NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F057616

Metagenome Family F057616

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057616
Family Type Metagenome
Number of Sequences 136
Average Sequence Length 46 residues
Representative Sequence MNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKPA
Number of Associated Samples 126
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 56.62 %
% of genes near scaffold ends (potentially truncated) 29.41 %
% of genes from short scaffolds (< 2000 bps) 85.29 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.294 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF00579tRNA-synt_1b 55.15
PF13408Zn_ribbon_recom 1.47
PF02371Transposase_20 1.47
PF13414TPR_11 1.47
PF04828GFA 1.47
PF13751DDE_Tnp_1_6 1.47
PF13191AAA_16 0.74
PF04392ABC_sub_bind 0.74
PF13847Methyltransf_31 0.74
PF05239PRC 0.74
PF08546ApbA_C 0.74
PF00491Arginase 0.74
PF05598DUF772 0.74
PF00135COesterase 0.74
PF02566OsmC 0.74
PF07978NIPSNAP 0.74
PF01694Rhomboid 0.74
PF00211Guanylate_cyc 0.74
PF06568DUF1127 0.74
PF01135PCMT 0.74
PF04909Amidohydro_2 0.74
PF13683rve_3 0.74
PF13649Methyltransf_25 0.74
PF12840HTH_20 0.74
PF01548DEDD_Tnp_IS110 0.74
PF12893Lumazine_bd_2 0.74
PF13340DUF4096 0.74
PF07366SnoaL 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 55.15
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 55.15
COG3547TransposaseMobilome: prophages, transposons [X] 2.21
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.47
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.74
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.74
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.74
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.74
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.74
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.74
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.74
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.74
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.74
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.74
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.74
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.74
COG5457Uncharacterized conserved protein YjiS, DUF1127 familyFunction unknown [S] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.53 %
UnclassifiedrootN/A1.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c1010412All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1608Open in IMG/M
2228664022|INPgaii200_c1010991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense521Open in IMG/M
3300000550|F24TB_11580988All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha637Open in IMG/M
3300000789|JGI1027J11758_12846824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense538Open in IMG/M
3300001593|JGI12635J15846_10119695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1862Open in IMG/M
3300001867|JGI12627J18819_10023878All Organisms → cellular organisms → Bacteria → Proteobacteria2509Open in IMG/M
3300003320|rootH2_10122299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1702Open in IMG/M
3300003324|soilH2_10271994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1453Open in IMG/M
3300003659|JGI25404J52841_10002183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3659Open in IMG/M
3300004081|Ga0063454_100264633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1043Open in IMG/M
3300004479|Ga0062595_101432234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae632Open in IMG/M
3300005160|Ga0066820_1018639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales529Open in IMG/M
3300005165|Ga0066869_10010362All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1261Open in IMG/M
3300005166|Ga0066674_10437981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141599Open in IMG/M
3300005178|Ga0066688_10701336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141643Open in IMG/M
3300005186|Ga0066676_11123569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae517Open in IMG/M
3300005187|Ga0066675_10024217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3474Open in IMG/M
3300005293|Ga0065715_10146675Not Available1729Open in IMG/M
3300005343|Ga0070687_100993810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense608Open in IMG/M
3300005434|Ga0070709_10044158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2759Open in IMG/M
