NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058613

Metagenome / Metatranscriptome Family F058613

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058613
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 61 residues
Representative Sequence MEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE
Number of Associated Samples 80
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 54.14 %
% of genes near scaffold ends (potentially truncated) 38.06 %
% of genes from short scaffolds (< 2000 bps) 99.25 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.776 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(68.657 % of family members)
Environment Ontology (ENVO) Unclassified
(87.313 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(85.821 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.07%    β-sheet: 0.00%    Coil/Unstructured: 53.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF04195Transposase_28 7.46


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.78 %
UnclassifiedrootN/A5.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005440|Ga0070705_101140778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum640Open in IMG/M
3300009553|Ga0105249_10994373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum907Open in IMG/M
3300009973|Ga0105136_102117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum951Open in IMG/M
3300009980|Ga0105135_125418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum541Open in IMG/M
3300009981|Ga0105133_113209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum658Open in IMG/M
3300009981|Ga0105133_118136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300009989|Ga0105131_105689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum956Open in IMG/M
3300009990|Ga0105132_121429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae641Open in IMG/M
3300009990|Ga0105132_137833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum536Open in IMG/M
3300009992|Ga0105120_1038896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum583Open in IMG/M
3300009995|Ga0105139_1020253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae987Open in IMG/M
3300009995|Ga0105139_1123439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300010371|Ga0134125_10857849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae998Open in IMG/M
3300010396|Ga0134126_12573802All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae553Open in IMG/M
3300010396|Ga0134126_12857093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum523Open in IMG/M
3300010396|Ga0134126_12986750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum511Open in IMG/M
3300010399|Ga0134127_10925161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum928Open in IMG/M
3300010399|Ga0134127_11204647All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum824Open in IMG/M
3300010399|Ga0134127_12375320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum610Open in IMG/M
3300010399|Ga0134127_12803007All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum567Open in IMG/M
3300010401|Ga0134121_12694994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum542Open in IMG/M
3300010403|Ga0134123_10602366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1056Open in IMG/M
3300014325|Ga0163163_12556739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae568Open in IMG/M
3300014326|Ga0157380_10831334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum943Open in IMG/M
3300015270|Ga0182183_1050057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum618Open in IMG/M
3300015273|Ga0182102_1003753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum954Open in IMG/M
3300015278|Ga0182099_1060328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae534Open in IMG/M
