NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059392

Metagenome / Metatranscriptome Family F059392

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059392
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 45 residues
Representative Sequence YRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI
Number of Associated Samples 116
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.52 %
% of genes near scaffold ends (potentially truncated) 94.78 %
% of genes from short scaffolds (< 2000 bps) 90.30 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.776 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(8.955 % of family members)
Environment Ontology (ENVO) Unclassified
(39.552 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.761 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.55%    β-sheet: 16.44%    Coil/Unstructured: 63.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF01594AI-2E_transport 41.04
PF136402OG-FeII_Oxy_3 17.16
PF07793DUF1631 14.18
PF01738DLH 6.72
PF04392ABC_sub_bind 2.24
PF03401TctC 1.49
PF00072Response_reg 0.75
PF02012BNR 0.75
PF07995GSDH 0.75
PF13247Fer4_11 0.75
PF04338DUF481 0.75
PF02148zf-UBP 0.75
PF05548Peptidase_M11 0.75
PF06808DctM 0.75
PF00082Peptidase_S8 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 41.04
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.24
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.49
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.75
COG3137Putative salt-induced outer membrane protein YdiYCell wall/membrane/envelope biogenesis [M] 0.75
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.78 %
UnclassifiedrootN/A5.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig79416All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium3253Open in IMG/M
3300004048|Ga0055494_10000738All Organisms → cellular organisms → Bacteria3067Open in IMG/M
3300004092|Ga0062389_101395993All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300004092|Ga0062389_104313906All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300004635|Ga0062388_100816435All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300004778|Ga0062383_10065571All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300005293|Ga0065715_10307751All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1024Open in IMG/M
3300005328|Ga0070676_10011964All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4730Open in IMG/M
3300005332|Ga0066388_105287801All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium655Open in IMG/M
3300005332|Ga0066388_106405794All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300005338|Ga0068868_100210665All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1624Open in IMG/M
3300005339|Ga0070660_100996209All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium708Open in IMG/M
3300005354|Ga0070675_101762869All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium571Open in IMG/M
3300005366|Ga0070659_101787047All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium550Open in IMG/M
3300005434|Ga0070709_11300875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium586Open in IMG/M
3300005434|Ga0070709_11601616All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium530Open in IMG/M
3300005459|Ga0068867_101192303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium699Open in IMG/M
3300005467|Ga0070706_101274438All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium674Open in IMG/M
3300005518|Ga0070699_100443568All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1176Open in IMG/M
3300005559|Ga0066700_10286738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1158Open in IMG/M
3300005563|Ga0068855_100646605All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1136Open in IMG/M
3300005564|Ga0070664_100003055All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria13534Open in IMG/M
3300005577|Ga0068857_100639864All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1007Open in IMG/M
3300005616|Ga0068852_100210542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1844Open in IMG/M
