NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059200

Metagenome / Metatranscriptome Family F059200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059200
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 42 residues
Representative Sequence GKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Number of Associated Samples 95
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.75 %
% of genes near scaffold ends (potentially truncated) 98.51 %
% of genes from short scaffolds (< 2000 bps) 94.03 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.403 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.343 % of family members)
Environment Ontology (ENVO) Unclassified
(44.030 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.478 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 19.72%    Coil/Unstructured: 80.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF04392ABC_sub_bind 14.93
PF03401TctC 3.73
PF04909Amidohydro_2 2.99
PF09837DUF2064 2.24
PF05935Arylsulfotrans 2.24
PF00355Rieske 1.49
PF10282Lactonase 1.49
PF07690MFS_1 1.49
PF03466LysR_substrate 1.49
PF00120Gln-synt_C 0.75
PF01152Bac_globin 0.75
PF04199Cyclase 0.75
PF01436NHL 0.75
PF02615Ldh_2 0.75
PF00596Aldolase_II 0.75
PF13570PQQ_3 0.75
PF07238PilZ 0.75
PF028262-Hacid_dh_C 0.75
PF01315Ald_Xan_dh_C 0.75
PF13683rve_3 0.75
PF00753Lactamase_B 0.75
PF02738MoCoBD_1 0.75
PF08241Methyltransf_11 0.75
PF12850Metallophos_2 0.75
PF07883Cupin_2 0.75
PF12974Phosphonate-bd 0.75
PF01068DNA_ligase_A_M 0.75
PF13343SBP_bac_6 0.75
PF13193AMP-binding_C 0.75
PF00849PseudoU_synth_2 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 14.93
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 3.73
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 0.75
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 0.75
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.75
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.75
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.75
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 0.75
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.40 %
UnclassifiedrootN/A30.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig174338Not Available615Open in IMG/M
3300004633|Ga0066395_10190914All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300005332|Ga0066388_101111878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1339Open in IMG/M
3300005332|Ga0066388_107388753Not Available552Open in IMG/M
3300005332|Ga0066388_108088656All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005332|Ga0066388_108251225Not Available520Open in IMG/M
3300005434|Ga0070709_10900469All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300005436|Ga0070713_100871224All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005554|Ga0066661_10245861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1107Open in IMG/M
3300005713|Ga0066905_100968747Not Available748Open in IMG/M
3300005764|Ga0066903_101509109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1269Open in IMG/M
3300005764|Ga0066903_102172926All Organisms → cellular organisms → Bacteria → Proteobacteria1070Open in IMG/M
3300005764|Ga0066903_102823085Not Available942Open in IMG/M
3300005764|Ga0066903_103977327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium793Open in IMG/M
3300005764|Ga0066903_104730322All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005764|Ga0066903_105162120All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005764|Ga0066903_105627507Not Available659Open in IMG/M
3300005764|Ga0066903_106318222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300006175|Ga0070712_101249404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300009137|Ga0066709_104016065Not Available535Open in IMG/M
3300009162|Ga0075423_12177090All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300009792|Ga0126374_10035236All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300009792|Ga0126374_11654407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300010043|Ga0126380_11479403Not Available600Open in IMG/M
3300010048|Ga0126373_11666720Not Available702Open in IMG/M
3300010154|Ga0127503_10122537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300010358|Ga0126370_10568467Not Available972Open in IMG/M
