NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059484

Metagenome / Metatranscriptome Family F059484

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059484
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 89 residues
Representative Sequence VASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Number of Associated Samples 97
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 67.16 %
% of genes near scaffold ends (potentially truncated) 55.22 %
% of genes from short scaffolds (< 2000 bps) 97.76 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(71.642 % of family members)
Environment Ontology (ENVO) Unclassified
(94.030 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(97.015 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.94%    β-sheet: 0.00%    Coil/Unstructured: 55.06%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF07716bZIP_2 1.50
PF03724META 0.75
PF13833EF-hand_8 0.75
PF01582TIR 0.75
PF13499EF-hand_7 0.75
PF00069Pkinase 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.01
COG3187Heat shock protein HslJPosttranslational modification, protein turnover, chaperones [O] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2156126005|TCCM__contig06489All Organisms → cellular organisms → Eukaryota684Open in IMG/M
2166559018|JCVI_READ_1348654All Organisms → cellular organisms → Eukaryota945Open in IMG/M
3300001971|GOS2215_10079901All Organisms → cellular organisms → Eukaryota1860Open in IMG/M
3300005551|Ga0066843_10110822All Organisms → cellular organisms → Eukaryota788Open in IMG/M
3300008832|Ga0103951_10667726All Organisms → cellular organisms → Eukaryota567Open in IMG/M
3300009103|Ga0117901_1174298All Organisms → cellular organisms → Eukaryota1177Open in IMG/M
3300009274|Ga0103878_1024082All Organisms → cellular organisms → Eukaryota653Open in IMG/M
3300009790|Ga0115012_10243541All Organisms → cellular organisms → Eukaryota1334Open in IMG/M
3300012953|Ga0163179_10998652All Organisms → cellular organisms → Eukaryota730Open in IMG/M
3300012953|Ga0163179_11503061All Organisms → cellular organisms → Eukaryota606Open in IMG/M
3300012953|Ga0163179_11548745All Organisms → cellular organisms → Eukaryota598Open in IMG/M
3300012953|Ga0163179_12092486All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300017726|Ga0181381_1076007All Organisms → cellular organisms → Eukaryota720Open in IMG/M
3300017731|Ga0181416_1133880All Organisms → cellular organisms → Eukaryota596Open in IMG/M
3300017748|Ga0181393_1120839All Organisms → cellular organisms → Eukaryota664Open in IMG/M
3300017748|Ga0181393_1162509All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300017750|Ga0181405_1084624All Organisms → cellular organisms → Eukaryota808Open in IMG/M
3300017752|Ga0181400_1126060All Organisms → cellular organisms → Eukaryota737Open in IMG/M
3300017753|Ga0181407_1132842All Organisms → cellular organisms → Eukaryota618Open in IMG/M
3300017753|Ga0181407_1141724All Organisms → cellular organisms → Eukaryota595Open in IMG/M
3300017755|Ga0181411_1194919All Organisms → cellular organisms → Eukaryota570Open in IMG/M
3300017756|Ga0181382_1082802All Organisms → cellular organisms → Eukaryota885Open in IMG/M
3300017756|Ga0181382_1142271All Organisms → cellular organisms → Eukaryota630Open in IMG/M
3300017756|Ga0181382_1178609All Organisms → cellular organisms → Eukaryota543Open in IMG/M
3300017762|Ga0181422_1129001All Organisms → cellular organisms → Eukaryota781Open in IMG/M
3300017762|Ga0181422_1229779All Organisms → cellular organisms → Eukaryota553Open in IMG/M
3300017767|Ga0181406_1134121All Organisms → cellular organisms → Eukaryota745Open in IMG/M
3300017767|Ga0181406_1254553All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300017769|Ga0187221_1172232All Organisms → cellular organisms → Eukaryota634Open in IMG/M
3300017769|Ga0187221_1172232All Organisms → cellular organisms → Eukaryota634Open in IMG/M
3300017770|Ga0187217_1151906All Organisms → cellular organisms → Eukaryota775Open in IMG/M
3300017771|Ga0181425_1155286All Organisms → cellular organisms → Eukaryota725Open in IMG/M
3300017776|Ga0181394_1093970All Organisms → cellular organisms → Eukaryota962Open in IMG/M
3300017776|Ga0181394_1122592All Organisms → cellular organisms → Eukaryota819Open in IMG/M
3300017776|Ga0181394_1196525All Organisms → cellular organisms → Eukaryota615Open in IMG/M
3300017781|Ga0181423_1339561All Organisms → cellular organisms → Eukaryota548Open in IMG/M
3300018501|Ga0193169_100664All Organisms → cellular organisms → Eukaryota972Open in IMG/M
