Basic Information | |
---|---|
Family ID | F058002 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 135 |
Average Sequence Length | 45 residues |
Representative Sequence | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGFW |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 3.12 % |
% of genes near scaffold ends (potentially truncated) | 94.81 % |
% of genes from short scaffolds (< 2000 bps) | 71.11 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (70.370 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (44.444 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.148 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.778 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF02843 | GARS_C | 0.74 |
PF07460 | NUMOD3 | 0.74 |
PF13884 | Peptidase_S74 | 0.74 |
PF13392 | HNH_3 | 0.74 |
PF13508 | Acetyltransf_7 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.15 % |
Unclassified | root | N/A | 11.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002091|JGI24028J26656_1025976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300002092|JGI24218J26658_1002578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4564 | Open in IMG/M |
3300003277|JGI25908J49247_10106740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300003394|JGI25907J50239_1002359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4579 | Open in IMG/M |
3300003394|JGI25907J50239_1038075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300005582|Ga0049080_10020881 | All Organisms → Viruses → Predicted Viral | 2284 | Open in IMG/M |
3300005583|Ga0049085_10057988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
3300006802|Ga0070749_10025502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3718 | Open in IMG/M |
3300006802|Ga0070749_10618080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300006805|Ga0075464_10398642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300006863|Ga0075459_1012313 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
3300007363|Ga0075458_10044617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
3300008113|Ga0114346_1075419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2430 | Open in IMG/M |
3300008266|Ga0114363_1022052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2791 | Open in IMG/M |
3300008448|Ga0114876_1141420 | Not Available | 891 | Open in IMG/M |
3300008450|Ga0114880_1035070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. NFPP12 | 2216 | Open in IMG/M |
3300008450|Ga0114880_1071311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1410 | Open in IMG/M |
3300008450|Ga0114880_1232558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300008450|Ga0114880_1235185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300009155|Ga0114968_10738679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300009159|Ga0114978_10667282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300009161|Ga0114966_10055292 | All Organisms → Viruses → Predicted Viral | 2800 | Open in IMG/M |
3300009164|Ga0114975_10551271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300009181|Ga0114969_10383858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300009181|Ga0114969_10418780 | Not Available | 763 | Open in IMG/M |
3300009183|Ga0114974_10132117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1576 | Open in IMG/M |
3300009184|Ga0114976_10306064 | Not Available | 849 | Open in IMG/M |
3300010160|Ga0114967_10098622 | All Organisms → Viruses → Predicted Viral | 1704 | Open in IMG/M |
3300010885|Ga0133913_10282314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4404 | Open in IMG/M |
3300010885|Ga0133913_10292409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4320 | Open in IMG/M |
3300010885|Ga0133913_11896543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Pseudorhodoferax → unclassified Pseudorhodoferax → Pseudorhodoferax sp. Leaf274 | 1486 | Open in IMG/M |
3300010885|Ga0133913_12369394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
3300013004|Ga0164293_10342847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
3300013372|Ga0177922_10543442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300017699|Ga0181345_102382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300017701|Ga0181364_1002645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3184 | Open in IMG/M |
3300017716|Ga0181350_1005438 | All Organisms → Viruses → Predicted Viral | 3684 | Open in IMG/M |