3300005764|Ga0066903_105487981All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium669Open in IMG/M
3300005994|Ga0066789_10115851All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1147Open in IMG/M
3300005994|Ga0066789_10409314All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium567Open in IMG/M
3300005995|Ga0066790_10243363All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium767Open in IMG/M
3300006163|Ga0070715_10566856All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium661Open in IMG/M
3300006175|Ga0070712_100353853All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1203Open in IMG/M
3300006354|Ga0075021_11126535All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium514Open in IMG/M
3300006796|Ga0066665_11584780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium515Open in IMG/M
3300006881|Ga0068865_100312566All Organisms → cellular organisms → Bacteria → Proteobacteria1261Open in IMG/M
3300006953|Ga0074063_12342970All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium822Open in IMG/M
3300006954|Ga0079219_10145242All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1256Open in IMG/M
3300009012|Ga0066710_101763266All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium937Open in IMG/M
3300009012|Ga0066710_102244241All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300009037|Ga0105093_10163532Not Available1124Open in IMG/M
3300009094|Ga0111539_10290326All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1903Open in IMG/M
3300009137|Ga0066709_100068624All Organisms → cellular organisms → Bacteria4147Open in IMG/M
3300009137|Ga0066709_102208932All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium758Open in IMG/M
3300009166|Ga0105100_10156596Not Available1351Open in IMG/M
3300009174|Ga0105241_11951988All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium577Open in IMG/M
3300010339|Ga0074046_10533975All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300010362|Ga0126377_11321110All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300010375|Ga0105239_10810686All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1073Open in IMG/M
3300010397|Ga0134124_10911000All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300010398|Ga0126383_12538568All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010937|Ga0137776_1434555All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300011270|Ga0137391_11049214All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300012198|Ga0137364_10675555All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium779Open in IMG/M
3300012205|Ga0137362_10311121All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1364Open in IMG/M
3300012209|Ga0137379_10620339All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300012209|Ga0137379_11631705All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium543Open in IMG/M
3300012351|Ga0137386_10771422All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300012361|Ga0137360_10340734All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1253Open in IMG/M
3300012361|Ga0137360_11091611All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012363|Ga0137390_10562471All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300012930|Ga0137407_11799876All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium584Open in IMG/M
3300012971|Ga0126369_13400452All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium521Open in IMG/M
3300014322|Ga0075355_1228215All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014969|Ga0157376_11251867All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium771Open in IMG/M
3300015080|Ga0167639_1045008All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria565Open in IMG/M
3300015264|Ga0137403_11349555Not Available560Open in IMG/M
3300015373|Ga0132257_102991772All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium616Open in IMG/M
3300015373|Ga0132257_103194334All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium597Open in IMG/M
3300015374|Ga0132255_100716071All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1487Open in IMG/M