3300005434|Ga0070709_10133959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1695Open in IMG/M
3300005439|Ga0070711_101629092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense565Open in IMG/M
3300005445|Ga0070708_101391187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141655Open in IMG/M
3300005456|Ga0070678_100728176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium896Open in IMG/M
3300005458|Ga0070681_10048003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4267Open in IMG/M
3300005467|Ga0070706_100142583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha2236Open in IMG/M
3300005511|Ga0077121_10223669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1477Open in IMG/M
3300005513|Ga0077120_1163066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium787Open in IMG/M
3300005548|Ga0070665_102467962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense522Open in IMG/M
3300005556|Ga0066707_11004105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae509Open in IMG/M
3300005844|Ga0068862_100618708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1042Open in IMG/M
3300005981|Ga0081538_10027754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3914Open in IMG/M
3300005983|Ga0081540_1015259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4871Open in IMG/M
3300006028|Ga0070717_10313817All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1396Open in IMG/M
3300006046|Ga0066652_100306308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1414Open in IMG/M
3300006047|Ga0075024_100033735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2103Open in IMG/M
3300006057|Ga0075026_100954819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGUVB1N3530Open in IMG/M
3300006173|Ga0070716_100586106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium837Open in IMG/M
3300006173|Ga0070716_101136532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense624Open in IMG/M
3300006175|Ga0070712_100766176All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha826Open in IMG/M
3300006806|Ga0079220_10499744All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha831Open in IMG/M
3300006844|Ga0075428_100258264All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1876Open in IMG/M
3300006844|Ga0075428_100635862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1138Open in IMG/M
3300006846|Ga0075430_100251129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1465Open in IMG/M
3300006847|Ga0075431_100279506All Organisms → cellular organisms → Bacteria → Proteobacteria1690Open in IMG/M
3300006852|Ga0075433_10011687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7070Open in IMG/M
3300007265|Ga0099794_10076768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1643Open in IMG/M
3300009147|Ga0114129_10233226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense2478Open in IMG/M
3300009147|Ga0114129_10331212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2021Open in IMG/M
3300009168|Ga0105104_10154849All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1240Open in IMG/M
3300010043|Ga0126380_11424879All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300010043|Ga0126380_11936328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium537Open in IMG/M
3300010361|Ga0126378_10945699All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha967Open in IMG/M
3300010366|Ga0126379_10551824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M1411232Open in IMG/M
3300010375|Ga0105239_12553917All Organisms → cellular organisms → Bacteria → Proteobacteria596Open in IMG/M
3300010376|Ga0126381_100742041All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300011423|Ga0137436_1143243All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha639Open in IMG/M
3300012096|Ga0137389_10380070All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1204Open in IMG/M
3300012189|Ga0137388_10522970All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1102Open in IMG/M
3300012198|Ga0137364_10146795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1702Open in IMG/M
3300012202|Ga0137363_11549213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense554Open in IMG/M
3300012205|Ga0137362_11610213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus536Open in IMG/M
3300012206|Ga0137380_11368477All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300012207|Ga0137381_11487348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141569Open in IMG/M