3300015278|Ga0182099_1062629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae528Open in IMG/M
3300015280|Ga0182100_1068998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum573Open in IMG/M
3300015280|Ga0182100_1092747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum516Open in IMG/M
3300015284|Ga0182101_1027338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis769Open in IMG/M
3300015284|Ga0182101_1044918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae661Open in IMG/M
3300015284|Ga0182101_1084570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum534Open in IMG/M
3300015290|Ga0182105_1019169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum884Open in IMG/M
3300015290|Ga0182105_1043545All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300015293|Ga0182103_1045409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum659Open in IMG/M
3300015293|Ga0182103_1048291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum647Open in IMG/M
3300015301|Ga0182184_1035409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum716Open in IMG/M
3300015306|Ga0182180_1029091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum768Open in IMG/M
3300015306|Ga0182180_1060857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum590Open in IMG/M
3300015309|Ga0182098_1100508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300015310|Ga0182162_1045477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum734Open in IMG/M
3300015311|Ga0182182_1027900Not Available832Open in IMG/M
3300015311|Ga0182182_1078259All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum592Open in IMG/M
3300015312|Ga0182168_1042255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum776Open in IMG/M
3300015312|Ga0182168_1081060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300015313|Ga0182164_1045591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum756Open in IMG/M
3300015313|Ga0182164_1105337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae558Open in IMG/M
3300015313|Ga0182164_1113436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum543Open in IMG/M
3300015313|Ga0182164_1131435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum511Open in IMG/M
3300015315|Ga0182120_1058497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum699Open in IMG/M
3300015315|Ga0182120_1082776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum616Open in IMG/M
3300015315|Ga0182120_1128278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300015316|Ga0182121_1078819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum646Open in IMG/M
3300015316|Ga0182121_1087455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae621Open in IMG/M
3300015317|Ga0182136_1030160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum873Open in IMG/M
3300015317|Ga0182136_1114831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae546Open in IMG/M
3300015318|Ga0182181_1023542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum859Open in IMG/M
3300015318|Ga0182181_1101041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum528Open in IMG/M
3300015318|Ga0182181_1101088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum528Open in IMG/M
3300015319|Ga0182130_1065339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum660Open in IMG/M
3300015320|Ga0182165_1015060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1119Open in IMG/M
3300015320|Ga0182165_1045432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum783Open in IMG/M
3300015320|Ga0182165_1137357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015320|Ga0182165_1139685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae514Open in IMG/M
3300015326|Ga0182166_1038438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum809Open in IMG/M