3300018501|Ga0193169_100667All Organisms → cellular organisms → Eukaryota971Open in IMG/M
3300018501|Ga0193169_100770All Organisms → cellular organisms → Eukaryota915Open in IMG/M
3300018517|Ga0193451_104630All Organisms → cellular organisms → Eukaryota571Open in IMG/M
3300018519|Ga0193135_1003798All Organisms → cellular organisms → Eukaryota616Open in IMG/M
3300018521|Ga0193171_101330All Organisms → cellular organisms → Eukaryota957Open in IMG/M
3300018555|Ga0193296_102953All Organisms → cellular organisms → Eukaryota679Open in IMG/M
3300018568|Ga0193457_1011267All Organisms → cellular organisms → Eukaryota619Open in IMG/M
3300018581|Ga0193079_1003000All Organisms → cellular organisms → Eukaryota867Open in IMG/M
3300018585|Ga0193221_1005668All Organisms → cellular organisms → Eukaryota748Open in IMG/M
3300018590|Ga0193114_1008656All Organisms → cellular organisms → Eukaryota988Open in IMG/M
3300018590|Ga0193114_1008658All Organisms → cellular organisms → Eukaryota988Open in IMG/M
3300018590|Ga0193114_1015761All Organisms → cellular organisms → Eukaryota751Open in IMG/M
3300018592|Ga0193113_1014748All Organisms → cellular organisms → Eukaryota817Open in IMG/M
3300018605|Ga0193339_1027554All Organisms → cellular organisms → Eukaryota552Open in IMG/M
3300018643|Ga0193431_1025189All Organisms → cellular organisms → Eukaryota629Open in IMG/M
3300018648|Ga0193445_1007381All Organisms → cellular organisms → Eukaryota1282Open in IMG/M
3300018648|Ga0193445_1012639All Organisms → cellular organisms → Eukaryota1052Open in IMG/M
3300018656|Ga0193269_1044869All Organisms → cellular organisms → Eukaryota623Open in IMG/M
3300018659|Ga0193067_1051290All Organisms → cellular organisms → Eukaryota608Open in IMG/M
3300018688|Ga0193481_1044002All Organisms → cellular organisms → Eukaryota781Open in IMG/M
3300018740|Ga0193387_1009476All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea1318Open in IMG/M
3300018752|Ga0192902_1006893All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1914Open in IMG/M
3300018754|Ga0193346_1043221All Organisms → cellular organisms → Eukaryota616Open in IMG/M
3300018777|Ga0192839_1037365All Organisms → cellular organisms → Eukaryota752Open in IMG/M
3300018783|Ga0193197_1014957All Organisms → cellular organisms → Eukaryota1129Open in IMG/M
3300018783|Ga0193197_1066564All Organisms → cellular organisms → Eukaryota533Open in IMG/M
3300018784|Ga0193298_1044639All Organisms → cellular organisms → Eukaryota872Open in IMG/M
3300018793|Ga0192928_1027173All Organisms → cellular organisms → Eukaryota1024Open in IMG/M
3300018796|Ga0193117_1057628All Organisms → cellular organisms → Eukaryota646Open in IMG/M
3300018802|Ga0193388_1010974All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea1353Open in IMG/M
3300018803|Ga0193281_1057888All Organisms → cellular organisms → Eukaryota766Open in IMG/M
3300018803|Ga0193281_1071197All Organisms → cellular organisms → Eukaryota677Open in IMG/M
3300018807|Ga0193441_1002951All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis2078Open in IMG/M
3300018807|Ga0193441_1026821All Organisms → cellular organisms → Eukaryota1003Open in IMG/M
3300018819|Ga0193497_1059708All Organisms → cellular organisms → Eukaryota707Open in IMG/M
3300018823|Ga0193053_1066696All Organisms → cellular organisms → Eukaryota575Open in IMG/M
3300018837|Ga0192927_1050908All Organisms → cellular organisms → Eukaryota645Open in IMG/M
3300018847|Ga0193500_1008502All Organisms → cellular organisms → Eukaryota1583Open in IMG/M
3300018847|Ga0193500_1036696All Organisms → cellular organisms → Eukaryota855Open in IMG/M
3300018856|Ga0193120_1036548All Organisms → cellular organisms → Eukaryota1149Open in IMG/M
3300018857|Ga0193363_1082650All Organisms → cellular organisms → Eukaryota656Open in IMG/M
3300018863|Ga0192835_1082509All Organisms → cellular organisms → Eukaryota623Open in IMG/M
3300018867|Ga0192859_1056128All Organisms → cellular organisms → Eukaryota645Open in IMG/M
3300018873|Ga0193553_1009046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda2246Open in IMG/M
3300018908|Ga0193279_1088610All Organisms → cellular organisms → Eukaryota639Open in IMG/M
3300018909|Ga0193160_10008557All Organisms → cellular organisms → Eukaryota1030Open in IMG/M
3300018909|Ga0193160_10009481All Organisms → cellular organisms → Eukaryota1004Open in IMG/M
3300018912|Ga0193176_10038418All Organisms → cellular organisms → Eukaryota1056Open in IMG/M
3300018924|Ga0193096_10207726All Organisms → cellular organisms → Eukaryota618Open in IMG/M
