga0075024_1000337352 | 3300006047 | Watersheds | MNGGDGWVNDKAVPLLRGAPPQVRERDHDESHACDIDETSEESKPA* |
Ga0075026_1009548192 | 3300006057 | Watersheds | RRPMNGGDGWVNDKAVPLLRGAPPQVRERDHDESHACDIDETSEESKPA* |
Ga0070716_1005861063 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKPA* |
Ga0070716_1011365322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA* |
Ga0070712_1007661762 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQATSQADDGGDGWVDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKP |
Ga0079220_104997441 | 3300006806 | Agricultural Soil | MNGGDGWVNDKAVPLLVGAPPQVRKRDHDDSHTNDIDETSEESKSSDVSPGQPD |
Ga0075428_1002582643 | 3300006844 | Populus Rhizosphere | MHGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP* |
Ga0075428_1006358622 | 3300006844 | Populus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHSVHMDETCEESKPP* |
Ga0075430_1002511292 | 3300006846 | Populus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHKAHMDEACEESKPP* |
Ga0075431_1002795064 | 3300006847 | Populus Rhizosphere | QPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP* |
Ga0075433_100116876 | 3300006852 | Populus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDETCEESKPP* |
Ga0099794_100767682 | 3300007265 | Vadose Zone Soil | MNGGGGWVNDKAVPLLSGAPPQVRERDHDDSHTADIDETSEESKPA* |
Ga0114129_102332264 | 3300009147 | Populus Rhizosphere | PMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDETCEESKPP* |
Ga0114129_103312123 | 3300009147 | Populus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAHDIDETSEESKSA* |
Ga0105104_101548491 | 3300009168 | Freshwater Sediment | MNGGDGWVNDKAVPLLSGAPPQVRERDHCDSHAAHMDETCEESKPPD |
Ga0126380_114248791 | 3300010043 | Tropical Forest Soil | MNGGDGCENDKAVPLLNGAPPQIRERDHDGSHGVVIDETSEESNPA* |
Ga0126380_119363281 | 3300010043 | Tropical Forest Soil | NDKAVPLLSGAPPQVRERDHDDSHAVDIDETSKESKPT* |
Ga0126378_109456992 | 3300010361 | Tropical Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDRDDSHAADIDETSKESKPT* |
Ga0126379_105518242 | 3300010366 | Tropical Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDKTSEESKLS* |
Ga0105239_125539171 | 3300010375 | Corn Rhizosphere | NDKAVPLLNGAPPQVRERDHDGSHAAVIDETLEESNSA* |
Ga0126381_1007420411 | 3300010376 | Tropical Forest Soil | AVPLLAGAPPQVRECDHGDSHIGDIGETSKESKSS* |
Ga0137436_11432431 | 3300011423 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDET |
Ga0137389_103800701 | 3300012096 | Vadose Zone Soil | MNGGDGWVNDKAVPLLDGAPPQVRECDHDDSHAADIDETSEESKPA* |
Ga0137388_105229701 | 3300012189 | Vadose Zone Soil | MNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDETSEESKAA* |
Ga0137364_101467952 | 3300012198 | Vadose Zone Soil | MNGGDGWVNDKAVPLLSGAPPQVLKRDHDDSHAADIDETSEESKPA* |
Ga0137363_115492131 | 3300012202 | Vadose Zone Soil | MNGGDGWVNDKAVPLLCGAPPQVRECDHDDSHAADIDETSEESKSA* |
Ga0137362_116102132 | 3300012205 | Vadose Zone Soil | MNGSDGWVNDKAVPLLSRAPPQVRERDHDESHAADMDETSK |
Ga0137380_113684772 | 3300012206 | Vadose Zone Soil | MNGGDGCVNYKAVPLLSGAPPQVRERDHDDSHAADIDETSAESKPI* |
Ga0137381_114873482 | 3300012207 | Vadose Zone Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDESHARDIDETSEKSKPA* |
Ga0137379_116375582 | 3300012209 | Vadose Zone Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHADDIDETLKESKPA* |
Ga0137371_104192002 | 3300012356 | Vadose Zone Soil | MNGGDGWVNDKAVPLLSGAPPQVLKRDHDDSHAADIDETSEERKPA* |
Ga0150984_1183041922 | 3300012469 | Avena Fatua Rhizosphere | MNGGDGWVNDKAVPLLDGAPPQVRECDHDESHAANIEEILEESKPA* |
Ga0157341_10099191 | 3300012494 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDRHVADIDETSEESKPA* |
Ga0157309_100088902 | 3300012895 | Soil | MNGGDGWMNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA* |
Ga0157285_101301371 | 3300012897 | Soil | PMNGGDGWVNDKAVPLLRGAPPQVRERAHDDSHAVDIDETSKESKPT* |
Ga0157298_102307831 | 3300012913 | Soil | QPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAVDTDETSKESKPT* |
Ga0137359_110647922 | 3300012923 | Vadose Zone Soil | MNGGDGWVNEKAVPLLSGAPPQVRERDHDDSHAHDIDETSEESKPA* |
Ga0137407_106978421 | 3300012930 | Vadose Zone Soil | PRKPMNGGDGWVNDKAVPLLCGAPPQVRGCDHNDSHAADIDETSEESKPA* |
Ga0164303_103016602 | 3300012957 | Soil | MNGGDGWVNDKAVPLLRGAPPQVRERDHDESHARDIDETSEKSKPA* |
Ga0164303_105978921 | 3300012957 | Soil | VPLLSGAPPQVRERDHDDRHAADIDETSEESKPA* |
Ga0164301_117858221 | 3300012960 | Soil | MNGGDGWVNDKAVPLLGAAPPHVREGDLNDSHAADIDETS |
Ga0164309_103632812 | 3300012984 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHADDIDETSEESKSA* |
Ga0157307_10654602 | 3300013096 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAANVDEPSEESKPA* |
Ga0157375_102728211 | 3300013308 | Miscanthus Rhizosphere | RQPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP* |
Ga0134078_106672251 | 3300014157 | Grasslands Soil | MNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDAVSEENKTACT* |
Ga0157376_129773551 | 3300014969 | Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQARERDHDDSHAADIDETSKESKPT* |
Ga0167631_10628881 | 3300015168 | Glacier Forefield Soil | KPMNGGDGWVNDKAVPLLSGAPPQVREHAHDDSHAADIDESSKESKPT* |
Ga0137412_111645502 | 3300015242 | Vadose Zone Soil | MNGGDGWLNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSGLMSQMGQ* |
Ga0132258_107021881 | 3300015371 | Arabidopsis Rhizosphere | KPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDETCEESKPP* |
Ga0132256_1025825171 | 3300015372 | Arabidopsis Rhizosphere | KPMNGGDGWVNDKAVPLLSGAPPQVHERDHDDSHAVDIDETSQESKPT* |
Ga0132256_1030073332 | 3300015372 | Arabidopsis Rhizosphere | QPRKPMNGGDGWVNDKAVPLLSGAPPQIREHDHDSHAADTDESSKESKPT* |
Ga0132257_1020420071 | 3300015373 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVHERDHDDSHAVDIDETSQESKPT* |
Ga0132257_1033372332 | 3300015373 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETC |
Ga0132255_1018498332 | 3300015374 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLRGAPPQVRERDHDDSHAVDIDETSKESKPT* |
Ga0182032_110522541 | 3300016357 | Soil | PRKPMNGGDVGNDKAVPLLSGAPPQVRERNHDDSHAGDFDETSEESKSS |
Ga0163161_101391211 | 3300017792 | Switchgrass Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDNQDSHADNIGEPSEESKSA |
Ga0163161_111393182 | 3300017792 | Switchgrass Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKPA |
Ga0184610_12445901 | 3300017997 | Groundwater Sediment | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIAETSKESKPT |
Ga0184604_101517192 | 3300018000 | Groundwater Sediment | MNGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDETSKESKPT |
Ga0184620_102274722 | 3300018051 | Groundwater Sediment | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSKESKPT |
Ga0184624_103555762 | 3300018073 | Groundwater Sediment | MNGGDGWVNDKAVPLLSGAPPQVREGDHDDSHAADIDETSEESKPA |
Ga0184640_104950021 | 3300018074 | Groundwater Sediment | MNGGDGWVNDKAVPLLSGAPPQVREGDHDDSHADDIDETSEESKPA |
Ga0190275_100806711 | 3300018432 | Soil | MNGGDGWMNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA |
Ga0190274_117506972 | 3300018476 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKPA |
Ga0210399_104425572 | 3300020581 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDNDDCHAADIDEISEESKPA |
Ga0210401_107606651 | 3300020583 | Soil | MNGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDETSEESKPA |
Ga0210404_103673531 | 3300021088 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA |
Ga0210405_103516853 | 3300021171 | Soil | MNGGDGWVNDKAVPLLRGAPPQVRERGHDDGHAVDIDETSEECKPA |
Ga0210396_115524482 | 3300021180 | Soil | MNGGDGWVNDKAVPLLSGAPPQVREGDHDDSHAADIDETSEESKLA |
Ga0193699_101828621 | 3300021363 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDSHADDIHETSEESKPAWCPRWVM |
Ga0213874_103147801 | 3300021377 | Plant Roots | MNGGDGWGHDKAVPLLSGAPPQVSERDHGDSHTGDNGEISKESKLS |
Ga0210410_100949511 | 3300021479 | Soil | GGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDETSEESKPA |
Ga0126371_101747221 | 3300021560 | Tropical Forest Soil | MNGGDGWVNDKAVPLLNGAPPQVRARDHDDSHAADFDETSGESKRGATL |
Ga0209148_10104124 | 3300025254 | Arabidopsis Root | NDKAVPLLSGAPPQVRERDHDDSHAVDIDQTSKESKPT |
Ga0209233_10879171 | 3300025261 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAVDIDQTSKESKPT |
Ga0209758_10553851 | 3300025297 | Arabidopsis Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHGADIDKTSEES |
Ga0207653_100087131 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESNRLNVSN |
Ga0207710_105729031 | 3300025900 | Switchgrass Rhizosphere | TAATVGNDKAVPLLSGAPPQVRERNHDDSHADDIDETSEESKSA |
Ga0207699_101769002 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAAPLLRGAPPQVRERDHDESHARDIDETSEKSKPA |
Ga0207684_101978663 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEEGKPV |
Ga0207707_100385322 | 3300025912 | Corn Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVLERDHDDSHAADIDETSEESKPA |
Ga0207663_113254691 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA |
Ga0207677_115063541 | 3300026023 | Miscanthus Rhizosphere | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKPGGS |
Ga0207639_115474743 | 3300026041 | Corn Rhizosphere | GNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA |
Ga0209686_11061942 | 3300026315 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKSA |
Ga0257157_10620512 | 3300026496 | Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDGHVANIDETSEESNPA |
Ga0209524_10172812 | 3300027521 | Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSKESKPA |
Ga0209734_10105031 | 3300027535 | Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHGGSHAADIHEASEESKPA |
Ga0209419_10293851 | 3300027537 | Forest Soil | MNGGDGWVNDKAVPLLRGAPPQVRERDHDGSHAADIDEAPEESKPA |
Ga0209733_10298961 | 3300027591 | Forest Soil | MPMNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA |
Ga0209331_10216471 | 3300027603 | Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDNHGSHAADID |
Ga0209736_10427971 | 3300027660 | Forest Soil | MNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDEAPEESKPA |
Ga0209588_10426231 | 3300027671 | Vadose Zone Soil | MNGGGGWVNDKAVPLLSGAPPQVRERDHDDSHTADIDETSEESKPA |
Ga0209328_100162122 | 3300027727 | Forest Soil | MNGGDGWVNDKAVPLLRGAPPQVRERDHDGSHAADIDEAPEESKPAWAEAEYET |
Ga0209069_101352631 | 3300027915 | Watersheds | WVNDKAVPLLRGAPPQVRERDHDESHACDIDETSEESKPA |
Ga0268265_105789693 | 3300028380 | Switchgrass Rhizosphere | MNGGDGCVNDKAVPLLNGAPPQVRERDHDGSHAAVIDETLEESNPA |
Ga0311348_107667652 | 3300030019 | Fen | MNGGDGWVNDKAVPLLRGAPPQVRERDHDESHARDIDETSEKSKPA |
Ga0311364_104399302 | 3300031521 | Fen | MNGGDGWVNDKAVPLLNGAPPQVSERDHDDSHAADIDETSEESKPA |
Ga0302321_1013867902 | 3300031726 | Fen | MNGGDGWMNDKAVPLLNGAPPQVSERDHDDSHAADIDETSEESKPA |
Ga0307472_1000841902 | 3300032205 | Hardwood Forest Soil | PRKPMNGGDGWVNDKAVPLLSGAPPQVRERDNHDCHAADIDEISEESKPA |
Ga0373958_0213402_169_309 | 3300034819 | Rhizosphere Soil | MNGGDGWSNDKAVPLLSGAPPQVREGDHDVSHVGDIDETSEEGKSA |
⦗Top⦘ |