3300015326|Ga0182166_1063679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae684Open in IMG/M
3300015326|Ga0182166_1123133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae537Open in IMG/M
3300015327|Ga0182114_1076708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum681Open in IMG/M
3300015327|Ga0182114_1077814All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300015327|Ga0182114_1159273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015328|Ga0182153_1054208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum741Open in IMG/M
3300015329|Ga0182135_1072648All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae675Open in IMG/M
3300015330|Ga0182152_1043570All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum810Open in IMG/M
3300015331|Ga0182131_1056036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum745Open in IMG/M
3300015331|Ga0182131_1092552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300015331|Ga0182131_1112902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae574Open in IMG/M
3300015332|Ga0182117_1042808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum870Open in IMG/M
3300015332|Ga0182117_1095604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum642Open in IMG/M
3300015332|Ga0182117_1163339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300015332|Ga0182117_1163713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae510Open in IMG/M
3300015333|Ga0182147_1054024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum788Open in IMG/M
3300015333|Ga0182147_1082394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum675Open in IMG/M
3300015337|Ga0182151_1063861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum730Open in IMG/M
3300015337|Ga0182151_1108845Not Available598Open in IMG/M
3300015338|Ga0182137_1102291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum641Open in IMG/M
3300015338|Ga0182137_1108527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum625Open in IMG/M
3300015339|Ga0182149_1089519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae662Open in IMG/M
3300015339|Ga0182149_1174988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum501Open in IMG/M
3300015340|Ga0182133_1059657Not Available811Open in IMG/M
3300015340|Ga0182133_1150092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015348|Ga0182115_1119524Not Available836Open in IMG/M
3300015349|Ga0182185_1013498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1701Open in IMG/M
3300015349|Ga0182185_1137456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum722Open in IMG/M
3300015350|Ga0182163_1216865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum600Open in IMG/M
3300015352|Ga0182169_1142572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum780Open in IMG/M
3300015352|Ga0182169_1189933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum672Open in IMG/M
3300015352|Ga0182169_1203433Not Available647Open in IMG/M
3300015353|Ga0182179_1140806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum747Open in IMG/M
3300015353|Ga0182179_1259854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum561Open in IMG/M
3300015354|Ga0182167_1177204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum784Open in IMG/M
3300017412|Ga0182199_1051634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum844Open in IMG/M
3300017412|Ga0182199_1128320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum605Open in IMG/M
3300017412|Ga0182199_1156661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300017414|Ga0182195_1214027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300017432|Ga0182196_1038050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis814Open in IMG/M
3300017435|Ga0182194_1042724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum807Open in IMG/M