3300018925|Ga0193318_10174573All Organisms → cellular organisms → Eukaryota590Open in IMG/M
3300018929|Ga0192921_10185323All Organisms → cellular organisms → Eukaryota624Open in IMG/M
3300018929|Ga0192921_10222368All Organisms → cellular organisms → Eukaryota541Open in IMG/M
3300018937|Ga0193448_1119335All Organisms → cellular organisms → Eukaryota595Open in IMG/M
3300018943|Ga0193266_10049222All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1260Open in IMG/M
3300018943|Ga0193266_10069242All Organisms → cellular organisms → Eukaryota1031Open in IMG/M
3300018947|Ga0193066_10097700All Organisms → cellular organisms → Eukaryota853Open in IMG/M
3300018947|Ga0193066_10172877All Organisms → cellular organisms → Eukaryota624Open in IMG/M
3300018958|Ga0193560_10017718All Organisms → cellular organisms → Eukaryota1904Open in IMG/M
3300018958|Ga0193560_10170610All Organisms → cellular organisms → Eukaryota687Open in IMG/M
3300018959|Ga0193480_10097730All Organisms → cellular organisms → Eukaryota984Open in IMG/M
3300018960|Ga0192930_10101980All Organisms → cellular organisms → Eukaryota1135Open in IMG/M
3300018963|Ga0193332_10187675All Organisms → cellular organisms → Eukaryota661Open in IMG/M
3300018970|Ga0193417_10189814All Organisms → cellular organisms → Eukaryota647Open in IMG/M
3300018972|Ga0193326_10053462All Organisms → cellular organisms → Eukaryota648Open in IMG/M
3300018973|Ga0193330_10146706All Organisms → cellular organisms → Eukaryota736Open in IMG/M
3300018978|Ga0193487_10266392All Organisms → cellular organisms → Eukaryota533Open in IMG/M
3300018995|Ga0193430_10069225All Organisms → cellular organisms → Eukaryota814Open in IMG/M
3300018995|Ga0193430_10108521All Organisms → cellular organisms → Eukaryota663Open in IMG/M
3300018995|Ga0193430_10108522All Organisms → cellular organisms → Eukaryota663Open in IMG/M
3300019004|Ga0193078_10037302All Organisms → cellular organisms → Eukaryota910Open in IMG/M
3300019004|Ga0193078_10127739All Organisms → cellular organisms → Eukaryota617Open in IMG/M
3300019007|Ga0193196_10163580All Organisms → cellular organisms → Eukaryota947Open in IMG/M
3300019007|Ga0193196_10376622All Organisms → cellular organisms → Eukaryota599Open in IMG/M
3300019007|Ga0193196_10414111All Organisms → cellular organisms → Eukaryota562Open in IMG/M
3300019007|Ga0193196_10418556All Organisms → cellular organisms → Eukaryota558Open in IMG/M
3300019008|Ga0193361_10322195All Organisms → cellular organisms → Eukaryota524Open in IMG/M
3300019011|Ga0192926_10100536All Organisms → cellular organisms → Eukaryota1139Open in IMG/M
3300019013|Ga0193557_10092211All Organisms → cellular organisms → Eukaryota1097Open in IMG/M
3300019018|Ga0192860_10140412All Organisms → cellular organisms → Eukaryota910Open in IMG/M
3300019019|Ga0193555_10259466All Organisms → cellular organisms → Eukaryota555Open in IMG/M
3300019028|Ga0193449_10261231All Organisms → cellular organisms → Eukaryota739Open in IMG/M
3300019028|Ga0193449_10290395All Organisms → cellular organisms → Eukaryota686Open in IMG/M
3300019044|Ga0193189_10021303All Organisms → cellular organisms → Eukaryota1395Open in IMG/M
3300019044|Ga0193189_10077172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota796Open in IMG/M
3300019055|Ga0193208_10004124All Organisms → cellular organisms → Eukaryota3179Open in IMG/M
3300019055|Ga0193208_10467182All Organisms → cellular organisms → Eukaryota661Open in IMG/M
3300019071|Ga0193428_100810All Organisms → cellular organisms → Eukaryota1375Open in IMG/M
3300019071|Ga0193428_102019All Organisms → cellular organisms → Eukaryota868Open in IMG/M
3300019074|Ga0193210_1005798All Organisms → cellular organisms → Eukaryota677Open in IMG/M
3300019107|Ga0193400_1011241All Organisms → cellular organisms → Eukaryota555Open in IMG/M
3300019134|Ga0193515_1064077All Organisms → cellular organisms → Eukaryota649Open in IMG/M
3300019136|Ga0193112_1115419All Organisms → cellular organisms → Eukaryota617Open in IMG/M
3300019136|Ga0193112_1142188All Organisms → cellular organisms → Eukaryota537Open in IMG/M
3300019152|Ga0193564_10018636All Organisms → cellular organisms → Eukaryota → Opisthokonta1890Open in IMG/M
3300026104|Ga0208452_1025271All Organisms → cellular organisms → Eukaryota546Open in IMG/M
3300030918|Ga0073985_11031563All Organisms → cellular organisms → Eukaryota596Open in IMG/M
3300031056|Ga0138346_10105183All Organisms → cellular organisms → Eukaryota897Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine71.64%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.99%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.75%