3300010359|Ga0126376_10343812All Organisms → cellular organisms → Bacteria → Proteobacteria1319Open in IMG/M
3300010360|Ga0126372_10266415Not Available1481Open in IMG/M
3300010360|Ga0126372_10279064All Organisms → cellular organisms → Bacteria → Proteobacteria1454Open in IMG/M
3300010360|Ga0126372_12030991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300010361|Ga0126378_10287309All Organisms → cellular organisms → Bacteria → Proteobacteria1745Open in IMG/M
3300010361|Ga0126378_11494332Not Available766Open in IMG/M
3300010362|Ga0126377_12248631Not Available621Open in IMG/M
3300010362|Ga0126377_12568518Not Available585Open in IMG/M
3300010366|Ga0126379_10576992All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300010376|Ga0126381_102417558All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300010397|Ga0134124_12256931Not Available584Open in IMG/M
3300010398|Ga0126383_11081104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860891Open in IMG/M
3300010398|Ga0126383_11561279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300010860|Ga0126351_1106389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300011271|Ga0137393_10971270All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300012202|Ga0137363_10005465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7840Open in IMG/M
3300012209|Ga0137379_10524539Not Available1092Open in IMG/M
3300012469|Ga0150984_111807239Not Available511Open in IMG/M
3300012924|Ga0137413_10168130All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300012930|Ga0137407_10376721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1311Open in IMG/M
3300012944|Ga0137410_11024625Not Available704Open in IMG/M
3300012944|Ga0137410_11577142Not Available575Open in IMG/M
3300012960|Ga0164301_11007903Not Available655Open in IMG/M
3300012961|Ga0164302_11249725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae597Open in IMG/M
3300012971|Ga0126369_10323884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium altum1552Open in IMG/M
3300012971|Ga0126369_11798601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria701Open in IMG/M
3300012971|Ga0126369_11924284Not Available680Open in IMG/M
3300012984|Ga0164309_10926822Not Available712Open in IMG/M
3300014489|Ga0182018_10732685All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300014883|Ga0180086_1074095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300015371|Ga0132258_11856946Not Available1518Open in IMG/M
3300016270|Ga0182036_10493018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria969Open in IMG/M
3300016270|Ga0182036_10806827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria765Open in IMG/M
3300016341|Ga0182035_10031297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3439Open in IMG/M
3300016341|Ga0182035_11916484Not Available538Open in IMG/M
3300016357|Ga0182032_11776478All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300016357|Ga0182032_11813967All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300016371|Ga0182034_10143415All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300016371|Ga0182034_11362176Not Available620Open in IMG/M
3300016387|Ga0182040_10841352All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300016387|Ga0182040_11482735All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300016387|Ga0182040_11936630Not Available506Open in IMG/M
3300017955|Ga0187817_10714615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales639Open in IMG/M
3300017975|Ga0187782_10613047All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300020199|Ga0179592_10091572All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300020580|Ga0210403_10019273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5449Open in IMG/M
3300021170|Ga0210400_11277611All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300021377|Ga0213874_10055818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1225Open in IMG/M
3300021432|Ga0210384_11719997Not Available533Open in IMG/M
3300021560|Ga0126371_12662154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300021861|Ga0213853_10739747All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300021861|Ga0213853_10863525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria596Open in IMG/M
3300025905|Ga0207685_10846716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7506Open in IMG/M