3300017716|Ga0181350_1008330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2977 | Open in IMG/M |
3300017716|Ga0181350_1133179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300017722|Ga0181347_1011644 | All Organisms → Viruses → Predicted Viral | 2847 | Open in IMG/M |
3300017722|Ga0181347_1039784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
3300017723|Ga0181362_1033099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
3300017736|Ga0181365_1002014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4890 | Open in IMG/M |
3300017736|Ga0181365_1009742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2389 | Open in IMG/M |
3300017736|Ga0181365_1089513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300017736|Ga0181365_1104711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300017761|Ga0181356_1226567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300017766|Ga0181343_1086784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300017766|Ga0181343_1102122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300017774|Ga0181358_1029517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2148 | Open in IMG/M |
3300017774|Ga0181358_1078075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
3300017774|Ga0181358_1099962 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300017777|Ga0181357_1056833 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
3300017777|Ga0181357_1079693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
3300017777|Ga0181357_1285102 | Not Available | 565 | Open in IMG/M |
3300017778|Ga0181349_1063749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1424 | Open in IMG/M |
3300017778|Ga0181349_1247772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300017780|Ga0181346_1077703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
3300017780|Ga0181346_1172017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300017780|Ga0181346_1245734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300017780|Ga0181346_1298244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300017784|Ga0181348_1032988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2170 | Open in IMG/M |
3300017784|Ga0181348_1047561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1763 | Open in IMG/M |
3300017784|Ga0181348_1050360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1706 | Open in IMG/M |
3300017784|Ga0181348_1151487 | Not Available | 868 | Open in IMG/M |
3300017784|Ga0181348_1291421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300017785|Ga0181355_1035509 | All Organisms → Viruses → Predicted Viral | 2144 | Open in IMG/M |
3300017785|Ga0181355_1053329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1715 | Open in IMG/M |
3300017785|Ga0181355_1082596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
3300017785|Ga0181355_1186320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300017785|Ga0181355_1317016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300017785|Ga0181355_1363452 | Not Available | 530 | Open in IMG/M |
3300019784|Ga0181359_1030660 | All Organisms → Viruses → Predicted Viral | 2074 | Open in IMG/M |
3300019784|Ga0181359_1040883 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
3300019784|Ga0181359_1201201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300019784|Ga0181359_1231311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300021956|Ga0213922_1102109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300021962|Ga0222713_10092194 | Not Available | 2189 | Open in IMG/M |
3300022179|Ga0181353_1046688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
3300022190|Ga0181354_1229316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300022198|Ga0196905_1132672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300022407|Ga0181351_1038437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2025 | Open in IMG/M |
3300023184|Ga0214919_10161800 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
3300024289|Ga0255147_1004419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3241 | Open in IMG/M |
3300024503|Ga0255152_1034731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300024531|Ga0255228_1121858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300025445|Ga0208424_1030154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300025635|Ga0208147_1057402 | Not Available | 988 | Open in IMG/M |
3300025818|Ga0208542_1197938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300025896|Ga0208916_10028809 | All Organisms → Viruses → Predicted Viral | 2226 | Open in IMG/M |
