NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F059198

Metagenome Family F059198

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059198
Family Type Metagenome
Number of Sequences 134
Average Sequence Length 47 residues
Representative Sequence MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVENDGRVEFL
Number of Associated Samples 124
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.76 %
% of genes from short scaffolds (< 2000 bps) 90.30 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.448 % of family members)
Environment Ontology (ENVO) Unclassified
(29.851 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.582 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 42.86%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF13531SBP_bac_11 18.66
PF13343SBP_bac_6 17.16
PF09084NMT1 6.72
PF01177Asp_Glu_race 4.48
PF04909Amidohydro_2 3.73
PF01977UbiD 1.49
PF00557Peptidase_M24 1.49
PF12704MacB_PCD 0.75
PF13701DDE_Tnp_1_4 0.75
PF02371Transposase_20 0.75
PF14720NiFe_hyd_SSU_C 0.75
PF05145AbrB 0.75
PF02775TPP_enzyme_C 0.75
PF08378NERD 0.75
PF12838Fer4_7 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 6.72
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 6.72
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 1.49
COG3180Uncharacterized membrane protein AbrB, regulator of aidB expressionGeneral function prediction only [R] 0.75
COG3547TransposaseMobilome: prophages, transposons [X] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.76 %
UnclassifiedrootN/A2.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c1055952Not Available1898Open in IMG/M
3300000574|JGI1357J11328_10111837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300003319|soilL2_10096254All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300004022|Ga0055432_10188298All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300004463|Ga0063356_103298998All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300004779|Ga0062380_10196518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium813Open in IMG/M
3300005093|Ga0062594_102706381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300005174|Ga0066680_10686417All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005293|Ga0065715_10207498All Organisms → cellular organisms → Bacteria → Proteobacteria1330Open in IMG/M
3300005294|Ga0065705_10290802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1078Open in IMG/M
3300005454|Ga0066687_10467623All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300005468|Ga0070707_101504282All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005530|Ga0070679_101919876All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005586|Ga0066691_10679134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300005618|Ga0068864_101348705All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300005713|Ga0066905_102100788All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300006175|Ga0070712_101260609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium644Open in IMG/M
3300006196|Ga0075422_10439301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300006844|Ga0075428_102435683All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006852|Ga0075433_10548766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1016Open in IMG/M
3300006854|Ga0075425_100181641All Organisms → cellular organisms → Bacteria2416Open in IMG/M
3300006880|Ga0075429_100496066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1070Open in IMG/M
3300006894|Ga0079215_10024102All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300006904|Ga0075424_101480336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium721Open in IMG/M
3300006914|Ga0075436_101370074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300006918|Ga0079216_10944071All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300006969|Ga0075419_10240753All Organisms → cellular organisms → Bacteria → Proteobacteria1207Open in IMG/M
3300006969|Ga0075419_10873360All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300009094|Ga0111539_12327515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300009111|Ga0115026_11138612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300009147|Ga0114129_10509002All Organisms → cellular organisms → Bacteria → Proteobacteria1571Open in IMG/M
3300009147|Ga0114129_12493548Not Available618Open in IMG/M
3300009156|Ga0111538_10914515All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300009545|Ga0105237_11245828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300009553|Ga0105249_10509370All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1250Open in IMG/M
