Basic Information | |
---|---|
Family ID | F059858 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 45 residues |
Representative Sequence | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGA |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.64 % |
% of genes near scaffold ends (potentially truncated) | 94.74 % |
% of genes from short scaffolds (< 2000 bps) | 78.95 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.489 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.865 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.880 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF01103 | Omp85 | 74.44 |
PF07244 | POTRA | 18.80 |
PF00496 | SBP_bac_5 | 3.01 |
PF01923 | Cob_adeno_trans | 0.75 |
PF13738 | Pyr_redox_3 | 0.75 |
PF01761 | DHQ_synthase | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.49 % |
Unclassified | root | N/A | 4.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1053559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
3300002916|JGI25389J43894_1071848 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
3300005174|Ga0066680_10062573 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
3300005178|Ga0066688_10608364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 702 | Open in IMG/M |
3300005187|Ga0066675_10465466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 941 | Open in IMG/M |
3300005294|Ga0065705_10923018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 566 | Open in IMG/M |
3300005436|Ga0070713_100893463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 854 | Open in IMG/M |
3300005440|Ga0070705_101624281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
3300005450|Ga0066682_10029694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3189 | Open in IMG/M |
3300005468|Ga0070707_100235716 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1781 | Open in IMG/M |
3300005518|Ga0070699_100507970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1095 | Open in IMG/M |
3300005518|Ga0070699_101770976 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 565 | Open in IMG/M |
3300005549|Ga0070704_100173434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1718 | Open in IMG/M |
3300005554|Ga0066661_10533134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
3300005556|Ga0066707_10940762 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300005557|Ga0066704_10017899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4116 | Open in IMG/M |
3300005557|Ga0066704_10745277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
3300005560|Ga0066670_10295395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 985 | Open in IMG/M |
3300005576|Ga0066708_10972872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300005586|Ga0066691_10432358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 785 | Open in IMG/M |
3300005598|Ga0066706_10077697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2344 | Open in IMG/M |
3300005880|Ga0075298_1025833 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300006031|Ga0066651_10174251 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1134 | Open in IMG/M |
3300006031|Ga0066651_10498823 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
3300006034|Ga0066656_10069556 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300006755|Ga0079222_10117301 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300006797|Ga0066659_10263916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1296 | Open in IMG/M |
3300006797|Ga0066659_10711930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 822 | Open in IMG/M |
3300006804|Ga0079221_10179617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1139 | Open in IMG/M |
3300006804|Ga0079221_11680581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
3300006854|Ga0075425_101613078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 731 | Open in IMG/M |
3300006904|Ga0075424_102328786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
3300006914|Ga0075436_100118481 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300006914|Ga0075436_100244398 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300007265|Ga0099794_10642048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 563 | Open in IMG/M |
3300009012|Ga0066710_102060669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 841 | Open in IMG/M |
3300009089|Ga0099828_11164687 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 684 | Open in IMG/M |
3300009089|Ga0099828_11584728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
3300009090|Ga0099827_10105801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2244 | Open in IMG/M |
3300009090|Ga0099827_10293908 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1373 | Open in IMG/M |
3300009090|Ga0099827_11739568 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
3300009137|Ga0066709_102508577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
3300009137|Ga0066709_104702162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