3300025896|Ga0208916_10443074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300027130|Ga0255089_1025793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
3300027132|Ga0255110_1005630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2532 | Open in IMG/M |
3300027143|Ga0255105_1037419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300027486|Ga0255086_1036668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300027492|Ga0255093_1057157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300027608|Ga0208974_1019237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2136 | Open in IMG/M |
3300027659|Ga0208975_1082850 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300027732|Ga0209442_1076122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
3300027782|Ga0209500_10297033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300027785|Ga0209246_10058327 | Not Available | 1493 | Open in IMG/M |
3300027798|Ga0209353_10014303 | All Organisms → Viruses → Predicted Viral | 3783 | Open in IMG/M |
3300027808|Ga0209354_10002015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8730 | Open in IMG/M |
3300027808|Ga0209354_10015040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3084 | Open in IMG/M |
3300027808|Ga0209354_10046884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1739 | Open in IMG/M |
3300027808|Ga0209354_10439797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300027836|Ga0209230_10757319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027963|Ga0209400_1146861 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
3300028025|Ga0247723_1011317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3424 | Open in IMG/M |
3300028394|Ga0304730_1077298 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
3300028394|Ga0304730_1214768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300028394|Ga0304730_1277666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300031707|Ga0315291_10498565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
3300031707|Ga0315291_10587164 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
3300031746|Ga0315293_10762262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300031772|Ga0315288_11280899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300031784|Ga0315899_10370422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1400 | Open in IMG/M |
3300031786|Ga0315908_11261157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300031834|Ga0315290_11288233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300031963|Ga0315901_10065839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3467 | Open in IMG/M |
3300031999|Ga0315274_10462698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300032018|Ga0315272_10663673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300032053|Ga0315284_10534164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
3300032092|Ga0315905_10337203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1435 | Open in IMG/M |
3300032116|Ga0315903_10079288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3207 | Open in IMG/M |
3300034082|Ga0335020_0622623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300034102|Ga0335029_0564948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → unclassified Achromobacter → Achromobacter sp. | 646 | Open in IMG/M |
3300034356|Ga0335048_0505618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 44.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.33% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.15% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.93% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.70% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.70% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.70% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.96% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.48% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.48% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.48% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.74% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.74% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.74% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027130 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d | Environmental | Open in IMG/M |
3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI24028J26656_10259763 | 3300002091 | Lentic | MLAAGLVKQIQAGCDLYREAKTQFVEIKKTADEVVAIGKEAKGF |