3300017439|Ga0182200_1094210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum612Open in IMG/M
3300017439|Ga0182200_1133972Not Available541Open in IMG/M
3300017692|Ga0182210_1147435All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum523Open in IMG/M
3300017693|Ga0182216_1093476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum712Open in IMG/M
3300017694|Ga0182211_1125969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae605Open in IMG/M
3300017694|Ga0182211_1180288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300025972|Ga0207668_10994114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum750Open in IMG/M
3300026088|Ga0207641_12346776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae533Open in IMG/M
3300026118|Ga0207675_100725204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1004Open in IMG/M
3300028049|Ga0268322_1031072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300028056|Ga0268330_1002351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1416Open in IMG/M
3300028056|Ga0268330_1020828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum739Open in IMG/M
3300028058|Ga0268332_1025015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum756Open in IMG/M
3300028062|Ga0268342_1025861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae607Open in IMG/M
3300028140|Ga0268334_1003821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum851Open in IMG/M
3300028142|Ga0268347_1022181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300028153|Ga0268320_1012168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum660Open in IMG/M
3300028262|Ga0268310_1007215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum946Open in IMG/M
3300028262|Ga0268310_1048465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae516Open in IMG/M
3300028466|Ga0268321_100824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1069Open in IMG/M
3300028469|Ga0268337_1019082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300028471|Ga0268323_1018864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae529Open in IMG/M
3300028526|Ga0268339_1003740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300028527|Ga0268335_1010409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum601Open in IMG/M
3300032502|Ga0214490_1146569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300032625|Ga0214501_1119424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum842Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere68.66%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere11.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.46%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated7.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.49%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028466Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028469Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028527Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070705_10114077833300005440Corn, Switchgrass And Miscanthus RhizosphereMEKEPEEFKMALNAKESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRARKPQSSFQV*
Ga0105249_1099437313300009553Switchgrass RhizosphereMETESEELKMGLDAQKSFAQMHEDRNMNKRIGGQMMQLDPVVAHESKKERRTRKPQSPFQE*
Ga0105136_10211713300009973Switchgrass AssociatedMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0105135_12541813300009980Switchgrass AssociatedMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVTQESRKERRTRKPQSPFQE*
Ga0105133_11320913300009981Switchgrass AssociatedMEKESEELKMGLDAQESFAQMHENRNMNKGIGGQMMQLDPVVTQESRKERRTRKPQSPFQE*
Ga0105133_11813613300009981Switchgrass AssociatedMEKKSEEFEMGLDVQKSFAQMLEDRNMNEGIGGQMMKLDPVVAQESKKERLAWKPQSSFQ
Ga0105131_10568913300009989Switchgrass AssociatedMEKESEKLKMGLDAQESFAQMHEDRNMNKKIGGQMMQLDLVVAQESRKERRTRNPQSPFQE*