3300009610|Ga0105340_1348108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium655Open in IMG/M
3300010362|Ga0126377_10282707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1629Open in IMG/M
3300010362|Ga0126377_11059979All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300010362|Ga0126377_12062928All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300010376|Ga0126381_103799583All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium590Open in IMG/M
3300010399|Ga0134127_12804914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria567Open in IMG/M
3300010400|Ga0134122_10183487All Organisms → cellular organisms → Bacteria → Proteobacteria1724Open in IMG/M
3300010400|Ga0134122_10430391All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300010401|Ga0134121_11702373All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300011405|Ga0137340_1055126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium761Open in IMG/M
3300011409|Ga0137323_1005029All Organisms → cellular organisms → Bacteria → Proteobacteria3232Open in IMG/M
3300011416|Ga0137422_1085472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium756Open in IMG/M
3300012160|Ga0137349_1015812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1155Open in IMG/M
3300012174|Ga0137338_1108182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300012198|Ga0137364_10220143All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300012231|Ga0137465_1167953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300012356|Ga0137371_10007073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8725Open in IMG/M
3300012358|Ga0137368_10754629All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300012361|Ga0137360_10659513All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300012477|Ga0157336_1015522All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300012897|Ga0157285_10025709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1290Open in IMG/M
3300012923|Ga0137359_10402784All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300012929|Ga0137404_12239545All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012955|Ga0164298_10002894All Organisms → cellular organisms → Bacteria → Proteobacteria5702Open in IMG/M
3300012957|Ga0164303_11006652All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300012971|Ga0126369_12771509All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300012989|Ga0164305_11989081All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300013297|Ga0157378_11338488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300013308|Ga0157375_11910029All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300014267|Ga0075313_1178505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300014320|Ga0075342_1017729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1598Open in IMG/M
3300014876|Ga0180064_1116250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium566Open in IMG/M
3300015374|Ga0132255_104398900All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300017654|Ga0134069_1008645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2910Open in IMG/M
3300017659|Ga0134083_10081356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1258Open in IMG/M
3300018028|Ga0184608_10102900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1194Open in IMG/M
3300018032|Ga0187788_10156844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium860Open in IMG/M
3300018054|Ga0184621_10051699All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1374Open in IMG/M
3300018054|Ga0184621_10062457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1267Open in IMG/M
3300018066|Ga0184617_1087261All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300018075|Ga0184632_10039549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2026Open in IMG/M
3300018429|Ga0190272_10253478Not Available1323Open in IMG/M
3300018429|Ga0190272_10399783All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300018469|Ga0190270_11133855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300019356|Ga0173481_10109156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1078Open in IMG/M
3300019789|Ga0137408_1271043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1570Open in IMG/M
3300019886|Ga0193727_1062763All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300020006|Ga0193735_1089750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium869Open in IMG/M
3300020061|Ga0193716_1045586All Organisms → cellular organisms → Bacteria2069Open in IMG/M