JGI24218J26658_10025781 | 3300002092 | Lentic | MLAAGLVKQIQAGCDLYREAKTQFVEIKKTADEVVAIGKEAKGFIA |
JGI25908J49247_101067401 | 3300003277 | Freshwater Lake | MAAGICKQIQAGCELYRECKTQFVEIKKTSDEVIAVGKELQSFWKQLL |
JGI25907J50239_10023591 | 3300003394 | Freshwater Lake | MAAGLVKQIQAGCELYKQAKESFVEIKATADEVVGIYKEVTGFWGNF |
JGI25907J50239_10380751 | 3300003394 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGSK |
Ga0049080_100208813 | 3300005582 | Freshwater Lentic | MAAGLVKQIQAGCELYKQAKESFVEIKATADEVVGIYKEVTGFWGNFRKLFGAK |
Ga0049085_100579881 | 3300005583 | Freshwater Lentic | LVKNIQAGCELYKQAKEQFVSIKRTADEVVGIYKEVTGFWSNFGKLFG |
Ga0070749_100255021 | 3300006802 | Aqueous | MAAGLVKQIQAGCDLYKQAKESFVEVKKTADEVIAIG |
Ga0070749_106180801 | 3300006802 | Aqueous | MAAGLVKQIQAGCDLYKQAKESFVEVKKTADEVIAIGKEVKGFWGKL |
Ga0075464_103986422 | 3300006805 | Aqueous | LVKNIQAGCDLYKQAKESFVEVKKTADQVIAIGKEVKGFWGTLRKLFGG |
Ga0075459_10123132 | 3300006863 | Aqueous | MAAGLVKQIQQGVDLYKQAKDQFVQVKRTADEVVAIGKELGGFWSK |
Ga0075458_100446172 | 3300007363 | Aqueous | MAAGLVKQIQAGCDLYKQAKESFVEVKKTADEVIAI |
Ga0114346_10754191 | 3300008113 | Freshwater, Plankton | MAAGLVKQIQAGCDLYKQAKESFVEIKSTADEVVAIGKEVRGFWGKLLSIFG |
Ga0114363_10220525 | 3300008266 | Freshwater, Plankton | VDPISICLLAAGLVKQIQAGCELYKQAKESFVEIKATADEVIAIG |
Ga0114876_11414202 | 3300008448 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFW |
Ga0114880_10350701 | 3300008450 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIKATADEVIAIGKEVHG |
Ga0114880_10713111 | 3300008450 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGFW |
Ga0114880_12325581 | 3300008450 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEVKGFWGSL |
Ga0114880_12351852 | 3300008450 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGTLRKLF |
Ga0114968_107386792 | 3300009155 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVKGFWGTLRKLFG |
Ga0114978_106672822 | 3300009159 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVKGFWG |
Ga0114966_100552921 | 3300009161 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVKGFWGTLRK |
Ga0114975_105512712 | 3300009164 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVK |
Ga0114969_103838584 | 3300009181 | Freshwater Lake | MAAGICKQIQAGCDLYRECKTQFVEVKKTADEVIAI |
Ga0114969_104187803 | 3300009181 | Freshwater Lake | VDPISLCLLAAGLVKQIQAGCDLYREAKTQFIQVKKTADEVIAI |
Ga0114974_101321172 | 3300009183 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKRFWGVLRKLF |
Ga0114976_103060642 | 3300009184 | Freshwater Lake | MAAGLVKQIQQGVDLYKQAKEQFVQVKRTADEVVAIGKE |
Ga0114967_100986222 | 3300010160 | Freshwater Lake | MAAGLVKQIQQGCELYKQAKEQFVQVKQTGEQVVAIGKELNGFWNQLRKLFGAKP |
Ga0133913_1028231411 | 3300010885 | Freshwater Lake | MAAGICKQIQAGCDLYRSAKTQFVEIKATADQVMEIGKEVQGFWKKLM |
Ga0133913_102924091 | 3300010885 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGIFGFLRNF |
Ga0133913_118965431 | 3300010885 | Freshwater Lake | MAAGLVKQIQQGVDLYKQAKDQFVQVKRTADEVVAIGKELGGFWSKLR |
Ga0133913_123693942 | 3300010885 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGIF |
Ga0164293_103428471 | 3300013004 | Freshwater | MAAGLVKQIQQGVDLYKQAKEHFVEVKSTVDQAVAVGKEIGGFWTQLLKFFG |
Ga0136641_11880202 | 3300013286 | Freshwater | VDPISLCLLAAGLVKNIQQGCDLYKQAKESFVQVKKTADEVVAIGKEVQGFWGKLAKFFNSQPKVN |
Ga0177922_105434421 | 3300013372 | Freshwater | MAAGICKQIQAGCDLYRSAKTQFVEIKATADQVMEI |
Ga0181345_1023821 | 3300017699 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLRKLFG |
Ga0181364_10026453 | 3300017701 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLRKLFGGS |
Ga0181350_10054383 | 3300017716 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGS |
Ga0181350_10083303 | 3300017716 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQL |
Ga0181350_11331791 | 3300017716 | Freshwater Lake | LAAGLVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFG |
Ga0181347_10116443 | 3300017722 | Freshwater Lake | VKQIQAGCELYKSTKEQFVQIKRTADEVIAIGKEVHGFWNQLLAFFGAKP |
Ga0181347_10397841 | 3300017722 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGFWGSLRK |
Ga0181362_10330992 | 3300017723 | Freshwater Lake | LVKNIQAGCELYKQAKESFVVLKRTGEVGVAIGNEL |
Ga0181365_10020141 | 3300017736 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIKRTGEEVVAIGKEL |
Ga0181365_10097421 | 3300017736 | Freshwater Lake | MAAGLVKQIQAGCELYKQAKESFVEIKATADEVVGIYKEVTGFWGNFRKLFGAKP |
Ga0181365_10895132 | 3300017736 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVVGIYKEVTGFWSNF |
Ga0181365_11047111 | 3300017736 | Freshwater Lake | LVKNIQAGCELYKQAKEQLVSIKRTADEVIAIGKEVKGFW |
Ga0181356_12265671 | 3300017761 | Freshwater Lake | MAAGLVKQIQAGCELYKQAKESFVEIKAIADEVVGIYKEVTGFWGNFRKLFGAKPK |
Ga0181343_10867841 | 3300017766 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGI |
Ga0181343_11021221 | 3300017766 | Freshwater Lake | VDPISICLLAAGLVKNIQAGCDLYKQAKESFVEIKATADEVIAIGKEVHGFWN |
Ga0181358_10295171 | 3300017774 | Freshwater Lake | LAAGLVKNIQAGCELYKQAKESFVEIKRTGEEVIAIGKEVHGFWNQLLRFFGSRPKP |
Ga0181358_10305913 | 3300017774 | Freshwater Lake | VKQIQAGCELYKQSKEQFVQIKRTADEVIAIGKEVHGFWNQLLAFFGAKPKPQ |
Ga0181358_10780751 | 3300017774 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGFWGSL |
Ga0181358_10999622 | 3300017774 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVVAIGKEVKGFWGSL |
Ga0181357_10568332 | 3300017777 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAFGKELHGFWNQLLGFF |
Ga0181357_10796932 | 3300017777 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKEVKGFWGS |
Ga0181357_12554741 | 3300017777 | Freshwater Lake | LAAGLVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGSKPK |
Ga0181357_12851021 | 3300017777 | Freshwater Lake | MAAGICKQIQAGCDLYRECKTQFVEIKKTSDEVIAVGKELQSFWKQLL |
Ga0181349_10637491 | 3300017778 | Freshwater Lake | VDPISLCLLAAGLVKQIQAGCDLYREAKTQFIQVRQTAEEVIAIGKEAKGFFAK |
Ga0181349_12477722 | 3300017778 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEVKGFW |
Ga0181346_10777032 | 3300017780 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEVK |
Ga0181346_11720171 | 3300017780 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVKG |
Ga0181346_12457342 | 3300017780 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVVAIGKE |
Ga0181346_12982442 | 3300017780 | Freshwater Lake | LAAGLVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFW |
Ga0181348_10329881 | 3300017784 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEVKGFWGT |
Ga0181348_10475611 | 3300017784 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFCSFF |
Ga0181348_10503601 | 3300017784 | Freshwater Lake | VDPISICLLAAGLVKQIQAGCELYKQAKESFVEIKRTADEVVAI |
Ga0181348_11514871 | 3300017784 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLRKL |
Ga0181348_12914211 | 3300017784 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEV |
Ga0181355_10355093 | 3300017785 | Freshwater Lake | LVKNTQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGA |
Ga0181355_10533291 | 3300017785 | Freshwater Lake | VDPISICLLAAGLVKQIQAGCELYKQAKESFVEIKRTADEVVAIGKE |
Ga0181355_10825961 | 3300017785 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVVGIYKEVTGFWSNFGKLF |
Ga0181355_11863202 | 3300017785 | Freshwater Lake | LCLLAAGLVKQIQAGCELYKSTKEQFVQIKRTADEVIAIGKEVHGFWNQLLAFFGA |
Ga0181355_13170161 | 3300017785 | Freshwater Lake | LAAGLVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHG |
Ga0181355_13634521 | 3300017785 | Freshwater Lake | MAAGICKQIQAGCDLYRECKTQFVEIKKTSDEVIAVL |
Ga0181359_10306601 | 3300019784 | Freshwater Lake | MAAGLVSKIQQSVELYKSAREHFVQVKATADEVVAIGKELGGLWSKLRKFFAG |
Ga0181359_10408831 | 3300019784 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELH |
Ga0181359_12012012 | 3300019784 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKE |
Ga0181359_12313112 | 3300019784 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVF |
Ga0213922_11021092 | 3300021956 | Freshwater | LVKNIQAGCDLYKQAKESFVEVKKTADQVIAIGKEVKGFWGT |
Ga0222713_100921946 | 3300021962 | Estuarine Water | VDPISLCLLAAGLVKQIQAGCDLYREAKTQFIQVKKTADEVIAIGKEAK |
Ga0181353_10466882 | 3300022179 | Freshwater Lake | MAAGLVKQIQAGCDLYKQAKESFVEIKATADEVVAIGKEVRG |
Ga0181354_12029762 | 3300022190 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGSKPKFS |
Ga0181354_12293161 | 3300022190 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLRKLFGG |
Ga0196905_11326721 | 3300022198 | Aqueous | VDPISICLLAAGLVKNIQAGCDLYRQAKESFVEIKATADE |
Ga0181351_10351132 | 3300022407 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGSKTKPQ |
Ga0181351_10384371 | 3300022407 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGF |
Ga0214919_101618004 | 3300023184 | Freshwater | VDPISLCLLAAGLVKNIQQGCDLYKQAKESFVQVKKTADEVVAIGKEVQGFWS |
Ga0255147_10044193 | 3300024289 | Freshwater | MAAGLVKQIQAGCDLYKQAKESFVEVKKTADDVTKIYKEVTGFWSNFSNFFKS |
Ga0255152_10347312 | 3300024503 | Freshwater | MAAGLVKQIQAGCDLYKQAKESFVEVKKTADDVTKIYKEVTGFWSNLRKLFG |
Ga0255228_11218581 | 3300024531 | Freshwater | MAAGLVKQIQAGCELYKQAKESFVEIKATADEVVGIYKEVTGFWGNFLKLF |
