NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059558

Metagenome / Metatranscriptome Family F059558

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059558
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 38 residues
Representative Sequence RSQLLISSIKGEVKKKHISNGWTFSCFAAHLIEQDLF
Number of Associated Samples 117
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.11 %
% of genes near scaffold ends (potentially truncated) 92.48 %
% of genes from short scaffolds (< 2000 bps) 86.47 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.489 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.564 % of family members)
Environment Ontology (ENVO) Unclassified
(27.068 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.158 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.46%    β-sheet: 0.00%    Coil/Unstructured: 61.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF02371Transposase_20 55.64
PF01548DEDD_Tnp_IS110 0.75
PF07883Cupin_2 0.75
PF03729DUF308 0.75
PF13620CarboxypepD_reg 0.75
PF13701DDE_Tnp_1_4 0.75
PF04193PQ-loop 0.75
PF04986Y2_Tnp 0.75
PF04101Glyco_tran_28_C 0.75
PF13181TPR_8 0.75
PF00990GGDEF 0.75
PF00691OmpA 0.75
PF00589Phage_integrase 0.75
PF00903Glyoxalase 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 56.39
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.49 %
UnclassifiedrootN/A4.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000912|JGI12032J12867_1002694All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300001086|JGI12709J13192_1004186All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300001164|JGI11823J13286_1004889All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300001181|JGI12663J13571_100493All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300002245|JGIcombinedJ26739_100606735All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300002245|JGIcombinedJ26739_101848440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300002718|JGI25454J38594_10007All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300002899|JGIcombinedJ43975_10062544All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300002917|JGI25616J43925_10299396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium599Open in IMG/M
3300005466|Ga0070685_10998746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300005602|Ga0070762_10682960All Organisms → cellular organisms → Bacteria → Acidobacteria688Open in IMG/M
3300009641|Ga0116120_1041152All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300010339|Ga0074046_10001168All Organisms → cellular organisms → Bacteria24185Open in IMG/M
3300010359|Ga0126376_13045996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010361|Ga0126378_13039101All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300010362|Ga0126377_12423596All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300012096|Ga0137389_11584898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300012582|Ga0137358_10195266All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300012582|Ga0137358_10340228All Organisms → cellular organisms → Bacteria → Acidobacteria1017Open in IMG/M
3300012912|Ga0157306_10155092All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300012915|Ga0157302_10161035All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300012916|Ga0157310_10059120All Organisms → cellular organisms → Bacteria → Acidobacteria1133Open in IMG/M
3300012930|Ga0137407_10764920All Organisms → cellular organisms → Bacteria → Acidobacteria911Open in IMG/M
3300012957|Ga0164303_10805492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300015241|Ga0137418_10008567All Organisms → cellular organisms → Bacteria → Acidobacteria9399Open in IMG/M