3300012209|Ga0137379_11637558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales542Open in IMG/M
3300012356|Ga0137371_10419200All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1037Open in IMG/M
3300012469|Ga0150984_118304192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium682Open in IMG/M
3300012494|Ga0157341_1009919All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha800Open in IMG/M
3300012895|Ga0157309_10008890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1977Open in IMG/M
3300012897|Ga0157285_10130137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense727Open in IMG/M
3300012913|Ga0157298_10230783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense614Open in IMG/M
3300012923|Ga0137359_11064792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium692Open in IMG/M
3300012930|Ga0137407_10697842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae956Open in IMG/M
3300012957|Ga0164303_10301660All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha945Open in IMG/M
3300012957|Ga0164303_10597892All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012960|Ga0164301_11785822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141516Open in IMG/M
3300012984|Ga0164309_10363281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1067Open in IMG/M
3300013096|Ga0157307_1065460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141710Open in IMG/M
3300013308|Ga0157375_10272821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1854Open in IMG/M
3300014157|Ga0134078_10667225All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300014969|Ga0157376_12977355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141513Open in IMG/M
3300015168|Ga0167631_1062888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → gamma proteobacterium NOR5-3610Open in IMG/M
3300015242|Ga0137412_11164550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense543Open in IMG/M
3300015371|Ga0132258_10702188Not Available2546Open in IMG/M
3300015372|Ga0132256_102582517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei609Open in IMG/M
3300015372|Ga0132256_103007333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi567Open in IMG/M
3300015373|Ga0132257_102042007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300015373|Ga0132257_103337233All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha584Open in IMG/M
3300015374|Ga0132255_101849833All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300016357|Ga0182032_11052254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae697Open in IMG/M
3300017792|Ga0163161_10139121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1837Open in IMG/M
3300017792|Ga0163161_11139318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141672Open in IMG/M
3300017997|Ga0184610_1244590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141597Open in IMG/M
3300018000|Ga0184604_10151719All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha765Open in IMG/M
3300018051|Ga0184620_10227472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141624Open in IMG/M
3300018073|Ga0184624_10355576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141656Open in IMG/M
3300018074|Ga0184640_10495002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141539Open in IMG/M
3300018432|Ga0190275_10080671All Organisms → cellular organisms → Bacteria2823Open in IMG/M
3300018476|Ga0190274_11750697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha716Open in IMG/M
3300020581|Ga0210399_10442557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1083Open in IMG/M
3300020583|Ga0210401_10760665All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa829Open in IMG/M
3300021088|Ga0210404_10367353All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha801Open in IMG/M
3300021171|Ga0210405_10351685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1163Open in IMG/M
3300021180|Ga0210396_11552448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141542Open in IMG/M
3300021363|Ga0193699_10182862All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha868Open in IMG/M
3300021377|Ga0213874_10314780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense592Open in IMG/M
3300021479|Ga0210410_10094951All Organisms → cellular organisms → Bacteria → Proteobacteria2630Open in IMG/M
3300021560|Ga0126371_10174722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2227Open in IMG/M