Environmental And Host-AssociatedEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated0.75%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.75%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2156126005Marine Trichodesmium cyanobacterial communities from the Bermuda Atlantic Time-SeriesEnvironmentalOpen in IMG/M
2166559018Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574)EnvironmentalOpen in IMG/M
3300001971Marine microbial communities from the Sargasso Sea - GS000cEnvironmentalOpen in IMG/M
3300005551Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89AEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300009103Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7umEnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300018501Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_S400007202 (ERX1782147-ERR1712052)EnvironmentalOpen in IMG/M
3300018517Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002366 (ERX1782329-ERR1712120)EnvironmentalOpen in IMG/M
3300018519Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000759 (ERX1782467-ERR1711905)EnvironmentalOpen in IMG/M
3300018521Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000311 (ERX1782300-ERR1712011)EnvironmentalOpen in IMG/M
3300018555Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001618 (ERX1809464-ERR1739837)EnvironmentalOpen in IMG/M
3300018568Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002404 (ERX1789617-ERR1719200)EnvironmentalOpen in IMG/M
3300018581Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782098-ERR1712053)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018590Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000357 (ERX1782335-ERR1712116)EnvironmentalOpen in IMG/M
3300018592Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018656Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789469-ERR1719513)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018688Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789672-ERR1719470)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018754Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001810 (ERX1789618-ERR1719236)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018803Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789721-ERR1719184)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018837Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018857Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001828 (ERX1789640-ERR1719290)EnvironmentalOpen in IMG/M
3300018863Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000581 (ERX1789689-ERR1719283)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018909Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000402 (ERX1782377-ERR1712208)EnvironmentalOpen in IMG/M
3300018912Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782195-ERR1712243)EnvironmentalOpen in IMG/M
3300018924Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789468-ERR1719259)EnvironmentalOpen in IMG/M
3300018925Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789484-ERR1719312)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018937Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789592-ERR1719202)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018959Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018973Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001742 (ERX1789408-ERR1719300)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019028Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789432-ERR1719419)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019071Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002297 (ERX1782186-ERR1712067)EnvironmentalOpen in IMG/M
3300019074Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000074 (ERX1782410-ERR1711996)EnvironmentalOpen in IMG/M
3300019107Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002041 (ERX1782217-ERR1711949)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300026104Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3611_800 (SPAdes)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TCCM_0489.000004602156126005MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI
Ocean6-_029782202166559018Environmental And Host-AssociatedVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
GOS2215_1007990113300001971MarineLGGAVCQTIGTRSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL*
Ga0066843_1011082233300005551MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL*