3300021432|Ga0210384_10372636All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300021560|Ga0126371_10418068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1484Open in IMG/M
3300021560|Ga0126371_10916669All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300025324|Ga0209640_10797892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300025580|Ga0210138_1040566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1051Open in IMG/M
3300025796|Ga0210113_1095352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300025905|Ga0207685_10309917All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300025914|Ga0207671_11107821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300025933|Ga0207706_10592748All Organisms → cellular organisms → Bacteria → Proteobacteria952Open in IMG/M
3300025935|Ga0207709_10835393All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300025959|Ga0210116_1098209All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300025961|Ga0207712_10568288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium977Open in IMG/M
3300025986|Ga0207658_10452800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1136Open in IMG/M
3300026067|Ga0207678_11907714All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300026315|Ga0209686_1167280All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300026317|Ga0209154_1239084All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300026327|Ga0209266_1039952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2399Open in IMG/M
3300026329|Ga0209375_1032155All Organisms → cellular organisms → Bacteria2814Open in IMG/M
3300026536|Ga0209058_1077311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1761Open in IMG/M
3300026547|Ga0209156_10133681All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300026550|Ga0209474_10160226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1459Open in IMG/M
3300027840|Ga0209683_10378621All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300027886|Ga0209486_10640784All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300027909|Ga0209382_10904814All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium929Open in IMG/M
3300028379|Ga0268266_10341993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1405Open in IMG/M
3300031231|Ga0170824_102396450All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031446|Ga0170820_15033410All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300031474|Ga0170818_101013424All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031547|Ga0310887_10920872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300031573|Ga0310915_10959404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300031720|Ga0307469_10235510All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300031720|Ga0307469_12442238All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031740|Ga0307468_100134144All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300031908|Ga0310900_10324909All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300031908|Ga0310900_11348314All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300031912|Ga0306921_10180447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2475Open in IMG/M
3300031941|Ga0310912_10587852All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300032002|Ga0307416_102623038All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300032005|Ga0307411_10259383All Organisms → cellular organisms → Bacteria1372Open in IMG/M
3300032013|Ga0310906_10443820All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300032075|Ga0310890_10555853All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300032157|Ga0315912_10032855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4176Open in IMG/M
3300032180|Ga0307471_102106019All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300033158|Ga0335077_10621716All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300033412|Ga0310810_11462912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300033414|Ga0316619_10079900All Organisms → cellular organisms → Bacteria2005Open in IMG/M
3300033433|Ga0326726_11547102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300033481|Ga0316600_10512726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium833Open in IMG/M