3300025254|Ga0209148_1010412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1766Open in IMG/M
3300025261|Ga0209233_1087917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense538Open in IMG/M
3300025297|Ga0209758_1055385All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1347Open in IMG/M
3300025885|Ga0207653_10008713All Organisms → cellular organisms → Bacteria3164Open in IMG/M
3300025900|Ga0207710_10572903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii589Open in IMG/M
3300025906|Ga0207699_10176900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1432Open in IMG/M
3300025910|Ga0207684_10197866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1733Open in IMG/M
3300025912|Ga0207707_10038532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4176Open in IMG/M
3300025916|Ga0207663_11325469All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300026023|Ga0207677_11506354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141621Open in IMG/M
3300026041|Ga0207639_11547474All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium622Open in IMG/M
3300026315|Ga0209686_1106194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae966Open in IMG/M
3300026496|Ga0257157_1062051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseovarius → unclassified Roseovarius → Roseovarius sp. M141635Open in IMG/M
3300027521|Ga0209524_1017281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1480Open in IMG/M
3300027535|Ga0209734_1010503All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1669Open in IMG/M
3300027537|Ga0209419_1029385All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1032Open in IMG/M
3300027591|Ga0209733_1029896All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1467Open in IMG/M
3300027603|Ga0209331_1021647All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1664Open in IMG/M
3300027660|Ga0209736_1042797All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1309Open in IMG/M
3300027671|Ga0209588_1042623All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1466Open in IMG/M
3300027727|Ga0209328_10016212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2262Open in IMG/M
3300027915|Ga0209069_10135263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1214Open in IMG/M
3300028380|Ga0268265_10578969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1070Open in IMG/M
3300030019|Ga0311348_10766765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium719Open in IMG/M
3300031521|Ga0311364_10439930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1322Open in IMG/M
3300031726|Ga0302321_101386790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae808Open in IMG/M
3300032205|Ga0307472_100084190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2127Open in IMG/M
3300034819|Ga0373958_0213402All Organisms → cellular organisms → Bacteria510Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.15%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.41%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.21%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.47%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.74%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.74%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.74%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.74%
Arabidopsis RootHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root0.74%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.74%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.74%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005160Soil and rhizosphere microbial communities from Laval, Canada - mgLMBEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005511Combined assembly of arab plate scrape MF_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005513Combined assembly of arab plate scrape CL_Cvi (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025254Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025261Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes)Host-AssociatedOpen in IMG/M
3300025297Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes)Host-AssociatedOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300027521Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_101041232228664022SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAADIDETSKESKPT
INPgaii200_101099112228664022SoilRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAADIDETSKESKPT
F24TB_1158098823300000550SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMNETCEQSKPP*
JGI1027J11758_1284682423300000789SoilMNGGDGWVNDKAVPLLXGAPPQVREXDHDDSHAADIDETSKESKPT*
JGI12635J15846_1011969533300001593Forest SoilMNGGDGWVNDKAVPLLRGAPPQVRERDHDGSHAADIDEAPEESKPA*
JGI12627J18819_1002387833300001867Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDETSEESKPA*
rootH2_1012229933300003320Sugarcane Root And Bulk SoilMNGGDGWVNDKAVPLLRGAPPQVRKRDHDDSHTADIDETSEESKSA*
soilH2_1027199423300003324Sugarcane Root And Bulk SoilMNGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDESSEESKTA*
JGI25404J52841_1000218363300003659Tabebuia Heterophylla RhizosphereMNGGDGWVNDKAVPLLSGAPPQVGERDHDDSHATDIDETSEESKPA*
Ga0063454_10026463333300004081SoilMNGGDGWVNDKAVPLLRGGPPQVRERDHDDSHAVDIDETSKESKPT*
Ga0062595_10143223423300004479SoilMNGGDGWVNDKAVPLLRGAPPQVRERDHDESHARDIDETSKKSKPT*
Ga0066820_101863913300005160SoilMNGGDGWVNDKAVPLLRGAPPQVRERDHDDSHAADIDETSKESKPT*
Ga0066869_1001036223300005165SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA*
Ga0066674_1043798123300005166SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKSA*
Ga0066688_1070133623300005178SoilMNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDAVSEENKPACN*
Ga0066676_1112356913300005186SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEEGKPA*
Ga0066675_1002421753300005187SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDAVSEENKPACN*
Ga0065715_1014667523300005293Miscanthus RhizosphereGWMNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA*
Ga0070687_10099381023300005343Switchgrass RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP*
Ga0070709_1004415823300005434Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWSNDKAVPLLSGAPPQVREGDYDVSHVGDIDETSEESKSA*
Ga0070709_1013395923300005434Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAAPLLRGAPPQVRERDHDESHARDIDETSEKSKPA*
Ga0070711_10162909223300005439Corn, Switchgrass And Miscanthus RhizosphereNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA*
Ga0070708_10139118723300005445Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKPA*
Ga0070678_10072817633300005456Miscanthus RhizosphereDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA*
Ga0070681_1004800333300005458Corn RhizosphereMNGGDGWVNDKAVPLLSGAPPQVLERDHDDSHAADIDETSEESKPA*
Ga0070706_10014258333300005467Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEEGKPV*
Ga0077121_1022366923300005511Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQIRERDHGDSHAADIDQVSEESKPA*
Ga0077120_116306623300005513Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAVDIDQTSKESKPT*
Ga0070665_10246796223300005548Switchgrass RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHVADTDETSKESKPT*
Ga0066707_1100410523300005556SoilMNGGDGWVNDKAVPLLSGAPPQVRGCDHDDSHADDIDETSEESKSA*
Ga0068862_10061870833300005844Switchgrass RhizosphereMNGGDGCVNDKAVPLLNGAPPQVRERDHDGSHAAVIDETLEESNPA*
Ga0081538_1002775443300005981Tabebuia Heterophylla RhizosphereMNDGDGCVNDKAVPLLNGAPPQVRERDHDDCHAAVIDETSEESNPA*
Ga0081540_101525933300005983Tabebuia Heterophylla RhizosphereMNGGDGWVNDKAVPLLGGAPPQVRKRGRDDSHAADFDETSEESKPA*
Ga0070717_1031381723300006028Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSKESKPT*
Ga0066652_10030630823300006046SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKLA*
Ga0075024_10003373523300006047WatershedsMNGGDGWVNDKAVPLLRGAPPQVRERDHDESHACDIDETSEESKPA*
Ga0075026_10095481923300006057WatershedsRRPMNGGDGWVNDKAVPLLRGAPPQVRERDHDESHACDIDETSEESKPA*
Ga0070716_10058610633300006173Corn, Switchgrass And Miscanthus RhizosphereDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKPA*
Ga0070716_10113653223300006173Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA*
Ga0070712_10076617623300006175Corn, Switchgrass And Miscanthus RhizosphereMQATSQADDGGDGWVDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKP
Ga0079220_1049974413300006806Agricultural SoilMNGGDGWVNDKAVPLLVGAPPQVRKRDHDDSHTNDIDETSEESKSSDVSPGQPD
Ga0075428_10025826433300006844Populus RhizosphereMHGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP*
Ga0075428_10063586223300006844Populus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHSVHMDETCEESKPP*
Ga0075430_10025112923300006846Populus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHKAHMDEACEESKPP*
Ga0075431_10027950643300006847Populus RhizosphereQPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP*
Ga0075433_1001168763300006852Populus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDETCEESKPP*