3300015241|Ga0137418_10227835All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300015245|Ga0137409_10130186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2313Open in IMG/M
3300017925|Ga0187856_1084066All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300018006|Ga0187804_10119534All Organisms → cellular organisms → Bacteria → Acidobacteria1094Open in IMG/M
3300018057|Ga0187858_10243557All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300019866|Ga0193756_1017875All Organisms → cellular organisms → Bacteria → Acidobacteria975Open in IMG/M
3300019880|Ga0193712_1012192All Organisms → cellular organisms → Bacteria1764Open in IMG/M
3300019887|Ga0193729_1064138All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300020008|Ga0193757_1007553All Organisms → cellular organisms → Bacteria → Acidobacteria1016Open in IMG/M
3300020012|Ga0193732_1052793All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300020140|Ga0179590_1015119All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300020170|Ga0179594_10152235All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300020199|Ga0179592_10062285All Organisms → cellular organisms → Bacteria1703Open in IMG/M
3300020579|Ga0210407_10552957All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300020581|Ga0210399_10058498All Organisms → cellular organisms → Bacteria → Acidobacteria3106Open in IMG/M
3300020582|Ga0210395_10170506All Organisms → cellular organisms → Bacteria → Acidobacteria1629Open in IMG/M
3300020583|Ga0210401_10176062All Organisms → cellular organisms → Bacteria1994Open in IMG/M
3300021086|Ga0179596_10058329All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300021170|Ga0210400_10197054All Organisms → cellular organisms → Bacteria1636Open in IMG/M
3300021171|Ga0210405_10876640All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300021178|Ga0210408_10192596All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300021180|Ga0210396_10107279All Organisms → cellular organisms → Bacteria → Acidobacteria2523Open in IMG/M
3300021307|Ga0179585_1131190All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300021404|Ga0210389_10196445All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300021406|Ga0210386_10068106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2860Open in IMG/M
3300021432|Ga0210384_10147566All Organisms → cellular organisms → Bacteria2110Open in IMG/M
3300021432|Ga0210384_10182712All Organisms → cellular organisms → Bacteria → Acidobacteria1884Open in IMG/M
3300021433|Ga0210391_10107952All Organisms → cellular organisms → Bacteria2192Open in IMG/M
3300021474|Ga0210390_10006851All Organisms → cellular organisms → Bacteria9463Open in IMG/M
3300021474|Ga0210390_10211556All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300021478|Ga0210402_10067014All Organisms → cellular organisms → Bacteria → Acidobacteria3166Open in IMG/M
3300021478|Ga0210402_10252466All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300021478|Ga0210402_10846518All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300021559|Ga0210409_10230987All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300021559|Ga0210409_10414327All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300021559|Ga0210409_10438564All Organisms → cellular organisms → Bacteria → Acidobacteria1165Open in IMG/M
3300022557|Ga0212123_10170167All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300022840|Ga0224549_1005154All Organisms → cellular organisms → Bacteria2011Open in IMG/M