3300017792|Ga0163161_11171415All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium663Open in IMG/M
3300017792|Ga0163161_11963343All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium521Open in IMG/M
3300017930|Ga0187825_10169060All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium778Open in IMG/M
3300017974|Ga0187777_10336878All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1035Open in IMG/M
3300018054|Ga0184621_10142648All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300018058|Ga0187766_10467348All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300018058|Ga0187766_10678055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. L21710Open in IMG/M
3300018083|Ga0184628_10556967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria585Open in IMG/M
3300018481|Ga0190271_10796516All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300020081|Ga0206354_10175562All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium884Open in IMG/M
3300022694|Ga0222623_10241226All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300022889|Ga0247785_1040225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium570Open in IMG/M
3300025321|Ga0207656_10128490All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1185Open in IMG/M
3300025321|Ga0207656_10640590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium543Open in IMG/M
3300025878|Ga0209584_10398124Not Available531Open in IMG/M
3300025898|Ga0207692_10278103All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1012Open in IMG/M
3300025905|Ga0207685_10300459All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium794Open in IMG/M
3300025906|Ga0207699_10083113All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1991Open in IMG/M
3300025910|Ga0207684_11017107All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium693Open in IMG/M
3300025912|Ga0207707_10833624All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium766Open in IMG/M
3300025917|Ga0207660_10206833All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1535Open in IMG/M
3300025924|Ga0207694_10147978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1891Open in IMG/M
3300025926|Ga0207659_10452293All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1082Open in IMG/M
3300025926|Ga0207659_11242747All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium640Open in IMG/M
3300025937|Ga0207669_10407210All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1067Open in IMG/M
3300025937|Ga0207669_11031485All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium692Open in IMG/M
3300025938|Ga0207704_10009644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4669Open in IMG/M
3300025938|Ga0207704_10012080All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium4277Open in IMG/M
3300025961|Ga0207712_10329683All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300025964|Ga0210127_1021470All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300025986|Ga0207658_10749602All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium884Open in IMG/M
3300026067|Ga0207678_11925618All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium515Open in IMG/M
3300026089|Ga0207648_11687752All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium595Open in IMG/M
3300026548|Ga0209161_10049588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2754Open in IMG/M
3300027843|Ga0209798_10046057All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2283Open in IMG/M
3300027877|Ga0209293_10464899All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300027894|Ga0209068_10751743All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium573Open in IMG/M
3300027899|Ga0209668_10525026All Organisms → cellular organisms → Bacteria → Proteobacteria787Open in IMG/M
3300028380|Ga0268265_10039198All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3490Open in IMG/M
3300028380|Ga0268265_12008489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium585Open in IMG/M
3300028381|Ga0268264_11494438All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium686Open in IMG/M
3300028739|Ga0302205_10070613All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium896Open in IMG/M