3300034090|Ga0326723_0294412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300034417|Ga0364941_154846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.46%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.22%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.73%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.24%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.24%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.49%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.49%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.49%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.49%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.75%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.75%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_105595212228664021SoilMANIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVEDSGKVEFLLGAHHTGFKADASELQGQ
JGI1357J11328_1011183713300000574GroundwaterMAKIRAVVVEGDRQQGYKRVQVLFGANSFIEITDAAGRVNLLVGAHDRGFT
soilL2_1009625413300003319Sugarcane Root And Bulk SoilMAKIRSVVVEGSRESGFRRVQVLFGTNYFVEIVDRDGKVDFTLGAHHTGFKADASD
Ga0055432_1018829823300004022Natural And Restored WetlandsMAKIRAVVVEGDRSSGYRRVQVLFGTNSFIEITDDAGQINLLLGAHDRGVK
Ga0063356_10329899823300004463Arabidopsis Thaliana RhizosphereMAKIRSVVVEGTRETGYKRVQVLFGTNYFLEIVEDAGRVELLLGAHHTGFKADASELQGE
Ga0062380_1019651823300004779Wetland SedimentMAKIRAVVVEGDRERGYERVQVLFGTNSFIEITENDGRVMCLLGAHAGGVEVDGSE
Ga0062594_10270638113300005093SoilMAKIRGVVVEGDRQHGYKRVQVLFGTNSFIEITENDGRVMC
Ga0066680_1068641713300005174SoilMAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVS
Ga0065715_1020749833300005293Miscanthus RhizosphereMAKIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVENQGRVDFLLGAHHTGFKADASE
Ga0065705_1029080213300005294Switchgrass RhizosphereMAKIRGVVVEGDRQTGYNRVQVLFGTNSFIEITENDGRVMCLLGAHAGGVQAEASDS
Ga0066687_1046762313300005454SoilMAKIRSVVVEGNREHGYRTVQVLFGQFFLEITESDGRVSFLL
Ga0070707_10150428213300005468Corn, Switchgrass And Miscanthus RhizosphereMAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDEGGQVNFLLGSHHEAFKADASEVKGD
Ga0070679_10191987623300005530Corn RhizosphereMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENEGRVNFLLGAHHTGFKADASEL
Ga0066691_1067913423300005586SoilMAKIRAVVAEGDRERGYKRIQVLFGTNSFIEITENDGKVMCLLGARDGGIQADAS
Ga0068864_10134870523300005618Switchgrass RhizosphereMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENEGRVNFLLGAHHTG
Ga0066905_10210078813300005713Tropical Forest SoilMAKIRSVVVEGDREHGYKRVQVLFGVNYFLEITEE
Ga0070712_10126060923300006175Corn, Switchgrass And Miscanthus RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSE
Ga0075422_1043930123300006196Populus RhizosphereMAKIRAVVVEGNRESGYKRVHVLFGTNSFVEITEN
Ga0075428_10243568323300006844Populus RhizosphereMAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDG
Ga0075433_1054876623300006852Populus RhizosphereMAKIRAVVVEGNRESGYKRVHVLFGTNSFVEITENDGRV
Ga0075425_10018164133300006854Populus RhizosphereMAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADG
Ga0075429_10049606633300006880Populus RhizosphereMAKIRAVVTEGDRQHGYKRVQVLFGTNYFLEIVENDG
Ga0079215_1002410233300006894Agricultural SoilMAKIRSVVVEGERQSGYKRVQVLFGTNYFLEIVENDGKVEFLL
Ga0075424_10148033613300006904Populus RhizosphereMAKIRAVVVEGDRERGYKRIQVLFGTNSFIEITENDGKVMC
Ga0075436_10137007423300006914Populus RhizosphereMAKIRAVVVEGDRERGYRRVQVLFGTNSFVEITEQEGRVLCLLGAHDGGVQADGSE
Ga0079216_1094407113300006918Agricultural SoilMAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRVEFL
Ga0075419_1024075313300006969Populus RhizosphereMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVD
Ga0075419_1087336013300006969Populus RhizosphereMAKIRAVVTEGDRQHGYKRVQVLFGTNYFLEIVENDGRVEFLL
Ga0111539_1232751533300009094Populus RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGR
Ga0115026_1113861213300009111WetlandMAKIRSVVVEGDRQRGYKRVQILFGVNSFIEITENDGRVMCLLG
Ga0114129_1050900213300009147Populus RhizosphereMAKIRAVIVEGNRESGYQLVQVLFGTNAFVEITERT
Ga0114129_1249354823300009147Populus RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLG
Ga0111538_1091451513300009156Populus RhizosphereMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADASELNGQLQK
Ga0105237_1124582823300009545Corn RhizosphereMAKIRAVIVEGNRESGYERVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSEAN
Ga0105249_1050937013300009553Switchgrass RhizosphereMAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITENEGRVL
Ga0105340_134810813300009610SoilMAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDD
Ga0126377_1028270733300010362Tropical Forest SoilMAKIRAVVVEGDRERGYKRVQVLFGTNSFIEITENDGRVLCLLGA
Ga0126377_1105997923300010362Tropical Forest SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADATELNGQ
Ga0126377_1206292823300010362Tropical Forest SoilMAKIRSVVVEGNREHGYKRVQVLFGVNYFLEITEDGDRVSFLLGNHHEAFK
Ga0126381_10379958313300010376Tropical Forest SoilMAKIRSVVVEGDREHGYKRVQVLFGVNYFLEITEENDCVTFLLGNHHEAFK
Ga0134127_1280491423300010399Terrestrial SoilMAKIRSVVVEGNREQGYKRVQVLFGTDCFLEITDQQGRIEFLLGSHHEAFK