3300009162|Ga0075423_12036930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 622 | Open in IMG/M |
3300009162|Ga0075423_13169736 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300009610|Ga0105340_1003819 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6271 | Open in IMG/M |
3300009821|Ga0105064_1140073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
3300010303|Ga0134082_10001040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9794 | Open in IMG/M |
3300010304|Ga0134088_10029025 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
3300010322|Ga0134084_10028287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1554 | Open in IMG/M |
3300010322|Ga0134084_10252995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 637 | Open in IMG/M |
3300010325|Ga0134064_10392067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
3300010326|Ga0134065_10170425 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
3300010326|Ga0134065_10258948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 652 | Open in IMG/M |
3300010335|Ga0134063_10687171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300010336|Ga0134071_10147596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1142 | Open in IMG/M |
3300010336|Ga0134071_10520192 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300010337|Ga0134062_10018768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2624 | Open in IMG/M |
3300010337|Ga0134062_10055638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1621 | Open in IMG/M |
3300010337|Ga0134062_10275836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 789 | Open in IMG/M |
3300011438|Ga0137451_1154490 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300012198|Ga0137364_10743007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 741 | Open in IMG/M |
3300012199|Ga0137383_10522613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 869 | Open in IMG/M |
3300012207|Ga0137381_11485209 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012208|Ga0137376_10113947 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
3300012211|Ga0137377_10220839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1820 | Open in IMG/M |
3300012211|Ga0137377_11031745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 753 | Open in IMG/M |
3300012349|Ga0137387_10582457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 812 | Open in IMG/M |
3300012351|Ga0137386_10148869 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300012355|Ga0137369_10730909 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012360|Ga0137375_10321985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1387 | Open in IMG/M |
3300012532|Ga0137373_11119001 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012922|Ga0137394_11602409 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
3300012927|Ga0137416_10107663 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300012972|Ga0134077_10122035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1023 | Open in IMG/M |
3300012976|Ga0134076_10040940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1723 | Open in IMG/M |
3300014150|Ga0134081_10220285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 652 | Open in IMG/M |
3300014157|Ga0134078_10047982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1467 | Open in IMG/M |
3300017654|Ga0134069_1216100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 658 | Open in IMG/M |
3300017657|Ga0134074_1230725 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 662 | Open in IMG/M |
3300018072|Ga0184635_10351924 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300018084|Ga0184629_10719724 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
3300018433|Ga0066667_10783089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 809 | Open in IMG/M |
3300018482|Ga0066669_10233469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1439 | Open in IMG/M |
3300018482|Ga0066669_11080630 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 724 | Open in IMG/M |
3300019882|Ga0193713_1007523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3362 | Open in IMG/M |
3300020022|Ga0193733_1119263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
3300021081|Ga0210379_10045046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1741 | Open in IMG/M |
3300021086|Ga0179596_10039376 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1890 | Open in IMG/M |
3300024330|Ga0137417_1021775 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3046 | Open in IMG/M |
3300024330|Ga0137417_1021776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3166 | Open in IMG/M |
3300025318|Ga0209519_10184102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1233 | Open in IMG/M |
3300025326|Ga0209342_10060746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3556 | Open in IMG/M |
3300025885|Ga0207653_10049071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1400 | Open in IMG/M |