3300028870|Ga0302254_10262954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium636Open in IMG/M
3300029923|Ga0311347_10326257All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium937Open in IMG/M
3300029984|Ga0311332_11214094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium608Open in IMG/M
3300029984|Ga0311332_11385875All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium569Open in IMG/M
3300030002|Ga0311350_10741065All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria881Open in IMG/M
3300030003|Ga0302172_10175810All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium670Open in IMG/M
3300030014|Ga0302175_10027050All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1211Open in IMG/M
3300030943|Ga0311366_10241309All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300031521|Ga0311364_11861755All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium591Open in IMG/M
3300031781|Ga0318547_10610573All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300031820|Ga0307473_10849418All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031879|Ga0306919_10375500All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300031902|Ga0302322_100178938All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2300Open in IMG/M
3300031902|Ga0302322_100746225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1164Open in IMG/M
3300031913|Ga0310891_10335039Not Available540Open in IMG/M
3300032003|Ga0310897_10334535All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium701Open in IMG/M
3300033408|Ga0316605_11664698All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300033418|Ga0316625_100863400All Organisms → cellular organisms → Bacteria → Proteobacteria786Open in IMG/M
3300033483|Ga0316629_11165312All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300033521|Ga0316616_102539117All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300033557|Ga0316617_100492286All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1111Open in IMG/M
3300034148|Ga0364927_0175647All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium624Open in IMG/M
3300034354|Ga0364943_0149282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium842Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere5.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.73%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.24%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.24%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.24%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.49%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.49%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.49%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.49%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.49%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.49%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.75%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.75%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.75%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300004048Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015080Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025964Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_012494902140918007SoilYRFFDNRSDANHRYTVDLTVRRAMINRQWVPEGSGPNAVAFCSPV
Ga0055494_1000073813300004048Natural And Restored WetlandsGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRVWVPDGKGANGAAFCSPY*
Ga0062389_10139599323300004092Bog Forest SoilLPVYKFFDNRVDANQRHTIDLSVRRAMINRAWVPQGVLPNFVSWCTPI*
Ga0062389_10431390613300004092Bog Forest SoilGMLPVYKFFDNRIDANQRHTIDLSVRRAMINRAWVPQGVLPNFVAWCTPI*
Ga0062388_10081643513300004635Bog Forest SoilLPVYKFFDNRVDANQRHTIDLSVRRAMINRAWVPQGVLPNFISWCTPI*
Ga0062383_1006557113300004778Wetland SedimentFFNNRRDANHRYTVDLSVRRGMINRAWVPEGNGPNAAVFCSPV*
Ga0065715_1030775113300005293Miscanthus RhizospherePVYRFFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI*
Ga0070676_1001196463300005328Miscanthus RhizosphereFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT*
Ga0066388_10528780113300005332Tropical Forest SoilTFWVMPVFADGSCPAGTLPTFRFDNNRRDFNQRHTIDLSIRRAMLNRSWAPTGTGKNGVGFCTPI*