Ga0134122_1018348713300010400Terrestrial SoilMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLGTHDGGVQADGSE
Ga0134122_1043039113300010400Terrestrial SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDF
Ga0134121_1170237313300010401Terrestrial SoilMAKIRSVVVEGNRESGYKRVQVLFGTNYFIEIVDNDGR
Ga0137340_105512613300011405SoilMAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDDGGN
Ga0137323_100502953300011409SoilMAKIRAVVVEGDRSSGYRRVQVLFGTNSFIEITDHAGQINLLVGAHDRGVKLDGSEAH
Ga0137422_108547223300011416SoilMAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDDGGNVSFLLGSHHE
Ga0137349_101581223300012160SoilMAKIRAVVVEGDRQNGYKRVQIIFGTNSFIEITENDGRVTCLLGAHDGGVQADGSE
Ga0137338_110818223300012174SoilMAKIRAVVVEGDRERGYKRVQVLFGTNYFLEIDEHDGRVSFLLGAHHEAFKA
Ga0137364_1022014313300012198Vadose Zone SoilMAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFLLGAIMKPSRRML
Ga0137465_116795323300012231SoilMAKIRAVVVEGDRQHGYKRVQIIFGTNSFIEITENDGRVTCLLGAHDGGVQ
Ga0137371_1000707343300012356Vadose Zone SoilMAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFLLGAIMKPSRRMLRKQRES
Ga0137368_1075462913300012358Vadose Zone SoilMAKIRAVVVEGDRERGYKRVQVLFGANSFVEITEND
Ga0137360_1065951313300012361Vadose Zone SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVENDGRVEFL
Ga0157336_101552213300012477Arabidopsis RhizosphereMAKIRSVVVEGDRQNGYRRVQVLFGTNYFLEIVENDGHVDFLLG
Ga0157285_1002570923300012897SoilMAKIRAVIVEGNRESGYERVQVLFGTNSFVEITEK
Ga0137359_1040278413300012923Vadose Zone SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEND
Ga0137404_1223954523300012929Vadose Zone SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVEN
Ga0164298_1000289423300012955SoilMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLGTHDGGVQAHGS*
Ga0164303_1100665213300012957SoilMAKIRSVVVEGNRESGYKRVQVLFGTNYFIEIVDNDGRVEFL
Ga0126369_1277150913300012971Tropical Forest SoilMAKIRSVVVEGDREHGYKRVQVLFGVNYFLEITEENDSVTFLL
Ga0164305_1198908123300012989SoilMAKIRSVVVEGNRESGYKRVQVLFGTNYFIEIVDNDGRVEFLLGA
Ga0157378_1133848813300013297Miscanthus RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDG
Ga0157375_1191002913300013308Miscanthus RhizosphereMAKIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVENQG
Ga0075313_117850513300014267Natural And Restored WetlandsMAKIRAVVVEGDREHGYKRVQILFGTNYFAEIVDDGGRVSFLL
Ga0075342_101772913300014320Natural And Restored WetlandsMAKIRAVVVEGDREQGYKRVQILFGTNYFVEIVDDGGRVSF
Ga0180064_111625013300014876SoilMAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDDGGNVSFLLGSHHEAFKADA
Ga0132255_10439890013300015374Arabidopsis RhizosphereMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHTGFKADASEREGE
Ga0134069_100864543300017654Grasslands SoilMAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITES
Ga0134083_1008135623300017659Grasslands SoilMAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFKRMLRKQRES
Ga0184608_1010290013300018028Groundwater SedimentMAKIRAVVVEGDRERGYKRVQVLFGTNSFVEITENDGR
Ga0187788_1015684413300018032Tropical PeatlandMAKIRAVVLEGDRQTGYKRVQILFGTNSFVEITENDGRVKCLLGAHDGGVQA
Ga0184621_1005169913300018054Groundwater SedimentMAKIRAVIVEGDRERGYKRVQVLFGTNSFVEITEND
Ga0184621_1006245713300018054Groundwater SedimentMAKIRAVVVEGDRERGYKRVQVLFGTNSFVEITENEGRVMCLLGTHDGGVEVDGSVANGQFAQ
Ga0184617_108726113300018066Groundwater SedimentMAKIRSVVVEGDRQSGYQRVQVLFGTNYFLEIVENQGRV
Ga0184632_1003954933300018075Groundwater SedimentMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRV
Ga0190272_1025347813300018429SoilMANIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGRVDFLLGAHHT
Ga0190272_1039978313300018429SoilMAKIRAVVVEGDRERGYKRVQVIFGTNSFIEITENDGRVMC
Ga0190270_1113385513300018469SoilMAKIRAVVVEGDRQNGYKRVQIIFGTNSFIEITENDGRV
Ga0173481_1010915613300019356SoilMAKIRAVIVEGNRESGYERVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSEANG
Ga0137408_127104343300019789Vadose Zone SoilMAKIRAVVIEGDRQRGYKRVQVLFGTNSFVEITENDGRVMCLLGT
Ga0193727_106276313300019886SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHT
Ga0193735_108975013300020006SoilMAKIRAVVVEGDRERGYKRIQVLFGTNSFIEITENDGKVMCLLGARDGGIQADASTA
Ga0193716_104558633300020061SoilMAKIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVENEGRVDFLLGAHHTGFNADASEL
Ga0210384_1037263613300021432SoilMAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDDGGQVSFLLGSHHEAFKADASE
Ga0126371_1041806833300021560Tropical Forest SoilMAKIRAVVVEGNRETGYKRVQVLFGTNSFVEITEDDGQVLCLLGAHD
Ga0126371_1091666923300021560Tropical Forest SoilMAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDDGGRVEFLLGAHHEAFKADASEAKG
Ga0209640_1079789223300025324SoilMAKIRAVVVEGDREHGYRRVQVLFGTNYFVEIVDNDGKISFLLGAHHE