3300023263|Ga0247800_1076836All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300024186|Ga0247688_1034875All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300024284|Ga0247671_1052423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300025898|Ga0207692_10338176All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300025898|Ga0207692_11068076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300025910|Ga0207684_10116187All Organisms → cellular organisms → Bacteria → Acidobacteria2292Open in IMG/M
3300025915|Ga0207693_10227533All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300025922|Ga0207646_10421516All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300025924|Ga0207694_11613316Not Available547Open in IMG/M
3300025935|Ga0207709_11719570All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300026294|Ga0209839_10035095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1881Open in IMG/M
3300026355|Ga0257149_1004748All Organisms → cellular organisms → Bacteria1616Open in IMG/M
3300026480|Ga0257177_1043285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300026873|Ga0207620_1001351All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300027050|Ga0209325_1005193All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300027122|Ga0207538_1001315All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300027178|Ga0207606_100070All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300027288|Ga0208525_1022301All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300027397|Ga0207463_100716All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300027403|Ga0207609_101734All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300027411|Ga0207519_100094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1723Open in IMG/M
3300027480|Ga0208993_1057889All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300027535|Ga0209734_1101005All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300027546|Ga0208984_1011845All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300027604|Ga0208324_1030610All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300027625|Ga0208044_1003613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7054Open in IMG/M
3300027633|Ga0208988_1028647All Organisms → cellular organisms → Bacteria1435Open in IMG/M
3300027643|Ga0209076_1026373All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300027671|Ga0209588_1033174All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300027671|Ga0209588_1034519All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300027671|Ga0209588_1073734Not Available1102Open in IMG/M
3300027737|Ga0209038_10027728All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300027737|Ga0209038_10032899All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300027783|Ga0209448_10207966All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300027821|Ga0209811_10235560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300027825|Ga0209039_10357272All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300027829|Ga0209773_10062368All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300027829|Ga0209773_10104371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1171Open in IMG/M
3300027846|Ga0209180_10113993All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300027855|Ga0209693_10371501All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300027884|Ga0209275_10042166All Organisms → cellular organisms → Bacteria2156Open in IMG/M
3300027889|Ga0209380_10627408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300027903|Ga0209488_10341110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1115Open in IMG/M