Ga0105132_12142923300009990Switchgrass AssociatedMGLDAQKSFAQMHEDRNMNKRIGGQMMQLDPVVVQESRKERRTRKPQSPFQE*
Ga0105132_13783313300009990Switchgrass AssociatedMEKESEKLKMGLDAQESFTQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKSQSPFQE*
Ga0105120_103889623300009992Switchgrass AssociatedMEKESKEFKMGLDAQKSFTQMHEYRNMNKGIGGQMVKLDPVVAQEPREEKSTRKPQSPFQVRCKSNNSP
Ga0105139_102025313300009995Switchgrass AssociatedLWFQLEKKSKEFELGLDAQKCFAQMHEDRNMNEGIGGQMMMLDPVVAQESRKERRAWKP*
Ga0105139_112343913300009995Switchgrass AssociatedMEKVAEEFKMGLDAQKSFAYMHEDGNMDKGIWGQMMQLDPVVVQESRKERRARKPQSAFQV*
Ga0134125_1085784913300010371Terrestrial SoilMEKESKKLKMGLDAQERFAQMHEDRNMNKGIGGQMMQLDPVVVQESRKERTTKKPQSTFQE*
Ga0134126_1257380213300010396Terrestrial SoilKELKMGLDAQKSFAQMHEDRNVNKGIGGQGMQLYLIVAQESREERRTRKSQSSF*
Ga0134126_1285709313300010396Terrestrial SoilMLQMEKESEKLKMGLDAQESFAQIHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0134126_1298675013300010396Terrestrial SoilSEKLKMGLDPQESFTQMHKDRNMNKGIRGQMMQLDPIVAQESRKERRTRKPQSPFQE*
Ga0134127_1092516113300010399Terrestrial SoilMKKKAKELKMGLDAQESFAQIQEDRNMNKGIGGQKMQLDTVVAQESRKERRARKPQSAFQV*
Ga0134127_1120464713300010399Terrestrial SoilMEKESEKLKMGLDAQESFAQMHEDRNMNKRIEGQMMQLDPVVAQESRKERRTRKSQSPFQE*
Ga0134127_1237532013300010399Terrestrial SoilLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0134127_1280300713300010399Terrestrial SoilMEKKSEEFKMGLDAQKRFAQMHEDRNMNEGIGGQMMKLDPVVAQYSRKERRAWKP*
Ga0134121_1269499413300010401Terrestrial SoilKMGLDAQKSFAQMHEDRNMNKGIWGQMMQLDPVVAQEPRKERRTRKPQSSFQV*
Ga0134123_1060236613300010403Terrestrial SoilVGLRLQMEKVAEEFKMGLDALKSFAQMHEDRHMNKGIWGQMMQLDPVVAQESRKERRARKPQSSFQV*
Ga0163163_1255673913300014325Switchgrass RhizosphereGVGLRLQMETESEELKMGLDAQKSFAPMHEDRNMNKRIGGQMMQLDPVVVQESRKERRTRKPQSPFQE*
Ga0157380_1083133423300014326Switchgrass RhizosphereMEKELEKLKMGLDAQEGFAQMHENRNINKGIGGQMMQLDPVVAQESKKERRTRKPQSAFQE*
Ga0182183_105005713300015270Switchgrass PhyllosphereMEKESEKLEMGLDAQESFAQMHEYRNMNKGIGGQMMQLDPVVVQEPRKERRARKPQSPFQE*
Ga0182102_100375313300015273Switchgrass PhyllosphereMGLDAQESFVQMHEDRNMNKGIGGQMMQLDPIVAQESRKEKRTRKAQSSFQE*
Ga0182099_106032813300015278Switchgrass PhyllosphereMEKESEKLKMGLYAQESFTQMHKDRNMNKGIGGQMMQLDPVVARESRKERRTRKPQSPFQE*
Ga0182099_106262913300015278Switchgrass PhyllosphereMEKESKKLKMGLDAQESFTQMHENRNMNKRIGGQMMQLDPVVAQESRKERRARKPQSPFQE*
Ga0182100_106899813300015280Switchgrass PhyllosphereMEKESENLKIGLDDQESFAQMHEDRNMNKEIGGQMMQLDPVVAQEFRKERRTWKPQSPF*
Ga0182100_109274713300015280Switchgrass PhyllosphereMEKESEKLKMGLDAQENFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182101_102733813300015284Switchgrass PhyllosphereLEKKSKEFELGLDAQKCFAQMHEDRNMNEGIGGQMIKLDPVVMQESRKERRAWKPQSLFQEGGESNNFTRI
Ga0182101_104491823300015284Switchgrass PhyllosphereMLKFKLGCYIGVGLRLQMEKESEKLKMGLDAQESFAQMREDRNMNKRIRGQMMQLDPVVAQEPRKERTARKPQSLFQE*
Ga0182101_108457013300015284Switchgrass PhyllosphereMEKESEKLKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPVVAQESKKERRTRKPQSPF*
Ga0182105_101916923300015290Switchgrass PhyllosphereMEKKSEKLKMGLDAQKCFAQVHEDRNMNEGIGGQMMKLDPVVAQESRKERRAWKP*
Ga0182105_104354513300015290Switchgrass PhyllosphereMEKESEKLKMGLDAKESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQ
Ga0182103_104540913300015293Switchgrass PhyllosphereVGLSLQMEKESEKLKMGLDAQESFAQMNEDRNMNKEIGGQMMQLDHVVTQEPKKERSARKPQSPFQVRSKSNNFPRIFIRMI*
Ga0182103_104829113300015293Switchgrass PhyllosphereQMKKESEKLKMGLDAQESFTQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182184_103540913300015301Switchgrass PhyllosphereVGLRLQMEKESKKLEMGLDAPKSFAQMDEDRNMNKGIGGQMMQLDPVVVQEPRKERRARKPQSLFQE*
Ga0182180_102909113300015306Switchgrass PhyllosphereMEKESEKLEMGLDAPKSFAQMDEDRNMNKGIGGQMMQLDPVVVQEPRKERRARKPQSLFQE*