Ga0099794_1007676823300007265Vadose Zone SoilMNGGGGWVNDKAVPLLSGAPPQVRERDHDDSHTADIDETSEESKPA*
Ga0114129_1023322643300009147Populus RhizospherePMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDETCEESKPP*
Ga0114129_1033121233300009147Populus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAHDIDETSEESKSA*
Ga0105104_1015484913300009168Freshwater SedimentMNGGDGWVNDKAVPLLSGAPPQVRERDHCDSHAAHMDETCEESKPPD
Ga0126380_1142487913300010043Tropical Forest SoilMNGGDGCENDKAVPLLNGAPPQIRERDHDGSHGVVIDETSEESNPA*
Ga0126380_1193632813300010043Tropical Forest SoilNDKAVPLLSGAPPQVRERDHDDSHAVDIDETSKESKPT*
Ga0126378_1094569923300010361Tropical Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRERDRDDSHAADIDETSKESKPT*
Ga0126379_1055182423300010366Tropical Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHADDIDKTSEESKLS*
Ga0105239_1255391713300010375Corn RhizosphereNDKAVPLLNGAPPQVRERDHDGSHAAVIDETLEESNSA*
Ga0126381_10074204113300010376Tropical Forest SoilAVPLLAGAPPQVRECDHGDSHIGDIGETSKESKSS*
Ga0137436_114324313300011423SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDET
Ga0137389_1038007013300012096Vadose Zone SoilMNGGDGWVNDKAVPLLDGAPPQVRECDHDDSHAADIDETSEESKPA*
Ga0137388_1052297013300012189Vadose Zone SoilMNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDETSEESKAA*
Ga0137364_1014679523300012198Vadose Zone SoilMNGGDGWVNDKAVPLLSGAPPQVLKRDHDDSHAADIDETSEESKPA*
Ga0137363_1154921313300012202Vadose Zone SoilMNGGDGWVNDKAVPLLCGAPPQVRECDHDDSHAADIDETSEESKSA*
Ga0137362_1161021323300012205Vadose Zone SoilMNGSDGWVNDKAVPLLSRAPPQVRERDHDESHAADMDETSK
Ga0137380_1136847723300012206Vadose Zone SoilMNGGDGCVNYKAVPLLSGAPPQVRERDHDDSHAADIDETSAESKPI*
Ga0137381_1148734823300012207Vadose Zone SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDESHARDIDETSEKSKPA*
Ga0137379_1163755823300012209Vadose Zone SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHADDIDETLKESKPA*
Ga0137371_1041920023300012356Vadose Zone SoilMNGGDGWVNDKAVPLLSGAPPQVLKRDHDDSHAADIDETSEERKPA*
Ga0150984_11830419223300012469Avena Fatua RhizosphereMNGGDGWVNDKAVPLLDGAPPQVRECDHDESHAANIEEILEESKPA*
Ga0157341_100991913300012494Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDRHVADIDETSEESKPA*
Ga0157309_1000889023300012895SoilMNGGDGWMNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA*
Ga0157285_1013013713300012897SoilPMNGGDGWVNDKAVPLLRGAPPQVRERAHDDSHAVDIDETSKESKPT*
Ga0157298_1023078313300012913SoilQPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAVDTDETSKESKPT*
Ga0137359_1106479223300012923Vadose Zone SoilMNGGDGWVNEKAVPLLSGAPPQVRERDHDDSHAHDIDETSEESKPA*
Ga0137407_1069784213300012930Vadose Zone SoilPRKPMNGGDGWVNDKAVPLLCGAPPQVRGCDHNDSHAADIDETSEESKPA*
Ga0164303_1030166023300012957SoilMNGGDGWVNDKAVPLLRGAPPQVRERDHDESHARDIDETSEKSKPA*
Ga0164303_1059789213300012957SoilVPLLSGAPPQVRERDHDDRHAADIDETSEESKPA*
Ga0164301_1178582213300012960SoilMNGGDGWVNDKAVPLLGAAPPHVREGDLNDSHAADIDETS
Ga0164309_1036328123300012984SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHADDIDETSEESKSA*
Ga0157307_106546023300013096SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAANVDEPSEESKPA*
Ga0157375_1027282113300013308Miscanthus RhizosphereRQPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETCEESKPP*
Ga0134078_1066722513300014157Grasslands SoilMNGGDGWVNDKAVPLLSGAPPQVRECDHDDSHAADIDAVSEENKTACT*
Ga0157376_1297735513300014969Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQARERDHDDSHAADIDETSKESKPT*
Ga0167631_106288813300015168Glacier Forefield SoilKPMNGGDGWVNDKAVPLLSGAPPQVREHAHDDSHAADIDESSKESKPT*
Ga0137412_1116455023300015242Vadose Zone SoilMNGGDGWLNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSGLMSQMGQ*
Ga0132258_1070218813300015371Arabidopsis RhizosphereKPMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHAAHMDETCEESKPP*
Ga0132256_10258251713300015372Arabidopsis RhizosphereKPMNGGDGWVNDKAVPLLSGAPPQVHERDHDDSHAVDIDETSQESKPT*
Ga0132256_10300733323300015372Arabidopsis RhizosphereQPRKPMNGGDGWVNDKAVPLLSGAPPQIREHDHDSHAADTDESSKESKPT*
Ga0132257_10204200713300015373Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQVHERDHDDSHAVDIDETSQESKPT*
Ga0132257_10333723323300015373Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHGDSHGAHMDETC
Ga0132255_10184983323300015374Arabidopsis RhizosphereMNGGDGWVNDKAVPLLRGAPPQVRERDHDDSHAVDIDETSKESKPT*
Ga0182032_1105225413300016357SoilPRKPMNGGDVGNDKAVPLLSGAPPQVRERNHDDSHAGDFDETSEESKSS