3300028138|Ga0247684_1094057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300028145|Ga0247663_1044040All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300028746|Ga0302233_10046185All Organisms → cellular organisms → Bacteria1797Open in IMG/M
3300028776|Ga0302303_10049153All Organisms → cellular organisms → Bacteria1651Open in IMG/M
3300028798|Ga0302222_10111217All Organisms → cellular organisms → Bacteria → Acidobacteria1088Open in IMG/M
3300028871|Ga0302230_10053869All Organisms → cellular organisms → Bacteria1694Open in IMG/M
3300028906|Ga0308309_10190309All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300029910|Ga0311369_10241151All Organisms → cellular organisms → Bacteria1651Open in IMG/M
3300029944|Ga0311352_10206585All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300030618|Ga0311354_10172568All Organisms → cellular organisms → Bacteria → Acidobacteria2338Open in IMG/M
3300030659|Ga0316363_10171781All Organisms → cellular organisms → Bacteria → Acidobacteria918Open in IMG/M
3300030935|Ga0075401_10042365All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300031128|Ga0170823_11567388All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300031446|Ga0170820_12441072Not Available950Open in IMG/M
3300031546|Ga0318538_10132395All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300031744|Ga0306918_10842030All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300031754|Ga0307475_11219878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300031771|Ga0318546_10077608All Organisms → cellular organisms → Bacteria2136Open in IMG/M
3300031947|Ga0310909_10676484All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300032035|Ga0310911_10094588All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300032076|Ga0306924_10307598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1818Open in IMG/M
3300032091|Ga0318577_10295986All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300032180|Ga0307471_100394417All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300032783|Ga0335079_12072435Not Available546Open in IMG/M
3300033289|Ga0310914_10475350All Organisms → cellular organisms → Bacteria → Acidobacteria1131Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.26%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.01%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.26%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.50%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.50%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.75%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.75%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000912Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3EnvironmentalOpen in IMG/M
3300001086Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3EnvironmentalOpen in IMG/M
3300001164Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1EnvironmentalOpen in IMG/M
3300001181Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002718Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5w-11EnvironmentalOpen in IMG/M
3300002899Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020008Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024284Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026873Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027122Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027178Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027397Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027403Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027411Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12032J12867_100269413300000912Forest SoilRLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF*
JGI12709J13192_100418623300001086Forest SoilRSHILISSIKGEVKKKHLSRGRNFSCFAAHLMEQDLF*