3300025929|Ga0207664_10477947All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300026067|Ga0207678_10306767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601364Open in IMG/M
3300026355|Ga0257149_1002920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1907Open in IMG/M
3300027903|Ga0209488_10520740All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300029990|Ga0311336_10895116Not Available768Open in IMG/M
3300031543|Ga0318516_10587240All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300031545|Ga0318541_10019845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3202Open in IMG/M
3300031546|Ga0318538_10436874All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300031561|Ga0318528_10467317All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031573|Ga0310915_10390634All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300031573|Ga0310915_10805808All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300031640|Ga0318555_10414992All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300031680|Ga0318574_10027295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2852Open in IMG/M
3300031682|Ga0318560_10317728All Organisms → cellular organisms → Bacteria → Proteobacteria840Open in IMG/M
3300031682|Ga0318560_10422086Not Available722Open in IMG/M
3300031708|Ga0310686_106827128Not Available1430Open in IMG/M
3300031719|Ga0306917_10730425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7777Open in IMG/M
3300031724|Ga0318500_10529043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi594Open in IMG/M
3300031744|Ga0306918_10232106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1402Open in IMG/M
3300031763|Ga0318537_10337006All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031771|Ga0318546_10292334All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300031779|Ga0318566_10517921Not Available583Open in IMG/M
3300031792|Ga0318529_10016653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2862Open in IMG/M
3300031792|Ga0318529_10374339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7663Open in IMG/M
3300031793|Ga0318548_10665069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031795|Ga0318557_10245295All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031859|Ga0318527_10162979All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300031859|Ga0318527_10500431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales518Open in IMG/M
3300031880|Ga0318544_10431178All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300031890|Ga0306925_12004175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae546Open in IMG/M
3300031893|Ga0318536_10140394All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300031893|Ga0318536_10644515Not Available528Open in IMG/M
3300031897|Ga0318520_10510955Not Available742Open in IMG/M
3300031910|Ga0306923_10995165All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300031910|Ga0306923_11227732All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300031912|Ga0306921_10893343All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300031912|Ga0306921_11138323All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300031912|Ga0306921_11628994Not Available700Open in IMG/M
3300031941|Ga0310912_10889340Not Available686Open in IMG/M
3300031941|Ga0310912_11410950Not Available526Open in IMG/M
3300031941|Ga0310912_11505211Not Available506Open in IMG/M
3300031942|Ga0310916_11245620Not Available614Open in IMG/M
3300031954|Ga0306926_10148842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602898Open in IMG/M
3300031954|Ga0306926_11397223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales812Open in IMG/M
3300031959|Ga0318530_10374760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300032039|Ga0318559_10571891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300032052|Ga0318506_10440177Not Available578Open in IMG/M
3300032065|Ga0318513_10557026All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300032067|Ga0318524_10642925Not Available559Open in IMG/M
3300032068|Ga0318553_10342957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7782Open in IMG/M
3300032068|Ga0318553_10436713Not Available686Open in IMG/M