Ga0182180_106085713300015306Switchgrass PhyllosphereMEKESEKLKMGLDAHESFAQMHEDRNMNKGIGGQMIQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182098_110050813300015309Switchgrass PhyllosphereMEKESEKLKIGLDAQESFAQMHEDRNMNKEIRGQMMQLDLVVAQESRKERRTRKPQSPFQE*
Ga0182162_104547713300015310Switchgrass PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMKQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182182_102790013300015311Switchgrass PhyllosphereMEKESEKLKMGLNAQESFAQMHEDRNMNKWIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182182_107825913300015311Switchgrass PhyllosphereIGIWLRLKVKKESEEFKMGLDAQKSFAHMHENRNMNKGIGGQMMQLDPIVAQEPRKERRARKPQSSFQV*
Ga0182168_104225523300015312Switchgrass PhyllosphereMEKESEEFKMGLDAQKSFAQMHEDGNVNKVIGGQVMKLDPVVAQEPREERQIRKPQSPF*
Ga0182168_105707513300015312Switchgrass PhyllosphereMEKKLEELKIGLNAQKSFAQMHEDRHMNKGIRSQMVQLDPVVVQEPREERR
Ga0182168_108106013300015312Switchgrass PhyllosphereMKKESEKLKMGLDAQESFTQMHEDRNMNKGIGGQMMQLDPVVAQESRKERR
Ga0182164_104559123300015313Switchgrass PhyllosphereMKELKMELDAQKSFAQMHEDRNMNEGIGGQMMKLDPVVMQESRKERRAWKPQSSFQE
Ga0182164_110533723300015313Switchgrass PhyllosphereMEKVVEKFKMGLDAQKSFAHMHENRNMNKGIGGQMMQLDPVVAQEPKKERRARKPQSPF*
Ga0182164_111343613300015313Switchgrass PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDLVVAQEFRKERRTRKPQSPFQE*
Ga0182164_113143513300015313Switchgrass PhyllosphereMEKKSEELKMGLDAQKSFAQMQEDRNMNKGIGGQIMQLDPVVAQEPRKERRARKPQSSFQVRSESNDFPVFSYG*
Ga0182120_105849713300015315Switchgrass PhyllosphereMEKELEEFKMELDAQKSFAQMHEDGNVNKEIWGQMMNLDHVVSQEPREERRTRKPQSMF*
Ga0182120_108277613300015315Switchgrass PhyllosphereMEKESEKLKMGLDAQESFTQIHKDRNMNKGIRGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182120_112827813300015315Switchgrass PhyllosphereLEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVAAQEPRKERTARKPQSLFQE*
Ga0182121_107881913300015316Switchgrass PhyllosphereMEKVTEKFEMGLDAQKRFAQMHEDRNMNEGIGGQMMKLDPVVAQESRKERRACKP*
Ga0182121_108745513300015316Switchgrass PhyllosphereELKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDLIVAQDSRKERRTRKPQSPFQE*
Ga0182136_103016013300015317Switchgrass PhyllosphereMEKESEKLKMGLDAKESFAQMHEDRNMNKGIGGQIKQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182136_111483113300015317Switchgrass PhyllosphereMEKKAEEFEMGLDAQKHFAQVHEDRNMNKGIGGQMVQLDPVVAQEPRKERRARKPQSSLQV*
Ga0182181_102354213300015318Switchgrass PhyllosphereMEKESEKLKIGLDAQESFAQMHEDTNMNKGIRGQMMQLDPVVVQESRKERTTKKPQSTFQE*
Ga0182181_110104113300015318Switchgrass PhyllosphereLRFQIEKKSEEFEMELDAQKSFAQMHEDRNMNEGIGGQMMKLDPVVAQDSRKERRAWKP*
Ga0182181_110108823300015318Switchgrass PhyllosphereMEKIAEELKMGLDAQKSFAQMHEDRNMNKEIGGQMVQLDPVVAQEPRKERRAWKPQSPFQI*
Ga0182130_106533913300015319Switchgrass PhyllosphereMEKESEKLKIGLDAQESFAQMHEDRNMNKEIRGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182165_101506013300015320Switchgrass PhyllosphereMEKKLEEFKMGLDAQKCFAQMHEDRNMNEGIGGQMMKLDPIVAQESRKERRAWKP*
Ga0182165_104543213300015320Switchgrass PhyllosphereESEKLKMGLDAQESFAQIHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKSQSPFQE*
Ga0182165_113735713300015320Switchgrass PhyllosphereMEKKSEELKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPIVAQEPRKERRARKPQPSFQERGESNNFPRIFI*
Ga0182165_113968513300015320Switchgrass PhyllosphereMKKKAKELKMGLDAQKSFAKMHEDGNMDKGIWGQMMQLDHVVVQESRKERRARKPQSAFQV*
Ga0182166_103843813300015326Switchgrass PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGVQMTQLDPVVAQESRKERRTRKPQSQFPRMR*
Ga0182166_106367913300015326Switchgrass PhyllosphereMEKESEKLKMGLDAQESFTQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182166_112313313300015326Switchgrass PhyllosphereMKKELEKLKMGLDAQESFTQMHEDRNMNKRNGGQMMQLDLVVAQESRKERRTRKPQSSFQK*
Ga0182114_107670823300015327Switchgrass PhyllosphereMEKDSEKLKIGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQKSRKERRIRKPQSPFQE*
Ga0182114_107781413300015327Switchgrass PhyllosphereMEKKSEEFKMGLDAQKSFAQMHEDRNVNKGIGGQMMQLDPVVAQESRKKRRARKPQSSFQV*
Ga0182114_115927323300015327Switchgrass PhyllosphereMEYKLEEFKMGLDAQESFAQMHKDRNMNKGIGGQMMQLDPVLTQEPRKERRVRKPQSPFQE*
Ga0182153_105420813300015328Switchgrass PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKWIGGQMMQLDPVVAQESRKERRTRKPQSPLQE*
Ga0182135_107264813300015329Switchgrass PhyllosphereMEKISEEFKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQEFRKERRTRKPQSPFQE*
Ga0182152_104357013300015330Switchgrass PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKEIGGQMMQLDHVVTQEPKKERSARKPQSPFQVRSKSNNFPRIFIWMI*
Ga0182131_105603623300015331Switchgrass PhyllosphereMEKESEKLKMGLDAQKSFAHMHENRNMNKEIGGQMMQLDPVVAQEPRKERRARKPQSPFQ
Ga0182131_109255223300015331Switchgrass PhyllosphereVEKEPEELKMGFDAQKSFAQMHEDGNMNKGIWGQMMQLDPVVAQESRKERRARKPQSSFQV*
Ga0182131_111290213300015331Switchgrass PhyllosphereKSEEFKMGLDAQKCFAQVHEDRNMNKGIGGQVMKLDPVVAQESRKERRARKPQSSFQV*
Ga0182117_104280813300015332Switchgrass PhyllosphereMEKESEKLKMELDAQESFAQMHEDRNMNKGIGGQMMQLDPVIAQESRKERRTRKSQSPFQE*
Ga0182117_109560413300015332Switchgrass PhyllosphereGVGLRLQMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDLIVAQDSRKERRTRKPQSPFQE*
Ga0182117_116333913300015332Switchgrass PhyllosphereMEKIAEELKMGLNAQKSFAQMHEDRHMNKGIGSQMMQLDTVVAQESRKERRTRKPQFPFQE*
Ga0182117_116371313300015332Switchgrass PhyllosphereGKLKMGLDAQESFAQMHEDRNMSKGIGGQMMQLDPIVAQESKKERRTRKPQSPFQE*
Ga0182147_105402413300015333Switchgrass PhyllosphereMGLDAQESFTQMHEDKNMNKGIGGQMMQLDPVVAQEPRKGRTARKLQSPFQE
Ga0182147_108239413300015333Switchgrass PhyllosphereVGVGLRLQMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQDSRKERRTRKPQSPFQE*
Ga0182151_106386123300015337Switchgrass PhyllosphereMEKKSEEFEMGLDVQKSFAQMHEDRNMNEGIGGQMMKLDPVVAQDSRKERRAWKP*
Ga0182151_110884513300015337Switchgrass PhyllosphereMEKESEKLKMGLDGQESFAQRHEDRNINKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182137_110229113300015338Switchgrass PhyllosphereMLQMEKESEKLRMGLDAQESFAQIQEDRNMNKEIGCQMMQLDPIVTQEPRKDRRARKPQSPFQVRSKSNNFPRIFI
Ga0182137_110852713300015338Switchgrass PhyllosphereMEKESEELKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRNERRTRKPQSPFQE*
Ga0182149_108951913300015339Switchgrass PhyllosphereMEKKPEEFEMGLDAQKSFAQMHEDRNMNEEIGGQMMKLDPVVAQESRKERRAWKP*
Ga0182149_117498813300015339Switchgrass PhyllosphereMEKESKKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVVQESRKERRTRKPQSPFQE*
Ga0182133_105965713300015340Switchgrass PhyllosphereMEKKSEELEMGLDDQKYFVQMHEDRNMNEGIGGQMMKLDPVVAQESRKERRTRQPQSLFQE*
Ga0182133_115009213300015340Switchgrass PhyllosphereMEKESEELKMGLDAQESLAQMHEDRNMKKGIGGQMIQLDPVVAQEFRKERR
Ga0182115_111952413300015348Switchgrass PhyllosphereMEKKAEEFKIGLDAQKSFAQMHEDRNINKGIGGQMMQLDPVVAQEPRKERRARKPQSSFQI*
Ga0182185_101349813300015349Switchgrass PhyllosphereMEKIAEKLKMGLDAQKSFAQMYEDRNMNKGIGGQMVQLDHVVAQEPRKERRARKP
Ga0182185_113745613300015349Switchgrass PhyllosphereESEKLKMGLDAQESFAQMHEDRNMNKWIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182163_121686513300015350Switchgrass PhyllosphereMEKEAKEFKMGLDAQKSFAQVHEDRNMNKGIGGQVLKLDPVVAQEPREERRTRKPQSPFQ
Ga0182169_114257213300015352Switchgrass PhyllosphereVEKESKELKMGLDAQKSFAQMHKDGNVNKGIGGQVMKLDPVITQESREEKQTRKPQSSFQIRSKN
Ga0182169_118993313300015352Switchgrass PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMTQLDPVVAQESRKERRTRKPQSLFQE*
Ga0182169_120343313300015352Switchgrass PhyllosphereMEKESEKLKMGLDGQESLAQRHEDRNINKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE*
Ga0182179_114080613300015353Switchgrass PhyllosphereMEKVVEKFKMGLDAQKSFAHMHENRNMNKGIGGQMMQLDPVVAQEPRKERR
Ga0182179_125985413300015353Switchgrass PhyllosphereMGLDAQKSFAYMHEDGNMDKGIWGQMMQLDLVVVQESRKERRARKPQSSFQV*