JGI11823J13286_100488923300001164Forest SoilFQLPISSIKGEVKKKHLCDGRSFSCFAAHVMEQGLF*
JGI12663J13571_10049313300001181Forest SoilHPDKFYKGRSSIKGEVKKKHTSFGWNFSCFAAPLIERNLF*
JGIcombinedJ26739_10060673533300002245Forest SoilTILLVMGSSIXGKVKKKHFSRGWNFSTFAAHLIEQDLF*
JGIcombinedJ26739_10184844013300002245Forest SoilSQLLXSSIKGEVKKKHISNGWTFSCFAAHLIEQDLF*
JGI25454J38594_1000723300002718SoilRVVAKVPVSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF*
JGIcombinedJ43975_1006254413300002899SoilRLRGQLLVCSLKGEVKKKHNCNGWIFSYFAAHLFEQDLF*
JGI25616J43925_1029939613300002917Grasslands SoilGTKSVANCLVSSIKVEVKKKHFCIGRTFSCFAAHLDEQDVF*
Ga0070685_1099874623300005466Switchgrass RhizosphereDGVKLGSDSTCLVSSLKGEVKKKHNCNGWIFSCFAAHLFEQDLF*
Ga0070762_1068296013300005602SoilVLISSIKVEVKKKHISTGCDFSCFSAHWMEQDLF*
Ga0116120_104115223300009641PeatlandMTGPRNFCQWMYSSIKGEVKKKHISFGWSFSCFAAHLIERDLF*
Ga0074046_1000116813300010339Bog Forest SoilMGVMSCQLLISSIKVEVKKKHSSAGWNFSRFAAHWMKQDLF*
Ga0126376_1304599613300010359Tropical Forest SoilGVAKAIKGEVKKKHHSNGWIFSCFAAHLFERDLF*
Ga0126378_1303910113300010361Tropical Forest SoilGVANALPPRRVLVSSLKGEVKKKHNSNGWIFSCFAAHLNEQDLF*
Ga0126377_1242359623300010362Tropical Forest SoilCLVCSIKGEVKKKHHSNGWIFSCFAAHLFEQDLF*
Ga0137389_1158489823300012096Vadose Zone SoilHILISSVKVEVKKKHFCIGRTFSCFAAHWMEQDLF*
Ga0137358_1019526623300012582Vadose Zone SoilEDNLMSSIKGEVKKKHSSNGGNFSCFVAHLIERDLC*
Ga0137358_1034022813300012582Vadose Zone SoilDPSISGQLLVSSLKGEVKKKHNRNGWIFSCFAAHLFEQDLF*
Ga0157306_1015509213300012912SoilQLLGSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF*
Ga0157302_1016103523300012915SoilVPVGSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF*
Ga0157310_1005912023300012916SoilMLSEQKEKRGKLLICSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF*
Ga0137407_1076492013300012930Vadose Zone SoilPRGLVSCSIKGEVKEKNIPCGWKFSCFAAHLIERDLF*
Ga0164303_1080549213300012957SoilRIKVGQLLICSIKEEVKKKHISFGRNFSCFSAHSIEQVLF*
Ga0137418_1000856733300015241Vadose Zone SoilVRYGYTGVARSQILISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF*
Ga0137418_1022783523300015241Vadose Zone SoilSIGLVSSIKGEVKKKHTSFGWNFSCFSAHLIKRDLF*
Ga0137409_1013018613300015245Vadose Zone SoilMRKTDVGLGQLLISSIKGEVKKKHTSLGWNFSCFAAPLIERNLF*
Ga0187856_108406613300017925PeatlandEESICSIKVEVKKKHVSFGWSFSCFAAHLIEQDLF
Ga0187804_1011953423300018006Freshwater SedimentLVSSIKVEVKKKHLSNGWPFPCFAAHLIEQDLFGSAAP
Ga0187858_1024355733300018057PeatlandMPKVLISSVKGEVKKKHLSIGWSFSCFAAHAMEQDLF
Ga0193756_101787513300019866SoilKRLVSSIKGEVKKKHISLGWNFSCFAAHLIERDLF
Ga0193712_101219213300019880SoilSFQVLISSIKGEVKKKHFSAGWNFSCFSAHWMEQDLF
Ga0193729_106413813300019887SoilFYKGRSSIKGEVKKKHISFGRTFSCFSAHLIERDLL
Ga0193757_100755323300020008SoilKQLPQLLISSIKGEVKKKHFSAGWNFSCFSAHWMEQDLF
Ga0193732_105279313300020012SoilKCFLLIAQVLISSIKGEVKKKHFSAGWNFSCFSAHWMEQDLF
Ga0179590_101511913300020140Vadose Zone SoilCCFGMCQLLVSSIKVEVKKKHLSNGWPFPRFAAHVIEQDLF
Ga0179594_1015223533300020170Vadose Zone SoilRSVALCGQVLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF
Ga0179592_1006228523300020199Vadose Zone SoilGRHNRKNQLDRSIKVEVKKKHLSNGWPFPRFAAHVIEQDLF
Ga0210407_1055295713300020579SoilASIQQHLISSIKEEVKKKHFSLGWKFSCFSAHTIERELF
Ga0210399_1005849833300020581SoilQTHRARKLIRSIKVEVKKKHFSFGWNFSCFAAHLIEQDLF
Ga0210395_1017050613300020582SoilIRGQVLISSIKGEVKKKHFSGGRSFSCFPAHVIERELF
Ga0210401_1017606213300020583SoilQRNPHQVLISSIKVEVKKKHLSNGWTFSCFAAHFIEQDLF
Ga0179596_1005832913300021086Vadose Zone SoilEKCLISSIKREVKKKHICNGWTFSCFAAHLKEQDLF
Ga0210400_1019705423300021170SoilYLDMSQLPISSIKVEVKKKYNPSGRKFSCFAAHLIERDLF
Ga0210405_1087664023300021171SoilAESCLVSSIKGEVKKKHLCNGWPFPRFAAHVIEQDLF