3300032090|Ga0318518_10271811All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300033289|Ga0310914_10711231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales900Open in IMG/M
3300033289|Ga0310914_10869960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium800Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.34%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil15.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.45%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.99%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.75%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.75%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.75%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_009416702140918007SoilGKVTAFIPTPSAEATPEGVGFDDAGNVFGSWTGKMMVRRWTKN
Ga0066395_1019091423300004633Tropical Forest SoilKDGKVTAFIPEPSAEAGAPEGVGVDDAGNVYGSWTGKMAVRRFTKS*
Ga0066388_10111187833300005332Tropical Forest SoilKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVRQ*
Ga0066388_10738875313300005332Tropical Forest SoilGSAKDGRVTAFIPTPSAEIATLEGVGFDDAGNVFGSWTGKMVVRRWTKN*
Ga0066388_10808865633300005332Tropical Forest SoilKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYARQ*
Ga0066388_10825122523300005332Tropical Forest SoilKDGKVTAFIPEPSAEIGSPEGIGVDDAGTVYAGWTGKMAVRRFVKQ*
Ga0070709_1090046933300005434Corn, Switchgrass And Miscanthus RhizosphereDGKVTAFIPEPSAEAGAPEGVGVDDTGNVYGGWVAKMAVRQFVKE*
Ga0070713_10087122423300005436Corn, Switchgrass And Miscanthus RhizosphereKVTAFIPEASAEAQAPEGVGVDDAGNVYGGWTGKMAVRRFVKG*
Ga0066661_1024586123300005554SoilIGSAKDGKVIAFIPQLSAEVGSPEGVGVDDAGNVYAGWVAKTAVRRFVKQ*
Ga0066905_10096874733300005713Tropical Forest SoilGKVTAFIPEPSVEAGAPEGVGTDDAGNVYAGWTAKMAVRRYVKQ*
Ga0066903_10150910933300005764Tropical Forest SoilPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK*
Ga0066903_10217292633300005764Tropical Forest SoilIGSAKDGKVNAFIPLTSTEIAAPEGVGVDETGNVYGGWTGKMAARRWNKS*
Ga0066903_10282308533300005764Tropical Forest SoilIPTPSAEATPEGVGFDDAGNVFGSWTGKMMVRRWTKN*
Ga0066903_10397732713300005764Tropical Forest SoilFIPTPNADIATPEGVGFDDAGNVYGGWTGKMAVRRWTKN*
Ga0066903_10473032213300005764Tropical Forest SoilPEPSVEAGAPEGVGVDDAGNIYAGWTAKMAVRRYVK*
Ga0066903_10516212023300005764Tropical Forest SoilFIPATSPETGSPEGVGVDDAGNVYGGWVAKMAVRRFVKQ*
Ga0066903_10562750713300005764Tropical Forest SoilPEPSVEAGAPEGVGVDDAGNVYASWTAKMAVRRYVKQ*
Ga0066903_10631822213300005764Tropical Forest SoilPSAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS*
Ga0070712_10124940413300006175Corn, Switchgrass And Miscanthus RhizosphereAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ*
Ga0066709_10401606513300009137Grasslands SoilSVKDGKVAAFIPEPSTEMGAPEGIGVDDAGTVYAGWTGKMNFRRFVKQ*
Ga0075423_1217709023300009162Populus RhizosphereSVKDGKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVK*
Ga0126374_1003523643300009792Tropical Forest SoilSVKDGKITAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK*
Ga0126374_1165440723300009792Tropical Forest SoilIPEPSAEASAPEGVGTDDAGNVYAGWTAKMAVRRYVKQ*
Ga0126380_1147940313300010043Tropical Forest SoilTAFIPTPSAESPEGVGFDDAGNVFGSWTGKMAVRRWTKS*
Ga0126373_1166672023300010048Tropical Forest SoilEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK*
Ga0127503_1012253713300010154SoilKVTAFIPEPSAEIAAPEGVGVDDAGNVYGGWTGKMNLRRFTKS*
Ga0126370_1056846713300010358Tropical Forest SoilKDGKVTAFIPQTSPETGSPEGVGVDDEGNVYASWVAKMNVRRYVKR*
Ga0126376_1034381213300010359Tropical Forest SoilNAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG*
Ga0126372_1026641513300010360Tropical Forest SoilIPTPNAEIETPEGVGFDDAGNVYGGWTGKMAVRRWTKG*
Ga0126372_1027906433300010360Tropical Forest SoilTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ*
Ga0126372_1203099123300010360Tropical Forest SoilAPEAGAPEGVGVDDGGNVYAGWVAKMNVRRYVKRQ*
Ga0126378_1028730933300010361Tropical Forest SoilEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQ*
Ga0126378_1149433223300010361Tropical Forest SoilFIPEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQWACGAAL*
Ga0126377_1224863123300010362Tropical Forest SoilGSAKDGKVTAFIPTPSAEIATPEGVGFDDAGNVYGSWTGKMAVRRFTKS*
Ga0126377_1256851823300010362Tropical Forest SoilGKVTAFIPTPEAESPEGVGFDDAGNVYGSWTGKMAVRRWTKG*
Ga0126379_1057699213300010366Tropical Forest SoilIPATSPEVGSPEGVGVDDAGNVYGGWVAKTAVRRFVK*
Ga0126381_10241755813300010376Tropical Forest SoilDGKVTAFIPEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQ*