Ga0208424_10301542 | 3300025445 | Aqueous | MAAGLVKQIQQGVDLYKQAKDQFVQVKRTADEVVAIG |
Ga0208147_10574021 | 3300025635 | Aqueous | MAAGLVKQIQQGVDLYKQAKEQFVQVKRTADEAIAIG |
Ga0208542_11979381 | 3300025818 | Aqueous | MAAGLVKQIQAGCDLYKQAKESFVEVKKTADEVIAIGKEVKGFWGKLLSIFGQK |
Ga0208916_100288091 | 3300025896 | Aqueous | MAAGLVKQIQQGCELYKQAKEQFVQVKRTSDEVVAIGKELNGFWN |
Ga0208916_104430742 | 3300025896 | Aqueous | MAAGLVKQIQQGVDLYKQAKDQFVQVKRTADEVVAIGKELGGFWS |
Ga0255089_10257931 | 3300027130 | Freshwater | MAAGLVKQIQAGCELYKQAKESFVEIKATADEVVGIYKE |
Ga0255110_10056303 | 3300027132 | Freshwater | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLL |
Ga0255105_10374191 | 3300027143 | Freshwater | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFGAK |
Ga0255086_10366684 | 3300027486 | Freshwater | LVKQIQAGCELYKQAKESFVEIKRTADEVVAIGKEVHG |
Ga0255093_10571572 | 3300027492 | Freshwater | MAAGLVKQIQAGCELYKQAKESFVEIKATADEVVGIYKEVTGFWGNFLKLFG |
Ga0208974_10192376 | 3300027608 | Freshwater Lentic | MAAGICKQIQAGCDLYRSAKTQFVEIKATADQVMEIGKEVQGFWKK |
Ga0208975_10828501 | 3300027659 | Freshwater Lentic | MAAGICKQIQAGCDLYRSAKTQFVEIKATADQVMEIGKEVQGFWKKLLQFF |
Ga0209599_102262332 | 3300027710 | Deep Subsurface | MAAGLVSKIQQSVELYKSAREHFVQVKATADEVVAIGKELGGLWSKLRKFFAGSPKP |
Ga0209442_10761221 | 3300027732 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEVKGFWGTLRKL |
Ga0209500_102970331 | 3300027782 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVKGFW |
Ga0209246_100583272 | 3300027785 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELYGF |
Ga0209353_100143034 | 3300027798 | Freshwater Lake | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHG |
Ga0209353_103064652 | 3300027798 | Freshwater Lake | VKQIQAGCELYKQSKEQFVQIKRTADEVIAIGKEVHGFWNQLLAFFGAKPKPKSA |
Ga0209354_100020151 | 3300027808 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSL |
Ga0209354_100150403 | 3300027808 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLR |
Ga0209354_100468842 | 3300027808 | Freshwater Lake | LVKNIQAGCDLYKQAKESFVEIRNTANEVIAIGKEVKGFWG |
Ga0209354_104397972 | 3300027808 | Freshwater Lake | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEV |
Ga0209230_107573191 | 3300027836 | Freshwater And Sediment | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFLNQLLGFFGSKP |
Ga0209400_11468611 | 3300027963 | Freshwater Lake | MAAGLVKQIQQGCELYKQAKEQFVQVKQTGEQVVAIGKELN |
Ga0247723_10113173 | 3300028025 | Deep Subsurface Sediment | MAAGLVKQIQAGCDLYKQAKESFVEIKATADEVVAIGKEVRGFWGKLLSIFG |
Ga0304730_10772981 | 3300028394 | Freshwater Lake | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVKGFWGTLRKL |
Ga0304730_12147683 | 3300028394 | Freshwater Lake | LCLLAAGLVKNIQQGCELYKQAKESFVQVKKTADEVLAIGKEVQGFWGKLLSFFNSQ |
Ga0304730_12776661 | 3300028394 | Freshwater Lake | LVKNIQAGCDLYKQAKEQIVSIKRTADEVIAIGKEVKGFWGS |
Ga0315291_104985652 | 3300031707 | Sediment | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFW |
Ga0315291_105871642 | 3300031707 | Sediment | MAAGLVKQIQQGCELYKQAKEQFVQVKQTGEQVVAIGKELNTFWNQLCKLFG |
Ga0315293_107622621 | 3300031746 | Sediment | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLRKLF |
Ga0315288_112808991 | 3300031772 | Sediment | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKG |
Ga0315899_103704221 | 3300031784 | Freshwater | LVKQIQAGCELYKQAKESFVEIKRTADEVVAIGKEVKGIWGTLVGFFGGK |
Ga0315908_112611571 | 3300031786 | Freshwater | LVKQIQAGCELYKQAKESFVEIKRTADEVVAIGKEVKGIWGTLVGF |
Ga0315290_112882332 | 3300031834 | Sediment | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGS |
Ga0315901_100658391 | 3300031963 | Freshwater | MAAGICKQIQAGCDLYRSAKTQFVEIKATADQVMEIGKEVQGFWKKL |
Ga0315274_104626981 | 3300031999 | Sediment | LVKNIQAGCDLYKQAKEQFVSIKRTADEVIAIGKEVQGFWGSLR |
Ga0315272_106636732 | 3300032018 | Sediment | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWGSLRK |
Ga0315284_105341642 | 3300032053 | Sediment | LVKNIQAGCELYKQAKEQFVSIKRTADEVIAIGKEVKGFWG |
Ga0315905_103372031 | 3300032092 | Freshwater | LVKNIQAGCELYKQAKESFVEIKRTGEEVIAIGKEVH |
Ga0315903_100792883 | 3300032116 | Freshwater | LVKNIQAGCELYKQAKESFVEIKRTGEEVVAIGKELHGFWNQLLGFFG |
Ga0335020_0622623_365_502 | 3300034082 | Freshwater | LVKNIQAGCELYKQAKESFVEIKATADQVIEIGKEAYGFWNQLLAF |
Ga0335029_0564948_491_646 | 3300034102 | Freshwater | VDPISICLLAAGLVKQIQAGCELYKQAKESFVEIKATADEVIAIGKEVRGFW |
Ga0335048_0505618_1_150 | 3300034356 | Freshwater | MAAGLVSKIQQSVELYKSAREHFVQVKATADEVVAIGKELGGLWSKLRKF |
⦗Top⦘ |