Ga0103951_1066772613300008832MarineGYNGSNELCGRSVASKLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQMFDHVLVA*
Ga0117901_117429813300009103MarineVASKLWVHEPDTFFLEAAREICEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI*
Ga0103878_102408213300009274Surface Ocean WaterVASKLWVHEPDTFFLEVAREISEKWNFFVNRSVPENFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWV
Ga0115012_1024354123300009790MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL*
Ga0163179_1099865223300012953SeawaterVVSKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL*
Ga0163179_1150306113300012953SeawaterSKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI*
Ga0163179_1154874513300012953SeawaterVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFQRENFSGQVPTESLRTQDSEYVYEGWVQQIFDPVLVARSWVSATKWHPLAKL*
Ga0163179_1209248613300012953SeawaterVASKLWVHEPDTFFLEAAREICEKWNFFVNRSVPENFVRENFSGQVPTEFLCTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKLLGVEKKCI
Ga0181381_107600713300017726SeawaterVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVQKKCISQNLRI
Ga0181416_113388023300017731SeawaterLLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0181393_112083913300017748SeawaterVASKLWVHEPNTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERLVQQIFDHVLVARSWVSAKKWGPLAKLLGVQKKCISQNLRI
Ga0181393_116250923300017748SeawaterKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGQSWMSAKKRGPLAKLLGVAKKSHSHNFRI
Ga0181405_108462413300017750SeawaterVASNLWVHEPDTFFLFEDTEISEKWNFFVNRSIPKNCGRENFSGQVPTESLRTQDSENVYERWVQPIFDPVSVGRSWMSAKKWGPLAKL
Ga0181400_112606013300017752SeawaterMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0181407_113284213300017753SeawaterMKIREKGKFFVNRSVPENFQWEFFLGQVPTESLRTQDSENVYERWVQQNFDPVLVARSRVSAKKWGPLAKLLGV
Ga0181407_114172413300017753SeawaterLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSATKWGPLAKL
Ga0181411_119491913300017755SeawaterRSVASKLWVHEPDPFFLFEDTEISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0181382_108280213300017756SeawaterLASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLA
Ga0181382_114227113300017756SeawaterIRGILTLGGAVCQTIGTRSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFFEAAREISEKWNFFVKRSVPENFQWEIFLGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0181382_117860923300017756SeawaterASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARS
Ga0181422_112900113300017762SeawaterVHEPDTFFLEAAREISEKWNFFVNRSVPENFPWENFSGQVPTESLRTQDSENVYERWVQQIFDHVLVARSWVSATKWGPLAKL
Ga0181422_122977913300017762SeawaterMVQTSYLGRSVASKLLVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKL
Ga0181406_113412113300017767SeawaterVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKLLGVEKKCISQNLRI
Ga0181406_125455323300017767SeawaterFFLEAAREISEKWNFFVSRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0187221_117223213300017769SeawaterWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRKNFSGQVPTESLRTQDSEYVYERWVQQMFDHVLVARSWVSATKWDQSAKL
Ga0187221_117223223300017769SeawaterFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0187217_115190613300017770SeawaterLWVHEPDTFFFEAAREISEKWNFFVNRSVPENFQWGNFSGQVPTESLRTQDSENVYERGVQQIFDPVLVARSWVSATKWGPLAKLCAVKKNKHGHNFQIIIS
Ga0181425_115528613300017771SeawaterVASKLWVHEPVTFCFEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSCVSATKWGPLAKL
Ga0181394_109397013300017776SeawaterLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQILDHVLVARSWVSATKWGPLAKLSAVEKNKHGHNFQ
Ga0181394_112259223300017776SeawaterVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFCGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0181394_119652513300017776SeawaterMEIREKRKIFVNCSVPENFQRENFSGQVPTESLRTQDSENVYERWVQQMFDPVLVGRSWVSATKWGPLGGEREL
Ga0181423_133956113300017781SeawaterEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193169_10066413300018501MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193169_10066723300018501MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKLLGVAKKSHSHNFRI
Ga0193169_10077013300018501MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKLLGVKKKCISQNLRI
Ga0193451_10463023300018517MarineLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFQRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193135_100379813300018519MarineMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDHVLVARSWVSATKWGPLAK
Ga0193171_10133013300018521MarineSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFEWENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKLFGVEKKCISQNLRI
Ga0193296_10295313300018555MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKLLGVQKKCISQ
Ga0193457_101126713300018568MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAK
Ga0193079_100300013300018581MarineSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFERENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193221_100566813300018585MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKEKLICGVQKKCISQNIQN
Ga0193114_100865623300018590MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193114_100865813300018590MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKLLGVKKKCISQNLRI
Ga0193114_101576113300018590MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193113_101474813300018592MarineSTSGVPLKSLGYNGSNELCGRSVASKLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193339_102755413300018605MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSA
Ga0193431_102518913300018643MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMP
Ga0193445_100738113300018648MarineRSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARS
Ga0193445_101263913300018648MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELPAKIGRC
Ga0193269_104486913300018656MarineLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKW
Ga0193067_105129013300018659MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFQRENFPGQAPTESLRTQDSENVYERWVQQIFDHVLVARSWVSA
Ga0193481_104400213300018688MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193387_100947613300018740MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0192902_100689343300018752MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFEQENFPGQVPTESLRTQDSEYVFERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193346_104322113300018754MarineVASKLWVHEPVTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAK
Ga0192839_103736513300018777MarineLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193197_101495713300018783MarineEISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193197_106656423300018783MarineEISEKWNFFVNRSVPENFQRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193298_104463913300018784MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0192928_102717323300018793MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKLLAV
Ga0193117_105762813300018796MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193388_101097413300018802MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKL
Ga0193281_105788813300018803MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVAR
Ga0193281_107119713300018803MarineLSPQQADGFFYQSDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVAR
Ga0193441_100295113300018807MarineVASKLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGP
Ga0193441_102682113300018807MarineMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGP
Ga0193497_105970813300018819MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPISVGRSWMSAKKWGPLAKLGVAKKWGPLAKLG
Ga0193053_106669613300018823MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSATKWGPLAK
Ga0192927_105090813300018837MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELPAKIGRC
Ga0193500_100850213300018847MarineLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193500_103669613300018847MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193120_103654823300018856MarineFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCDCNTS
Ga0193363_108265013300018857MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAK
Ga0192835_108250913300018863MarineLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSVKK
Ga0192859_105612813300018867MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKK
Ga0193553_100904623300018873MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLATAHFSCFFFVK
Ga0193279_108861013300018908MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSATK
Ga0193160_1000855713300018909MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI
Ga0193160_1000948113300018909MarineLSPQQADGFFYQSDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQMFDPVLVGRSWVSATKLGLLAKL
Ga0193176_1003841813300018912MarineVGTRARYFFLEAAREISEKRNFFVNRSVPENFERENFSGQVPTESLCTQDSENVYERWVQQMFDPVLVARSWVSKTKWGPLAKL
Ga0193096_1020772613300018924MarineLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193318_1017457313300018925MarineLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVAR
Ga0192921_1018532313300018929MarineSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI
Ga0192921_1022236813300018929MarineLQQADGFFYQSDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKLLGVAKKSHSHNFRI
Ga0193448_111933513300018937MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVA
Ga0193266_1004922213300018943MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVEKKCISQNLRI
Ga0193266_1006924213300018943MarineSTSGVPLKSLGYNGSNELCGRSVASKLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193066_1009770013300018947MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193066_1017287713300018947MarineLSPQQADGFFYQGDMKIREKGKFFVNRSVPENFQWEIFLGQVPTESLRTQDSENVYERWVQQIFDPVLVAR
Ga0193560_1001771813300018958MarineVASKLSPQQAGKKKMRVAMEFREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193560_1017061013300018958MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRIWA
Ga0193480_1009773013300018959MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0192930_1010198013300018960MarineSEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI
Ga0193332_1018767513300018963MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKF
Ga0193417_1018981413300018970MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193326_1005346213300018972MarineLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQILDHALVARSWVSATKWG
Ga0193330_1014670613300018973MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKLSAVEKK
Ga0193487_1026639223300018978MarineEISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKLLGVTKKCISQNLRI
Ga0193430_1006922523300018995MarineLLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERGVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193430_1010852123300018995MarineSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193430_1010852213300018995MarineSTSGVPLKSLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193078_1003730213300019004MarineSTSGVPLKSLGYNGSNELCGRSVASKLSLQQADGFFNQGDMKIREKRNFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLPARS
Ga0193078_1012773913300019004MarineSTSGVPLKSLGYNGSNELCGRSVASKLSLQQADGFFNQGDMKIREKRNFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193196_1016358013300019007MarineVCGTKLWVHEPDTFFLFEDTEISEKRNFFVNRSVPEKFQRENFSGQVPTESLRTQDSENVYERCVQQIFDPVSVARSWVSATKWGPLAKL
Ga0193196_1037662213300019007MarineVASKLWVREPDTFFLFEDTEICEKWNFLVNRSVPENFQRENFSGQVPTESLRTQDSENVYERCVQQIFDPVSVARSWVSATKWGPLAKL
Ga0193196_1041411113300019007MarineFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193196_1041855613300019007MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPISVGRSWMSAKKWGPLAKL
Ga0193361_1032219513300019008MarineFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKLLGVKKKCISQNLRI
Ga0192926_1010053643300019011MarineLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193557_1009221113300019013MarineSTSGVPLKSLGYNGSNELCGRSVASKLSPQQADGFFYQSDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI
Ga0192860_1014041213300019018MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKLLGVTKKCISQNLRI
Ga0193555_1025946613300019019MarineFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193449_1026123113300019028MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPISVGRSWMSAKKWGPLAKL
Ga0193449_1029039513300019028MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPKNFQWENFSGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELPAK
Ga0193189_1002130313300019044MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERCVQQIFDPVLVARVSATKWGPLAKL
Ga0193189_1007717213300019044MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERCVQQIFDPVLVARVSATKWGPLAKL
Ga0193208_1000412413300019055MarineGAVCQTIGTRSTSGVPLKNLGYNGSNELLGRSVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAK
Ga0193208_1046718213300019055MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFQRENFSGQVPTESLRTQDSENVYERWVQQMFDPVLVARSWVSATKWGPLAKL
Ga0193428_10081013300019071MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193428_10201913300019071MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQMFDPVLVARSWVSAKNGVR
Ga0193210_100579813300019074MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSATKWGPLAKL
Ga0193400_101124113300019107MarineFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0193515_106407713300019134MarineLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDPVLVARSWVSAKKWGPLAK
Ga0193112_111541913300019136MarineVGTRARYFFFWNFFVKRSVPENFQQENFSGQVPTESLRTQDSENVYERWVQQIFDPVSVGRSWMSAKKWGPLAKL
Ga0193112_114218823300019136MarineTHLSYTFFVNRSVPENFQWENFLGQVPTESLRTQDSGNVYERWVQQMFNPVLVARSWVSPKKWGPLAKL
Ga0193564_1001863633300019152MarineVASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLVARSWVSAKKWGPLAKL
Ga0208452_102527113300026104Marine OceanicLWVHEPDTFFLEAAREISEKWNFFVKRSVPENFQRENFPGQVPTESLRTQDSENVYERWVQQIFDYVLVARS
Ga0073985_1103156313300030918MarineLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKL
Ga0138346_1010518323300031056MarineVASKLWVHEPDTFFLEAAREISEKWNFFVKSSVPENFQRENFSGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.