Ga0134124_1225693113300010397Terrestrial SoilKDGKVTAFIPEPSAEMGDPEGVGVDDAGVVYAGWTGKMALRRFVK*
Ga0126383_1108110413300010398Tropical Forest SoilFIPTPSAESPEGVGFDDAGNVFGSWTGKMAVRRWTKG*
Ga0126383_1156127923300010398Tropical Forest SoilKDGKVTAFIPEVEIGAPEGVGVDDAGNVYGGWTAKMTVRRFVKN*
Ga0126351_110638913300010860Boreal Forest SoilKDGKVTAFIPEPSAEIQAPEGVGVDDAGNVYGGWTGKMTLRRFTKS*
Ga0137393_1097127013300011271Vadose Zone SoilNAQIATPEGVGVDNAGNVYGGWTGKMAVRRWTKG*
Ga0137363_1000546513300012202Vadose Zone SoilSAKDGKVTAFIPTPEAESPEGVGFDDAGNVYGSWTGKMEVRRWTKG*
Ga0137379_1052453933300012209Vadose Zone SoilGKVTAFIPTANAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKG*
Ga0150984_11180723913300012469Avena Fatua RhizosphereEASAEAQAPEGVGVDDAGNVYGGWTDKQAFRRFVK*
Ga0137413_1016813023300012924Vadose Zone SoilGKVTAFIPQLSAEAGAPEGVGVDDAGNVYAGWVEKKAVRKFVKQ*
Ga0137407_1037672123300012930Vadose Zone SoilNAEIATPEGVGVDSAGNVYGGWTGKMAVRRWTKG*
Ga0137410_1102462523300012944Vadose Zone SoilAFIPTLNAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKS*
Ga0137410_1157714223300012944Vadose Zone SoilAFIPTLNAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKG*
Ga0164301_1100790333300012960SoilSAEAGEPEGVGMHNTGNVYGGWVAKMAVRQFVKE*
Ga0164302_1124972523300012961SoilSVKDGKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ*
Ga0126369_1032388423300012971Tropical Forest SoilTLNAEIATPEGVGFDDAGNVYGSWTGKMAVRRFTKS*
Ga0126369_1179860123300012971Tropical Forest SoilAFVPLPSGEGSPEGVGFDDAGNLYGSWTGKMMVRRWTKG*
Ga0126369_1192428413300012971Tropical Forest SoilKVTAFIPEPSAEAGTPEGVGVDDAGNVYGGYTAKMTVRRFVKG*
Ga0164309_1092682223300012984SoilSAKDGKVTVFIPTPSAEIATPEGVGFDDTGNVYGSWTGKMAVRRWTKS*
Ga0182018_1073268513300014489PalsaMAFIPTPNTEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS*
Ga0180086_107409513300014883SoilGSAKDGKVTAFIPTPSAEIATPEGVGFDDSGNVYGSWTGKMAVRRWTKN*
Ga0132258_1185694613300015371Arabidopsis RhizosphereFIPTANDASPEGVGFDDAGNVFASWTGKMMVRRWTKG*
Ga0182036_1049301833300016270SoilAAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0182036_1080682723300016270SoilRIGSAKDGKVNAFIPLTSTDIAAPEGVGFDETGNVYGGWTGKMAARRWNKS
Ga0182035_1003129713300016341SoilAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0182035_1191648423300016341SoilPSVEAGAPEGVGVDDAGNVYASWTAKMAVRRYVKQ
Ga0182032_1177647823300016357SoilKDGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0182032_1181396713300016357SoilGKVTAFIPEPSVEAGAPEGVGVDDAGNLYAGWTAKMAVRRYVKQ
Ga0182034_1014341523300016371SoilGSAKDGKVTSFIPTPNADIATPEGVGFDDAGNVYGGWTGKMAVRRWTKG
Ga0182034_1136217613300016371SoilDGKVTAFIPTPSAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS
Ga0182040_1084135213300016387SoilVKDGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVQ
Ga0182040_1148273513300016387SoilKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0182040_1193663023300016387SoilGSAKDGKVTSFIPTPNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG
Ga0187817_1071461513300017955Freshwater SedimentVTAFIPTPNAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS
Ga0187782_1061304723300017975Tropical PeatlandGKVTAFIPTPNAEIATPEGVGFDDAGNVYGSWTGKMAVRRWTKN
Ga0179592_1009157223300020199Vadose Zone SoilKVTAFIPTANAEIATPEGVGVDNAGNVYGGWTGKMAVRRWTKN
Ga0210403_1001927313300020580SoilPTAPDGAGAEGVGVDDAGNVFGSWTDKMTVRRFAKQ
Ga0210400_1127761123300021170SoilEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0213874_1005581813300021377Plant RootsDGKVTAFIPEPNADMGGAEGVGVDDAGNVYGGWTNKMALIKYAK
Ga0210384_1171999713300021432SoilKVTAFITDTSAPDGAGAEAVGVDDAGNVYGGWTDKMTVKRFSK
Ga0126371_1266215413300021560Tropical Forest SoilKDGKVTSFIPTPNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKS
Ga0213853_1073974713300021861WatershedsKDGKVTAFITDTSAPDGAGAEAVGVDDAGNVYGGWTDKMTVKRFSK
Ga0213853_1086352523300021861WatershedsFIPTPNAEIATPEGVGVDDAGNVYGGWTGKMAVRRFTKG
Ga0207685_1084671623300025905Corn, Switchgrass And Miscanthus RhizosphereSAKDGKVTAFIPEPSAEAGTPEGVGVDDAGNVYGGYTAKMTVRRFVKG
Ga0207664_1047794713300025929Agricultural SoilFIPMPSAETGAPEGVGIDNVGNVYGGWVAKMNVRRFVKP
Ga0207678_1030676713300026067Corn RhizospherePSAEVETPEGVGFDDAGNVYGSWTGKTAVRRWTKG
Ga0257149_100292053300026355SoilMGKVTAFIPTPEAESPEGVGFDDAGNVYGSWTGKMAVRRWTKG
Ga0209488_1052074023300027903Vadose Zone SoilAKDGKVTAFIPEPSAEAGTPEGVGVDDAGNVYGGYTAKMTVRRFVKG