Ga0163161_1013912113300017792Switchgrass RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDNQDSHADNIGEPSEESKSA
Ga0163161_1113931823300017792Switchgrass RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKPA
Ga0184610_124459013300017997Groundwater SedimentMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIAETSKESKPT
Ga0184604_1015171923300018000Groundwater SedimentMNGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDETSKESKPT
Ga0184620_1022747223300018051Groundwater SedimentMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSKESKPT
Ga0184624_1035557623300018073Groundwater SedimentMNGGDGWVNDKAVPLLSGAPPQVREGDHDDSHAADIDETSEESKPA
Ga0184640_1049500213300018074Groundwater SedimentMNGGDGWVNDKAVPLLSGAPPQVREGDHDDSHADDIDETSEESKPA
Ga0190275_1008067113300018432SoilMNGGDGWMNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA
Ga0190274_1175069723300018476SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKPA
Ga0210399_1044255723300020581SoilMNGGDGWVNDKAVPLLSGAPPQVRERDNDDCHAADIDEISEESKPA
Ga0210401_1076066513300020583SoilMNGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDETSEESKPA
Ga0210404_1036735313300021088SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA
Ga0210405_1035168533300021171SoilMNGGDGWVNDKAVPLLRGAPPQVRERGHDDGHAVDIDETSEECKPA
Ga0210396_1155244823300021180SoilMNGGDGWVNDKAVPLLSGAPPQVREGDHDDSHAADIDETSEESKLA
Ga0193699_1018286213300021363SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDSHADDIHETSEESKPAWCPRWVM
Ga0213874_1031478013300021377Plant RootsMNGGDGWGHDKAVPLLSGAPPQVSERDHGDSHTGDNGEISKESKLS
Ga0210410_1009495113300021479SoilGGDGWVNDKAVPLLNGAPPQVRERDHDDSHAADIDETSEESKPA
Ga0126371_1017472213300021560Tropical Forest SoilMNGGDGWVNDKAVPLLNGAPPQVRARDHDDSHAADFDETSGESKRGATL
Ga0209148_101041243300025254Arabidopsis RootNDKAVPLLSGAPPQVRERDHDDSHAVDIDQTSKESKPT
Ga0209233_108791713300025261Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAVDIDQTSKESKPT
Ga0209758_105538513300025297Arabidopsis RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHGADIDKTSEES
Ga0207653_1000871313300025885Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESNRLNVSN
Ga0207710_1057290313300025900Switchgrass RhizosphereTAATVGNDKAVPLLSGAPPQVRERNHDDSHADDIDETSEESKSA
Ga0207699_1017690023300025906Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAAPLLRGAPPQVRERDHDESHARDIDETSEKSKPA
Ga0207684_1019786633300025910Corn, Switchgrass And Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEEGKPV
Ga0207707_1003853223300025912Corn RhizosphereMNGGDGWVNDKAVPLLSGAPPQVLERDHDDSHAADIDETSEESKPA
Ga0207663_1132546913300025916Corn, Switchgrass And Miscanthus RhizosphereAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA
Ga0207677_1150635413300026023Miscanthus RhizosphereMNGGDGWVNDKAVPLLSGAPPQVRERDHDDRHAADIDETSEESKPGGS
Ga0207639_1154747433300026041Corn RhizosphereGNDKAVPLLSGAPPQVRERDHDDSHADDIDETSEESKSA
Ga0209686_110619423300026315SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSEESKSA
Ga0257157_106205123300026496SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDGHVANIDETSEESNPA
Ga0209524_101728123300027521Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDDSHAADIDETSKESKPA
Ga0209734_101050313300027535Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHGGSHAADIHEASEESKPA
Ga0209419_102938513300027537Forest SoilMNGGDGWVNDKAVPLLRGAPPQVRERDHDGSHAADIDEAPEESKPA
Ga0209733_102989613300027591Forest SoilMPMNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDETSEESKPA
Ga0209331_102164713300027603Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRERDNHGSHAADID
Ga0209736_104279713300027660Forest SoilMNGGDGWVNDKAVPLLSGAPPQVRERDHDGSHAADIDEAPEESKPA
Ga0209588_104262313300027671Vadose Zone SoilMNGGGGWVNDKAVPLLSGAPPQVRERDHDDSHTADIDETSEESKPA
Ga0209328_1001621223300027727Forest SoilMNGGDGWVNDKAVPLLRGAPPQVRERDHDGSHAADIDEAPEESKPAWAEAEYET
Ga0209069_1013526313300027915WatershedsWVNDKAVPLLRGAPPQVRERDHDESHACDIDETSEESKPA
Ga0268265_1057896933300028380Switchgrass RhizosphereMNGGDGCVNDKAVPLLNGAPPQVRERDHDGSHAAVIDETLEESNPA
Ga0311348_1076676523300030019FenMNGGDGWVNDKAVPLLRGAPPQVRERDHDESHARDIDETSEKSKPA
Ga0311364_1043993023300031521FenMNGGDGWVNDKAVPLLNGAPPQVSERDHDDSHAADIDETSEESKPA
Ga0302321_10138679023300031726FenMNGGDGWMNDKAVPLLNGAPPQVSERDHDDSHAADIDETSEESKPA
Ga0307472_10008419023300032205Hardwood Forest SoilPRKPMNGGDGWVNDKAVPLLSGAPPQVRERDNHDCHAADIDEISEESKPA
Ga0373958_0213402_169_3093300034819Rhizosphere SoilMNGGDGWSNDKAVPLLSGAPPQVREGDHDVSHVGDIDETSEEGKSA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.