Ga0210408_1019259623300021178SoilELLMSSLKGEVKKKHTANGWIFSCFSAHLFEQDLF
Ga0210396_1010727933300021180SoilNRRQLLIRSIKREVKKKHFRIGRSVSCFAAHLIELDRF
Ga0179585_113119023300021307Vadose Zone SoilARMATSPVSSIKGEVKKKHFSAGWKFSCFAAHIIEQDLY
Ga0210389_1019644513300021404SoilQLLICSIKREVKKKHFRIGRSVSCFAAHLIELDRF
Ga0210386_1006810633300021406SoilGQLLVSSIKREVKKKHFRIGRSVSCFAAHLIELDRF
Ga0210384_1014756613300021432SoilSESQVLRSSIKGEVKEKHLSRGRSFSFFAARLIEQDLF
Ga0210384_1018271223300021432SoilVGESKGLVSSIKGEVKKKHISFGWNFSCFAAHLIEQDLF
Ga0210391_1010795213300021433SoilCSKVQMRLDGQLPISSIKREVKKKQFRIGRSFSCFAAYLIELDLF
Ga0210390_1000685113300021474SoilNESQLLVSSIKVEVKKKHFPFGRNFSCFAAHVMEQDLF
Ga0210390_1021155613300021474SoilRQILISSIKVEVKKKHISTGCDFSCFSAHWMEQDLF
Ga0210402_1006701413300021478SoilPLRAGKQKLIRSIKVEVKKKHFSFGWNFSCFAAHLIEQDLF
Ga0210402_1025246613300021478SoilGQLLRSSLKGEVKKKHTANGWIFSCFSAHLFEQDLF
Ga0210402_1084651823300021478SoilDAPQDQLLVSSIKVEVKKEHVSNGWTFSSFAAHLIEQDLF
Ga0210409_1023098713300021559SoilREHNSGQLPISSIKVEVKKKYNPSGRKFSCFAAHLIERDLF
Ga0210409_1041432713300021559SoilAPRQHLVRSLKGEVKKKHTANGWIFSCFSAHLFEQDLF
Ga0210409_1043856423300021559SoilEFLRSSIKREVKKKHFRIGRSVSCFAAHLIELDRF
Ga0212123_1017016713300022557Iron-Sulfur Acid SpringRSQLLISSIKGEVKKKHISNGWTFSCFAAHLIEQDLF
Ga0224549_100515413300022840SoilPLQVLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF
Ga0247800_107683613300023263SoilTHQLPVSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF
Ga0247688_103487523300024186SoilPQVVLVSSIKVEVKKKHNSNGWNFSCFAAHLMEQDLF
Ga0247671_105242323300024284SoilESALVSSIKVEVKKKHNSNGWNFSCFAAHLMEQDLF
Ga0207692_1033817613300025898Corn, Switchgrass And Miscanthus RhizosphereKVLISSLKGEVKKKHHSNSWIFSCFAAHRLEQDLF
Ga0207692_1106807613300025898Corn, Switchgrass And Miscanthus RhizosphereSNSYCPVSSLKGEVKKKHNSNGWSFSCFAAHLVEQGLF
Ga0207684_1011618713300025910Corn, Switchgrass And Miscanthus RhizosphereCARPVKPFGRSLKGEVKKKHNSNGWTFSCFAAQLFEQDLF
Ga0207693_1022753323300025915Corn, Switchgrass And Miscanthus RhizosphereLPNDEQDGSNSYCPVSSLKGEVKKKHNSNGWSFSCFAAHLVEQGLF
Ga0207646_1042151623300025922Corn, Switchgrass And Miscanthus RhizosphereAWLERSIKGEVKKKHISCGWNFSCFAAHLIERDLF
Ga0207694_1161331613300025924Corn RhizosphereSQLLVCSLKGEVKKKHHCNGWIFSCFAAHLFEQDLF
Ga0207709_1171957013300025935Miscanthus RhizosphereQGLDGVKLGSDSTCLVSSLKGEVKKKHNCNGWIFSCFAAHLFEQDLF
Ga0209839_1003509513300026294SoilTRLSPRRQVLISSIKVEVKKKHISFGWNFSRFAAHWIERDLF
Ga0257149_100474813300026355SoilRVPSQVLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF
Ga0257177_104328513300026480SoilINDQLLISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF
Ga0207620_100135113300026873SoilKLLICSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF
Ga0209325_100519323300027050Forest SoilISAFGRSLKGEVKKKHNSDGWTFSCFAAQLFEQDLF
Ga0207538_100131513300027122SoilLLLISSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF
Ga0207606_10007013300027178SoilEKRGKLLICSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF
Ga0208525_102230113300027288SoilLGIYSTCLCSSIKVEVKKKHISFGWNFSCFAAHLIERDLF
Ga0207463_10071613300027397SoilEAFYHPTDGLLLISSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF
Ga0207609_10173423300027403SoilCVCPSNQLLGSSIKGKVKKKHFSRGWNFSTFAAHLIEQDLF
Ga0207519_10009413300027411SoilAKVPVSSLKGEVKNKHNRNGWIFSCFAAHLFEQDLF
Ga0208993_105788923300027480Forest SoilRSQVPISSIKEEVKKKHTSFGWNFSCFAAPLIERNLF
Ga0209734_110100513300027535Forest SoilRFEAWPSSIKVEVKKKHFSVGRNFSCFAARLIERDLF
Ga0208984_101184513300027546Forest SoilASVVALIGSIKGEFKKKHLCDGRSFSCFAAHVMEQGLF
Ga0208324_103026413300027604Peatlands SoilSALSETVLFLISSIKGEVKKKHICNGWTFSCFAAHWIEQDLF
Ga0208324_103061013300027604Peatlands SoilRRRLESSIKGEVKKKHLSDGWNFSCFAAHLIERGLF