Ga0311336_1089511623300029990FenVGTKDGKVTAFIPEPSPEVGSPEGVGVDEAGNVYGGYTSKMAVRRFTKG
Ga0318516_1058724023300031543SoilTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0318541_1001984513300031545SoilTAFIPEPSVEAGAAEGIGVDDAGDVYAGWTAKMAVRRYVKQ
Ga0318538_1043687423300031546SoilAVIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ
Ga0318528_1046731723300031561SoilPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0310915_1039063413300031573SoilSNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG
Ga0310915_1080580813300031573SoilGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318555_1041499223300031640SoilDGKVTAFIPEPSATAGAPEGVGVDDAGNVYAGWTEKMAVRRFLKQ
Ga0318574_1002729563300031680SoilVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318560_1031772813300031682SoilIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318560_1042208623300031682SoilVTAFIPEPSAEAGAPEGVSVDDAGNVYAGWTAKMAVRRYVK
Ga0310686_10682712823300031708SoilAKDGKVTAFIPEAADIKAAPEGVGVDDAGNVYGGWTAKQAVRRFVKG
Ga0306917_1073042523300031719SoilKDGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318500_1052904323300031724SoilPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0306918_1023210613300031744SoilGSVKDGKVAAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318537_1033700623300031763SoilKVTAFIPEPSVEAGAPEGVGVDDAGNLYAGWTAKMAVRRYVKQ
Ga0318546_1029233413300031771SoilDRKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0318566_1051792113300031779SoilPEPSATAGAPEGVGVDDAGNVYAGWTEKMAVRRFLKQ
Ga0318529_1001665343300031792SoilKDGKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0318529_1037433913300031792SoilGKVTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVQ
Ga0318548_1066506923300031793SoilIPEPSVEASAPEGVGTDDAGNVYAGWTAKMAVRRYVKQ
Ga0318557_1024529513300031795SoilKDGKVTAFIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ
Ga0318527_1016297923300031859SoilRVKDGKVTAFIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ
Ga0318527_1050043113300031859SoilVKDGKVTAFIPEPSVEAGVPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318544_1043117813300031880SoilIKDGKVTAFIPEPSVEAGAPEGIGVDDTGNVYAGWTAKMAVRRYVK
Ga0306925_1200417513300031890SoilDGKVTAFIPEPSPEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0318536_1014039423300031893SoilKVTAFIAGPSAEAEAPEGVGVDDSGNVYAGWTGKMAVRRFVKQ
Ga0318536_1064451513300031893SoilFIPEPSLEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0318520_1051095523300031897SoilTAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVQ
Ga0306923_1099516523300031910SoilKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0306923_1122773223300031910SoilTPNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG
Ga0306921_1089334313300031912SoilSFIPTPSAEVATPEGVGFDDAGNVYGSWTGKMAVRRWTKG
Ga0306921_1113832333300031912SoilAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYMK
Ga0306921_1162899423300031912SoilAFIPEPSVEAGAPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0310912_1088934013300031941SoilKDGKVTSFIPTSNADIATPEGVGFDDAGNVYGSWTGKMAVRRWTKG
Ga0310912_1141095013300031941SoilEQSIEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0310912_1150521113300031941SoilFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0310916_1124562013300031942SoilTAFIPEVEIGAPEGVGVDDAGNVYGGWTGKMTVRRFVKN
Ga0306926_1014884233300031954SoilAFIPEPSAEAGAPEGVSVDDAGNVYAGWTAKMAVRRYVK
Ga0306926_1139722333300031954SoilKVTAFIPEPSVGAGVPEGVGVDDAGNVYAGWTAKMAVRRYVKE
Ga0318530_1037476023300031959SoilGSVKDGKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0318559_1057189113300032039SoilIPEPSVEAGVAEGIGVDDAGDVYAGWTAKMAVRRYVKQ
Ga0318506_1044017723300032052SoilIPEPSLEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK
Ga0318513_1055702613300032065SoilIPEPSVEAGAPEGVGVDDAGNLYAGWTAKMAVRRYVKQ
Ga0318524_1064292513300032067SoilNGKVTAFIPEPSVEAGVPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318553_1034295713300032068SoilKVTAFIPEPSVEAGTPEGIGVDDAGNVYAGWTAKMAVRRYVK
Ga0318553_1043671323300032068SoilGKVTAFIPEPSAEAGAPEGVSVDDAGNVYAGWTAKMAVRRYVK
Ga0318518_1027181123300032090SoilVKDGKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0310914_1071123133300033289SoilKVTAFIPEPSVEAGAAEGVGVDDAGNVYAGWTAKMAVRRYVKQ
Ga0310914_1086996023300033289SoilGKVTAFIPEPSVEAGAPEGVGVDDAGNVYAGWTAKMAVRRYVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.