Ga0182167_117720413300015354Switchgrass PhyllosphereMEKESEKLKMELDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTKKPQSTFQE*
Ga0182199_105163413300017412Switchgrass PhyllosphereMEKEAEEFKMGLDAQKSFAQMHEDRNVNKEIGGQVMKLDPVVAQESREEGRTRKPQSSFQIRCESNDFFRI
Ga0182199_112832013300017412Switchgrass PhyllosphereMEKESEKLKMGLDAQKSFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQ
Ga0182199_115666113300017412Switchgrass PhyllosphereMEKESEKLEMGLDAQESFTQMHEDRNMNKEIGGQMMQLDPIVTQEPRKDRRARKPQSPFQVRSKSNNFPVFSYR
Ga0182195_121402713300017414Switchgrass PhyllosphereLSLQMEKESEKFKMGLDAQESFAQMNEDRNMNKEIGGQMMQLDHVVTQEPKKERSARKPQSPFEVRSKSNNFPRIFIRMI
Ga0182196_103805023300017432Switchgrass PhyllosphereMGLDAQKSFAEMHEDGNMNKGIGGQVMKLDPVVAQESREEKRTRKPQSPFQIRCE
Ga0182194_104272413300017435Switchgrass PhyllosphereMEKKLEEFEMGLDAQKRFAQMHEDRNMNEXIGGQMMKLDPIVAQESRKERRAWKP
Ga0182200_109421013300017439Switchgrass PhyllosphereLQMEKESEKLKMGLDAQESFTQMHKDRNMNKGIGGQMMQLDPVVAQDSRKERRTRQPQSLFQE
Ga0182200_113397213300017439Switchgrass PhyllosphereMEKESEKLKMGLDGQESFAQRHEDRNINKGIGGQMMQLDPIVPQEPRKERRARKPQPSFQERGESNNFPRIFI
Ga0182210_114743513300017692Switchgrass PhyllosphereLEKESEKLKMGLDAQESFAQMHEDRYMNKGIWGQMMQLDPIVAQEPRKERRTRKPQSSFQ
Ga0182216_109347613300017693Switchgrass PhyllosphereVGLRLQMEKELEKLKMGLDAQESFAQMHENRNMNKGFGGQMMQLDPVVAQESRKERRTRKPQSPFQE
Ga0182211_112596923300017694Switchgrass PhyllosphereMEKKSEELEMGLDAQKRFVQMHEDRNMNEGIGGQMMKLDPVVAQDSRKERRAWKP
Ga0182211_118028813300017694Switchgrass PhyllosphereMEKKSEEFEMGLDAQKCFAQMYEDRNMNEGIGGQMIKLDSVVAQESRKERRACKP
Ga0207668_1099411413300025972Switchgrass RhizosphereEKESEKLKMVLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVAQESRKERRTRKPQSPFQE
Ga0207641_1234677613300026088Switchgrass RhizosphereLRFQMEKKSEEFKIGLDAQKSFAQMHEDRNMNEEIGGQMMKLDLVVAQESRKERRAWK
Ga0207675_10072520413300026118Switchgrass RhizosphereLKMGLHAQKSFAQMHEDRNMNKRIGGQMVQLDPVVAQEPRKERIARKPQSIF
Ga0268322_103107223300028049PhyllosphereMEKESEEFKMGLDAQKSFAQMHEDINVNKGIGGQVMKLDPVVAQESREEKXTREPQSSF
Ga0268330_100235123300028056PhyllosphereLRFQIENKSEEFEMELDAQKSFAQMHEDRNMNEGIGGQMIKLDPVVAQESRKERRACKP
Ga0268330_102082813300028056PhyllosphereMEKESEKLEMGLDAPKSFAQMDEDRNMNKGIGGQMMQLDPVVAQEPRKERRARKPQSPFQ
Ga0268332_102501513300028058PhyllosphereVEKESEEFKIGLDAQKSFAQMHEDGNVNKEIWGQMMNLDPVVSQEPREERRTRKPQSPFHIRCESNNF
Ga0268342_102586113300028062PhyllosphereMGLDAQKSFAYMHEDGNMDKGIWGQMMQLDPVVAQESRKERRARKPQS
Ga0268334_100382123300028140PhyllosphereMEKESKKLKMGLDAQESFAQMHEDRNMNKRIGGQMMQLDPVVAQESRKERRTRKPQSPFQ
Ga0268347_102218113300028142PhyllosphereLWFQLEKKSKEFELGLDAQKCFAQMHEDRNMNEGIGGQMMKLDPIVAQKSRKKRRAWKPQSSFQEGGES
Ga0268320_101216813300028153PhyllosphereLRLQIEKESEKLKMGLDAQEIFAQMHEDRNMNKEIGGQMMQLDPIVTQEPRKDRRARKPQSPFQVRSKSNN
Ga0268310_100721513300028262PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKRIEGQMMQLDPVVAQESRKERRTRKPQSQFQ
Ga0268310_104846513300028262PhyllosphereMEKESEEFKIGLDAQKSFAQMNEDRNVNKIIGGHVMKLDPVVALESKKERRTRKPQSSFQIRCESNDFPRIFI
Ga0268321_10082423300028466PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPIVAQESRKERRACKP
Ga0268337_101908213300028469PhyllosphereMEKESEKLKMGLDPQESFTQMHKDRNMNKGIRGQMMQLDPIVAQESRKERRTRKPQSPFQ
Ga0268323_101886413300028471PhyllosphereMEKESKKLKMGLDAQERFAQMHENRNMNKGIGGQMMQLDPVVAQESREERRTRKSQSSF
Ga0268339_100374013300028526PhyllosphereMEKESEKLEMGLDAPKSFAQMDEDRNMNKGIGGQMMQLDPVVAQEPRKERRARKPQSPFQEXGKSNNFPRI
Ga0268335_101040913300028527PhyllosphereMEKESEKLKMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVVQESRKERRTRKPQSPFQEXGESNNFP
Ga0214490_114656923300032502Switchgrass PhyllosphereMAKKSEEFEMGLDAQKSFAQMHEDRHMNKEIWGQMIKLDPEVVQEPRKERRARKPQSPFQVRCESNDSPVFSYG
Ga0214501_111942423300032625Switchgrass PhyllosphereMEKESEKLEMGLDAQESFAQMHEDRNMNKGIGGQMMQLDPVVVQESRKERRTRKPQSPFQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.