Ga0210138_104056623300025580Natural And Restored WetlandsMAKIRAVVVEGDRSSGYRRVQVLFGTNSFIEITDDAGQINLLLGAHDRGVKVDGSE
Ga0210113_109535223300025796Natural And Restored WetlandsMAKIRAVVVEGDQERGYRRVQVLFGTNYFLEISDNDGKISFVLGARDEAFKAD
Ga0207685_1030991713300025905Corn, Switchgrass And Miscanthus RhizosphereMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENEGHVDF
Ga0207671_1110782123300025914Corn RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIHADGSE
Ga0207706_1059274833300025933Corn RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENEGRVLCLLGTHDG
Ga0207709_1083539313300025935Miscanthus RhizosphereMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHTGFKADASEREGELQ
Ga0210116_109820913300025959Natural And Restored WetlandsMANIRAVVVEGDRERGYKRVQILFGTNYFAEIIDDGGRVSFLLGSHHEAFKAD
Ga0207712_1056828813300025961Switchgrass RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENEGRVL
Ga0207658_1045280023300025986Switchgrass RhizosphereMAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITEKDG
Ga0207678_1190771423300026067Corn RhizosphereMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLGTHDGGV
Ga0209686_116728023300026315SoilMAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVSFL
Ga0209154_123908413300026317SoilMAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFKADASEAKG
Ga0209266_103995243300026327SoilMAKIRSVVVEGNREHGYKTVQVLFGTNFFLEISESDGRVSFLLGAHHEAFKADASEAKGE
Ga0209375_103215553300026329SoilMAKIRSVVVEGNREDGYRTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFK
Ga0209058_107731113300026536SoilMAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFKADASEA
Ga0209156_1013368113300026547SoilMAKIRSVVVEGNREHGYKTVQVLFGTNFFLEISESDGRVSFLLGAHHE
Ga0209474_1016022633300026550SoilMAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFL
Ga0209683_1037862113300027840Wetland SedimentMAKIRAVVVEGDRERGYERVQVLFGTNSFIEITENDGRVMCLLGAHAGGVEVDGSEARGQ
Ga0209486_1064078423300027886Agricultural SoilMAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRV
Ga0209382_1090481413300027909Populus RhizosphereMAKIRAVIVEGNRESGYQRVQVLFGTNAFVEITEKDGRVLC
Ga0268266_1034199333300028379Switchgrass RhizosphereMAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSEAN
Ga0170824_10239645023300031231Forest SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDG
Ga0170820_1503341013300031446Forest SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGA
Ga0170818_10101342423300031474Forest SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLG
Ga0310887_1092087213300031547SoilMAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITEND
Ga0310915_1095940413300031573SoilMAKIRAVVVEGNRETGYKRVQVLFGTNSFVEISEADGQVLCLLGAHDGGVQADGSEANSRFA
Ga0307469_1023551033300031720Hardwood Forest SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHT
Ga0307469_1244223823300031720Hardwood Forest SoilMAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDDGGQVSFLLGSHHEAFKADASEAQGA
Ga0307468_10013414413300031740Hardwood Forest SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKANASELNGQLQ
Ga0310900_1032490933300031908SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADAS
Ga0310900_1134831413300031908SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHTGF
Ga0306921_1018044733300031912SoilMAKIRAVVVEGNRERGYKRVQVLFGTNSFVEITEHEVA
Ga0310912_1058785223300031941SoilMAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADASELNG
Ga0307416_10262303823300032002RhizosphereMAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRVEFLLGAHHTGFKADASEPNGE
Ga0307411_1025938333300032005RhizosphereMAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRVEF
Ga0310906_1044382013300032013SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAH
Ga0310890_1055585313300032075SoilMAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGTHH
Ga0315912_1003285513300032157SoilMAKIRGVVVEGDRQHGYKRVQVLFGTNSFIEITEN
Ga0307471_10210601913300032180Hardwood Forest SoilMAKIRAVVVEGDRERGYKRVHVLFGTNYFLEIVENDGRVEFLLGAHHTGFKADASELNGQLQK
Ga0335077_1062171633300033158SoilMAKIRSVIVEGNREQGFKRVQVLFGTDYFLEIIDDG
Ga0310810_1146291213300033412SoilMAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITENDGR
Ga0316619_1007990033300033414SoilMAKIRSVVVEGDRQRGYKRVQILFGVNSFIEITENDGRVMCLLGSHAGGVHADRS
Ga0326726_1154710223300033433Peat SoilMAKIRAVVVEGDRQQGYKRVQVLFGANSFIEITDEAGRVKLLVGAHDRGFTVD
Ga0316600_1051272613300033481SoilMAKIRSVVVEGDRQRGYKRVQILFGVNSFIEITENDG
Ga0326723_0294412_576_7283300034090Peat SoilMVKIRGVVVEGDRQRGYKRVQILFGVNSFIEITENDGRVMCLLGSHAGGVH
Ga0364941_154846_2_1243300034417SedimentMAKIRAVVVEGDRQNGYKRVQIIFGTNSFIEITENDGRVTC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.