Ga0066388_10640579423300005332Tropical Forest SoilVYRFFDNRQDANQRHTIDLSVRRAMLNRAWVPQGVTPDGVIFCTPI*
Ga0068868_10021066513300005338Miscanthus RhizosphereLPVYRFFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT*
Ga0070660_10099620923300005339Corn RhizosphereFDNRRDANHRYTVDLSVHRAMQNRSWVAEGTRGVAFCSAI*
Ga0070675_10176286923300005354Miscanthus RhizosphereFFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI*
Ga0070674_10005392543300005356Miscanthus RhizosphereYVQVPDGDGRCPDNTLPVYRFFDNRRDANHRYTVDLSVHRAMQNRSWVAEGARGVAFCSPV*
Ga0070659_10178704723300005366Corn RhizosphereYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI*
Ga0070709_1130087523300005434Corn, Switchgrass And Miscanthus RhizosphereFFNNRNDANMRHSRDLTVRREMLNKQWAPNGFGPNNVAFCTPA*
Ga0070709_1160161623300005434Corn, Switchgrass And Miscanthus RhizospherePVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV*
Ga0068867_10119230323300005459Miscanthus RhizosphereGNCLDGRIPVYRFFNNRNDANHRLTIDLSERRAMINRAWVPEGTGPRAAVFCSPI*
Ga0070706_10127443823300005467Corn, Switchgrass And Miscanthus RhizosphereGACTGGLVPVFRFSNNRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI*
Ga0070699_10044356813300005518Corn, Switchgrass And Miscanthus RhizosphereFRFSNNRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI*
Ga0070679_10155821723300005530Corn RhizosphereQVPDSKGKCPSNTLPVYRFFDNRRDANHRYSVDLSVRRAMNNRSWVPEGSGTGVAFCSPI
Ga0066700_1028673813300005559SoilNRSDANHRHTVDLTVRRAMINRKWVPEGSGANAVAFCSPV*
Ga0068855_10064660513300005563Corn RhizosphereHRYTVDLSIRRAMINRGWTQEGFGPNAVVFCSPV*
Ga0070664_100003055153300005564Corn RhizosphereAGTLPVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV*
Ga0068857_10063986423300005577Corn RhizosphereGQCMDGHVPVYRFFDNRRDANQRFTVDRSERRAMQNRAWVADADNGTGAVFCAPI*
Ga0068852_10021054213300005616Corn RhizospherePVYRFFDNRRDANHRYTVDLSVHRAMQNRSWVAEGTRGVAFCSAI*
Ga0066903_10548798113300005764Tropical Forest SoilGTLPTYRFDNNRRDFNQRHTIDLSIRRAMLNRSWAPTGAGKNGVGFCTPI*
Ga0066789_1011585113300005994SoilDANHRHTVDLSVRRQMINRDWVPEGSGPNAVAFCSPV*
Ga0066789_1040931423300005994SoilCPAQTAPVYRFFDNRNDANHRHTIDLSVRRAMINREWAAEGTGPNSVAFCTPI*
Ga0066790_1024336313300005995SoilRNDANHRYTVDLTVRRAMINRKWAPEGNGPNAVAFCSPV*
Ga0070715_1056685613300006163Corn, Switchgrass And Miscanthus RhizosphereNHRYSVDLSVRRAMRNRSWVPEGSGSGVAFCSPI*
Ga0070712_10035385323300006175Corn, Switchgrass And Miscanthus RhizosphereFFDNRNDANHRHTIDLSVRRAMLNRSWAPEGVGPNAVAFCTPI*
Ga0075021_1112653523300006354WatershedsPVYRFFDNRNDANHRYTLDLSVRRAMLNRAWVPEGNGPSAVVMCSVF*
Ga0066665_1158478023300006796SoilATGTVPIFRFSNNRKDFNQRHTLDLSVKRAMINRAWVPDGGGPNGTAFCSPI*
Ga0068865_10031256623300006881Miscanthus RhizosphereGEGACRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGVNGVAFCSPI*
Ga0074063_1234297023300006953SoilPVYRFFDNRNDANHRYTVDLSVRRAMLNRSWVPEGNGPSAVVMCSVF*
Ga0079219_1014524223300006954Agricultural SoilMLPVYRFFNNRQDANQRHTIDLSVRRAMLNRAWVPQGVPPDQVIFCTPI*
Ga0066710_10176326613300009012Grasslands SoilFDNRQDANQRHTIDLSVRRAMINRAWVPEGFGPSHVIFCTPI
Ga0066710_10224424123300009012Grasslands SoilYRFFNNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNHVIFCTPI
Ga0105093_1016353223300009037Freshwater SedimentAGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGANGAAFCSPY*
Ga0111539_1029032623300009094Populus RhizosphereVYRFFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI*
Ga0066709_10006862413300009137Grasslands SoilDANQRHTIDLSVRRAMINRAWVPEGFGPSHVIFCTPI*
Ga0066709_10220893223300009137Grasslands SoilFRFSNNRKDFNQRHTLDLSVKRAMINRAWVPDGGGPNGTAFCSPI*
Ga0105100_1015659623300009166Freshwater SedimentFFNNRRDANQRHTVDLSVKRAMVNRAWVPDGKGTNGAAFCSPY*
Ga0105241_1195198823300009174Corn RhizosphereVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI*
Ga0074046_1053397523300010339Bog Forest SoilPVYKFFDNRVDANQRHTIDLSVRRAMINRAWVPQGVLPNFVAWCTPI*
Ga0126377_1132111023300010362Tropical Forest SoilGTLPVYKFFDNRQDANQRHTIDLSVRRAMNNRAWVPQGIGPNHVAFCTPI*
Ga0105239_1081068613300010375Corn RhizosphereNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI*
Ga0134124_1091100013300010397Terrestrial SoilEGACRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGVNGVAFCSPI*