Ga0208044_100361363300027625Peatlands SoilEQLSQLLVSSIKGEVKKKHLSDGWNFSCFAAHLIERGLF
Ga0208988_102864723300027633Forest SoilQILISSIKGEVKKKHLCDGRSFSCFAAHVMEQGLF
Ga0209076_102637313300027643Vadose Zone SoilQILISSIKVEVKKKHPSHGRTFSCFAAHLIEQDLF
Ga0209588_103317413300027671Vadose Zone SoilRLRLALEPECSIKGEVKKKHFSAGWKFSCFAAHIIEQDLY
Ga0209588_103451923300027671Vadose Zone SoilAFPISSIKGEVKKKHISIGRNFSCFSAHLIERDLF
Ga0209588_107373413300027671Vadose Zone SoilVKSWYATCPVRSIKGEVKKKHFSAGWKFSCFAAHIIEQDL
Ga0209038_1002772823300027737Bog Forest SoilGQSCEAPKLLISSIKVEVKKKHISFGRDFSCFSAHWMEQDLF
Ga0209038_1003289913300027737Bog Forest SoilTPLTQLLVSSIKGGVKKKHFSTGWNVSCFSAHLDEQNLF
Ga0209448_1020796613300027783Bog Forest SoilSLGQLPISSIKGEVKKKHTSFGWSFSCFAAPLIERNLF
Ga0209811_1023556023300027821Surface SoilDKRIADQLPISSIKVEVKKKHNSNGWNFSCFAAHLMERDLF
Ga0209039_1035727223300027825Bog Forest SoilQLLISSIKVEVKKKHSSAGWNFSRFAAHWMKQDLF
Ga0209773_1006236813300027829Bog Forest SoilLQRTFSQVLISSIKGEVKKKHLSIGWKFSCFAAHTIEGELF
Ga0209773_1010437123300027829Bog Forest SoilMLDAGASVGQVLVSSIKEEVKKKDISIGWNFSCFSAHLIE
Ga0209180_1011399323300027846Vadose Zone SoilVSDLISSIKVEVKKKHVSFGWNFSCFTAHLIERDLF
Ga0209180_1039137613300027846Vadose Zone SoilLFKPKRRQVLICSIRGKVKKKNFSRGWNFSTFAAHLIEQDLF
Ga0209693_1037150123300027855SoilRVPRSSIKGEVKKKHLSAGWKFSCFAAHMMEQDLF
Ga0209275_1004216613300027884SoilSTWLISSIKVEVKKKHFPFGWNFSCFAAHVMEQDLF
Ga0209380_1062740823300027889SoilRFLTRQRLISSIKGEVKKKHISHGRSFSCFPAPVIERDLF
Ga0209488_1034111013300027903Vadose Zone SoilMGQVLRSSIKGGVKKKHICFDRNFSCFPAHWIERDL
Ga0247684_109405713300028138SoilAFSSHLISSIKVEVKKKHFRAGWNFSCFAAHLMEQDLF
Ga0247663_104404013300028145SoilQADQILISSLKGEVKKKHNSNGWSFSCFAAHLFEQGLF
Ga0302233_1004618543300028746PalsaLCTSIGSIKAEDKKKHYFIGRTFARFAAHLIEQNLL
Ga0302303_1004915313300028776PalsaSFTARLQRLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF
Ga0302222_1011121713300028798PalsaYTFSPFHAEVLISSIKGEVKKKHISCGWTFSCFAAHLIERDVF
Ga0302230_1005386923300028871PalsaRLQRLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF
Ga0308309_1019030923300028906SoilGLDCRQLLISSIKREVKKKQFRIGRSFSCFAAYLIELDLF
Ga0311369_1024115123300029910PalsaSCTARLQRLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF
Ga0311352_1020658533300029944PalsaWKNFAGPRQLLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF
Ga0311354_1017256833300030618PalsaRKTVTCLISSIKVEVKKKHFSFGWNFSCFAAHLIERELF
Ga0316363_1017178113300030659Peatlands SoilVCQQAASSIKGEVKKKHISNGWTFSCFAAHLMERNLF
Ga0075401_1004236523300030935SoilQVLISSIKVEVKKKHLANGWPFSCFAAHWIEQDLF
Ga0170823_1156738813300031128Forest SoilAQLLVSSLKGEVKKKHNSVGWIFSCFAAPLNEQDLF
Ga0170820_1244107213300031446Forest SoilMDDSAFGRSLKGEVKKKHNSNGWTFSCFTAQLFEQDLF
Ga0318538_1013239523300031546SoilFPLKQLLVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF
Ga0306918_1084203013300031744SoilSEGQVLVCSLKGEVKKKHNSNGRIFSCFAAHLFEQDLF
Ga0307475_1121987823300031754Hardwood Forest SoilFLLISSIEGKVKKKHSCIGRNFSCFAGYLVEQDLF
Ga0318546_1007760833300031771SoilQVPVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF
Ga0310909_1067648423300031947SoilGRTVLICSLKGEVKKKDNPVGWIFSCFAAHLCEQDLF
Ga0310911_1009458813300032035SoilDERQLLVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF
Ga0306924_1030759833300032076SoilKVLVSSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF
Ga0318577_1029598623300032091SoilAMRIQVLISSLKGEVKKKHKCNGWSFSCFTAHLFEQDLF
Ga0307471_10039441723300032180Hardwood Forest SoilLVEQGSLKGEVKKKHNSNGWSFSCFAAHLVEQGLF
Ga0335079_1207243523300032783SoilKVPVSSIKGEVKKKHISYGRNLSCFTADLIEQDLF
Ga0310914_1047535013300033289SoilWGRTVLICSLKGEVKKKDNPVGWIFSCFAAHLCEQDLF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.