Ga0126383_1253856823300010398Tropical Forest SoilDANQRHTIDLSVRRAMLNRAWVPQGVAPDGVIFCTPI*
Ga0137776_143455523300010937SedimentNQRHTIDLSVRRAMINRAWVPQGFGPNFVAFCTPTPS*
Ga0137391_1104921413300011270Vadose Zone SoilNRQDANQRHTIDLSVRRAMLNRAWVPQGFGPNQVIFCTPI*
Ga0137364_1067555523300012198Vadose Zone SoilRQDANHRYTVNLSVRRAMINRKWVPEGTGPNAVSFCSPF*
Ga0137362_1031112133300012205Vadose Zone SoilDNRSDANHRYTVDLTVRRAMINRKWVPEGSGANAVAFCSPV*
Ga0137379_1062033913300012209Vadose Zone SoilLPAYRFFNNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNQVIFCTPI*
Ga0137379_1163170523300012209Vadose Zone SoilNHRYTIDLTARRAMLNRQWAPEGIGSNAVAFCSPI*
Ga0137386_1077142213300012351Vadose Zone SoilRQDASQRHSIDLSVRRAMINRAWVPQGFGPNQVIFCTPI*
Ga0137360_1034073433300012361Vadose Zone SoilGTLPVYRFFDNRSDANHRHTVDLTVRRAMINRKWVPEGSGPNAVAFCSPV*
Ga0137360_1109161113300012361Vadose Zone SoilQDANQRHTIDLSVRRAMINRAWVPQGFGPNHVIFCTPI*
Ga0137390_1056247123300012363Vadose Zone SoilPAYRFFNNRQDANQRHTIDLSVRRAMLNRAWVPQGFGPNQVIFCTPI*
Ga0137407_1179987613300012930Vadose Zone SoilLPIYRFFNNRNDANMRHTRDLTVRREMLNKKWAPNGFGPNGVAFCSPV*
Ga0126369_1340045213300012971Tropical Forest SoilRFSNNRKDFNQRHTLDLSVKRAMLNRAWVPDGGGPNGTAFCSPI*
Ga0075355_122821513300014322Natural And Restored WetlandsRFFNNRRDANHRYTVDLSVRRAMQNRAWAAEGTGPNSVAFCSPI*
Ga0157376_1125186723300014969Miscanthus RhizosphereFFDNRRDANHRYTVDLSVHRAMQNRSRVAEGTRGVAFCSPV*
Ga0167639_104500813300015080Glacier Forefield SoilNDANHRYTIDLTVRRAMINRGWVPEGAGPNAVAFCTPM*
Ga0137403_1134955513300015264Vadose Zone SoilNTLPAYRFFDNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNHVIFCTPI*
Ga0132257_10299177223300015373Arabidopsis RhizosphereFRFSNQRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI*
Ga0132257_10319433413300015373Arabidopsis RhizosphereLVPVFRFSNNRQDFNQRMTFDLSIKRAMINRGWVPDGGGPNGTAFCSPI*
Ga0132255_10071607113300015374Arabidopsis RhizosphereYRFFNNRNDANMRHTRDLTVRREMLNKQWAPYGAGPNGVAFCSPV*
Ga0163161_1117141523300017792Switchgrass RhizosphereRFFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT
Ga0163161_1196334323300017792Switchgrass RhizosphereDAAGHCESGTLPIYRFFNNRRDASHRYAVDLSVRRAMINRAWTAEGKGLDSVAFCSPI
Ga0187825_1016906013300017930Freshwater SedimentCRAGTLPVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGIGPNAVAFCTPI
Ga0187777_1033687823300017974Tropical PeatlandFNNRNDANHRHTIDLTARRAMLNRQWASEGFGTNGVALCSPI
Ga0184621_1014264823300018054Groundwater SedimentNNRQDANQRHTVNLSVRQAMINRAWVPLGFGPNHVIFCTPI
Ga0187766_1046734823300018058Tropical PeatlandMLPVYRFFDNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNSVIFCTPAPA
Ga0187766_1067805523300018058Tropical PeatlandFNNRNDANQRHTIDLTARRAMLNRGWTPNGSGPNGVAFCSPV
Ga0184628_1055696733300018083Groundwater SedimentFNNRQAANHRHTPDLSVVRAMINRGWVPEGPGGVAFCSPI
Ga0190271_1079651613300018481SoilPESTLPVYRFFDNRRDANHRYTADLSVHRAMQNRQWVSEGAGGVAFCSAI
Ga0206354_1017556223300020081Corn, Switchgrass And Miscanthus RhizosphereANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI
Ga0222623_1024122623300022694Groundwater SedimentYRFFNNRQDANQRHTVNLSVRQAMINRAWVPLGFGPNHVIFCTPI
Ga0247785_104022513300022889SoilFDNRQDANHRHTPDLSVKRAMINRGWVPEGINGVAFCSPI
Ga0207656_1012849023300025321Corn RhizosphereNCRAGLLPVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGLGPNAVAFCTPI
Ga0207656_1064059023300025321Corn RhizosphereFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV
Ga0209584_1039812413300025878Arctic Peat SoilIPVYRFDNNRQDFNQRHTINLSVKRSMLNRGWAPDGAGPRGVAFCSPI
Ga0207692_1027810323300025898Corn, Switchgrass And Miscanthus RhizosphereVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV
Ga0207685_1030045923300025905Corn, Switchgrass And Miscanthus RhizosphereVYRFFDNRNDANHRYTINLSVRRAMLNRGWAPEGLGPNAVAFCTPI
Ga0207699_1008311323300025906Corn, Switchgrass And Miscanthus RhizosphereNDANHRHTIDLSVRRAMLNRSWAPEGVGPNAVAFCTPI
Ga0207684_1101710713300025910Corn, Switchgrass And Miscanthus RhizosphereGACTGGLVPVFRFSNNRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI
Ga0207707_1083362423300025912Corn RhizospherePVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI
Ga0207660_1020683313300025917Corn RhizosphereNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI
Ga0207694_1014797813300025924Corn RhizosphereTLPVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV
Ga0207659_1045229323300025926Miscanthus RhizosphereFFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI
Ga0207659_1124274723300025926Miscanthus RhizosphereNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT
Ga0207669_1040721013300025937Miscanthus RhizosphereDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGINGVAFCSPI
Ga0207669_1103148523300025937Miscanthus RhizosphereANHRYTVDRSVRRAMLNRGWVPEGNGKEAVAFCSVF
Ga0207704_1000964463300025938Miscanthus RhizosphereACRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGVNGVAFCSPI
Ga0207704_1001208053300025938Miscanthus RhizosphereDNRNDANHRYTINLSVRRAMLNRGWAPEGLGPNAVAFCTPI
Ga0207712_1032968343300025961Switchgrass RhizosphereGTIPIYRFFDNRQDANHRHTPDLSVKRAMINRGWIPEGVNGVAFCSPI
Ga0210127_102147013300025964Natural And Restored WetlandsRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGRGANGAAFCSPY
Ga0207658_1074960223300025986Switchgrass RhizosphereDNTLPVYRFFDNRRDANHRYTVDLSVHRAMQNRSWVAEGTRGVAFCSAI
Ga0207678_1192561813300026067Corn RhizosphereGRRDANHRYTVDLSIRRAMINRGWTQEGFGPNAVVFCSPV
Ga0207648_1168775223300026089Miscanthus RhizosphereFFNNRNDANHRYTVDRSVRRAMLNRGWVPEGNGKEAVAFCSVF
Ga0209161_1004958833300026548SoilNTLPVYRFFDNRQDANQRHTIDLSVRRAMINRAWVPEGFGPNHVIFCTPI
Ga0209798_1004605733300027843Wetland SedimentYRFFNNRRDANHRYTVDLSVRRGMINRAWVPEGNGPNAAVFCSPV
Ga0209293_1046489913300027877WetlandGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY
Ga0209068_1075174313300027894WatershedsTLPVYRFFDNRNDANHRYTLDLSVRRAMLNRAWVPEGNGPSAVVMCSVF
Ga0209668_1052502613300027899Freshwater Lake SedimentVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGANGAAFCAPY
Ga0268265_1003919813300028380Switchgrass RhizosphereVYRFFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT
Ga0268265_1200848933300028380Switchgrass RhizosphereCRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGINGVAFCSPI
Ga0268264_1149443813300028381Switchgrass RhizosphereRFFDNRRDANHRYSVDLSVRRAMNNRAWVPEGSGSGVAFCSPI
Ga0302205_1007061323300028739FenNRNDANHRYTVDLSVRRAMLNRSWVPEGNGPNAVAFCSVF
Ga0302254_1026295423300028870FenNDANHRYTVDLSVRRAMLNRSWVPEGSGPNAVAFCSAF
Ga0311347_1032625713300029923FenNHRYTVDLSVRRAMLNRAWAPEGEGPNSIAFCSPI
Ga0311332_1121409423300029984FenSNNRNDFNQRMTLDLSVKRAMLNRAWVPDGGGPNGSAFCSPI
Ga0311332_1138587523300029984FenRNDANHRYTVDRSVRRAMLNRSWVPEGNGPNAVAFCTVY
Ga0311350_1074106523300030002FenNDANMRHTRDLTVRREMLNKQWAPNGFGPNGVAFCSPA
Ga0302172_1017581023300030003FenNNRNDANHRYTIDLSVRRAMLNRSWVPEGNGPNAVAFCSVF
Ga0302175_1002705013300030014FenFNNRNDANHRYTVDRSVRRAMLNRSWVPEGNGPNAVAFCSVY
Ga0311366_1024130923300030943FenLPVYRFFNYRNDANHRYTVDRSVRRAMLNRSWVPEGNGPNAVAFCSVY
Ga0311364_1186175523300031521FenRFFNNRNDANHRYTVDLSVRRAMLNRSWVPEGNGPNSVAFCSAY
Ga0318547_1061057323300031781SoilVYKFFDNREDANQRHTIDLSVRRAMLNRAWVPQGFGPNHVAFCTPISS
Ga0307473_1084941823300031820Hardwood Forest SoilDNRIDANQRYTIDLSVRRAMINRAWVPQGFGPNHVAFCTPI
Ga0306919_1037550023300031879SoilTLPVYKFFDNREDANQRHTIDLSVRRAMLNRAWVPQGFGPNHVAFCTPISS
Ga0302322_10017893823300031902FenFFNNRNDANMRHTIDLTVRREMANKQWARNGTGPEGVAFCSPFAF
Ga0302322_10074622523300031902FenVYRFFNNRRDANHRYTVDLSVRRAMLNRAWAPEGEGPNSIAFCSPI
Ga0310891_1033503923300031913SoilNDGNCLDGRIPVYRFFNNRNDANHRLTIDLSERRAMINRAWVPEGTGPRAAVFCSPI
Ga0310897_1033453513300032003SoilYRFFNNRNDANHRLTIDLSERRAMINRAWVPEGTGPRAAVFCSPI
Ga0316605_1166469813300033408SoilCRAGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGANGAAFCAPY
Ga0316625_10086340013300033418SoilPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY
Ga0316629_1116531223300033483SoilNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY
Ga0316616_10253911713300033521SoilRAGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY
Ga0316617_10049228623300033557SoilDANHRYTLDLSVKRAMVNRGWVPEGAGPNNVAFCSPI
Ga0364927_0175647_3_1703300034148SedimentFTGTCREGTIPVHRFFNNRQDANHRHTPDLSVGRAMVNRGWVPEGNGGVAFCSPT
Ga0364943_0149282_712_8403300034354SedimentFNNRNDANHRYTVDLSVRRAMLNRSWVPEGNGKEAVAFCSVF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.