3300025917|Ga0207660_10005169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8483 | Open in IMG/M |
3300025929|Ga0207664_10717810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 899 | Open in IMG/M |
3300026005|Ga0208285_1017799 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300026075|Ga0207708_11012268 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300026305|Ga0209688_1049809 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300026306|Ga0209468_1130381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
3300026307|Ga0209469_1095604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 840 | Open in IMG/M |
3300026313|Ga0209761_1285285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
3300026324|Ga0209470_1078500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1517 | Open in IMG/M |
3300026326|Ga0209801_1005156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7242 | Open in IMG/M |
3300026326|Ga0209801_1236546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
3300026327|Ga0209266_1075161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1557 | Open in IMG/M |
3300026329|Ga0209375_1215419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 703 | Open in IMG/M |
3300026331|Ga0209267_1024813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2946 | Open in IMG/M |
3300026334|Ga0209377_1228274 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300026335|Ga0209804_1048187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2089 | Open in IMG/M |
3300026527|Ga0209059_1099905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1182 | Open in IMG/M |
3300026538|Ga0209056_10098892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2387 | Open in IMG/M |
3300027738|Ga0208989_10197365 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
3300028536|Ga0137415_10174304 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1978 | Open in IMG/M |
3300028719|Ga0307301_10163983 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300028811|Ga0307292_10090536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1193 | Open in IMG/M |
3300028884|Ga0307308_10255032 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300031720|Ga0307469_10209756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1529 | Open in IMG/M |
3300031720|Ga0307469_10539605 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300031962|Ga0307479_10229934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1829 | Open in IMG/M |
3300031962|Ga0307479_10256303 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1728 | Open in IMG/M |
3300032174|Ga0307470_10031942 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
3300032180|Ga0307471_100640351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1224 | Open in IMG/M |
3300033407|Ga0214472_10812484 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 840 | Open in IMG/M |
3300033811|Ga0364924_099524 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300033815|Ga0364946_140432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
3300034178|Ga0364934_0404904 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.31% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.04% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.02% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.51% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.76% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.26% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.26% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.26% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.50% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.50% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10535592 | 3300002557 | Grasslands Soil | MVXRSLGVALWSLVGLLACXLGALDALVGTHAGRTLLARVGSAAIQ |
JGI25389J43894_10718482 | 3300002916 | Grasslands Soil | MVRRSLGVALWTLAGLLACFLGALASLVGTDAGRALLTRVTAAALHQVFTGTVEIGDVG |
Ga0066680_100625731 | 3300005174 | Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRALLARVMESALA |
Ga0066680_106101261 | 3300005174 | Soil | MRRSLGVALWSLVGLLACFLGALNALVGTHAGRTLLALVASTVVEGAVN |
Ga0066688_106083641 | 3300005178 | Soil | MVRRSLGVALWMLAGLLACFLGALGSLVGTDAGRALLTRVTAGALHQVFTG |
Ga0066675_104654661 | 3300005187 | Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRALLTRVT |
Ga0065705_109230181 | 3300005294 | Switchgrass Rhizosphere | MVRRSLGVALWSLVGLLACFLGALNGLVGTRAGRSLLARIA |
Ga0070713_1008934631 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRSLGAALWTLVGLLAGFLGALSSLVGTEAGRDLLTRVTEGGLRQVFTGTVEIG |
Ga0070705_1016242812 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALRQVFTGTVEIG |
Ga0066682_100296941 | 3300005450 | Soil | LWTLVGLLAGFLGALSSLVGTGAGRSLLARVSEGALQHVF |
Ga0070707_1002357162 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALRQV |
Ga0070699_1005079701 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSLGAALWTLVGLLACFLGALNALVGTHAGRTLLARVASSVVEGA |
Ga0070699_1017709761 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALRQ |
Ga0070704_1001734342 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVASS |
Ga0066661_105331341 | 3300005554 | Soil | MVRRSLGVALWGVVGLLAVSLGALSALIGTGAGRTLVARAAEGALRQVFTG |
Ga0066707_109407622 | 3300005556 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALHQVFTGTMEI |
Ga0066704_100178991 | 3300005557 | Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRGLLARVMESALA |
Ga0066704_107452771 | 3300005557 | Soil | MRRSLGVALWTLVGLVACVFGALSALVGTHRGRALLARAAEAGLKRVF |
Ga0066670_102953952 | 3300005560 | Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRALL |
Ga0066708_109728722 | 3300005576 | Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTL |
Ga0066691_104323582 | 3300005586 | Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRALLTRVTA |
Ga0066706_100776971 | 3300005598 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTL |
Ga0075298_10258332 | 3300005880 | Rice Paddy Soil | LIRRSLGAALWFLAGLLACFLGALASLTGTGAGRTLLARSATRALA |
Ga0066651_101742512 | 3300006031 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEG |
Ga0066651_104988231 | 3300006031 | Soil | MRRSLGVALWTLVGLLACFLGALNALVGTRAGRTLLARVAST |
Ga0066656_100695561 | 3300006034 | Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRALLARVTESALARVFTGSI |
Ga0079222_101173012 | 3300006755 | Agricultural Soil | MVRRSLGAALWMLVGLVACFLGALSSLVGTGAGRTLLARVSEGALRRCSLAQ* |
Ga0066659_102639161 | 3300006797 | Soil | MVRRSLGVALWMLAGLLASFLGALASLVGTDAGRALLTRVTAGALHQVFTGTIEI |
Ga0066659_107119301 | 3300006797 | Soil | MIRRSLGAALWTLVALLAGFLGALSSLVGTGAGRALLARVSEGALRQAFTGTVEI |
Ga0079221_101796171 | 3300006804 | Agricultural Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLAR |
Ga0079221_116805811 | 3300006804 | Agricultural Soil | VRRSLAVLLWIIAGLLACFLGTLSGLVNTAAGRALLGA |
Ga0075425_1016130781 | 3300006854 | Populus Rhizosphere | MIRRSLGVALWSLVGLLACLLGALNALVGTRAGRT |
Ga0075424_1023287862 | 3300006904 | Populus Rhizosphere | MIRRSLGVALWSLVGLLACLLGALNGLVATRAGRALLARVGSAAVA |
Ga0075436_1001184812 | 3300006914 | Populus Rhizosphere | MRRSLGVALWSLVGLLACFLGALNALVGTHAGRTM |
Ga0075436_1002443981 | 3300006914 | Populus Rhizosphere | MVRRSLGVALWTIVGLLACFLGALSALVGTGAGRSLLARVAESSL |
Ga0099794_106420482 | 3300007265 | Vadose Zone Soil | MVRRSLGVALWILAGLLACFLGALASLVGTGAGRALL |
Ga0066710_1020606691 | 3300009012 | Grasslands Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRALLARVMESALARVFTG |
Ga0099828_111646871 | 3300009089 | Vadose Zone Soil | MVRRSLGVALWSVVGLLACFLGALSALVGTEAGRTLLARTAEGALQQVF |
Ga0099828_115847281 | 3300009089 | Vadose Zone Soil | MVRRSLGVALWTVVGLLACLLGALSALVGTGAGRTLLARVTENALGRVFTGSVEVG |
Ga0099827_101058012 | 3300009090 | Vadose Zone Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALL |
Ga0099827_102939082 | 3300009090 | Vadose Zone Soil | MRRSLGVALWSLVGLLACFLGALNALVGTRAGRTLLARVASSVV |
Ga0099827_117395682 | 3300009090 | Vadose Zone Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGA |
Ga0066709_1025085772 | 3300009137 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALHQVFTGTMEIG |
Ga0066709_1047021622 | 3300009137 | Grasslands Soil | VRRSLGVALWTLVGLVACVFGALSALVGTHRGRALLARA |
Ga0075423_120369301 | 3300009162 | Populus Rhizosphere | MVRRSLGAALWSLVGLFACFLGGLSALVGTGSGRALLARIASRVVAGAI |
Ga0075423_131697361 | 3300009162 | Populus Rhizosphere | MVRRSLGVALWSLVGLLACFLGALNGLVGTRAGRALLS |
Ga0105340_10038196 | 3300009610 | Soil | MVRHSLAAALWLVVGLLASFLGALSALVGTGAGRQLVTRVATGALRQ |
Ga0105064_11400732 | 3300009821 | Groundwater Sand | MIRRSLGVALWSLVGLLACFLGALNALVGTRAGRTMLARVASAAVE |
Ga0134082_1000104010 | 3300010303 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGA |
Ga0134088_100290251 | 3300010304 | Grasslands Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRGLLARVMESALAQVFTG |
Ga0134084_100282872 | 3300010322 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALHQVF |
Ga0134084_102529951 | 3300010322 | Grasslands Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRALLTRVTAGALHQ |
Ga0134064_103920671 | 3300010325 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSE |
Ga0134065_101704251 | 3300010326 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRAL |
Ga0134065_102589482 | 3300010326 | Grasslands Soil | MRRSLGVALWTLVGLVACVLGALSALVGTHRGRALLARAA |
Ga0134111_101540801 | 3300010329 | Grasslands Soil | MRRSLGVALWSLVGLLACFLGALNALVGTHAGRTLLARVASAAVESAV |
Ga0134063_106871712 | 3300010335 | Grasslands Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRALLTRVTAGALHQVF |
Ga0134071_101475962 | 3300010336 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALRQVF |
Ga0134071_105201922 | 3300010336 | Grasslands Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLAR |
Ga0134062_100187683 | 3300010337 | Grasslands Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRALLTRVTVGALHQVFTGTIEVGDVGG |
Ga0134062_100556382 | 3300010337 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALRQVFTGRAE |
Ga0134062_102758361 | 3300010337 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALHQV |
Ga0137439_11357371 | 3300011424 | Soil | MRRSLGVALWSLVGLLACFLGALNALVGTRAGRTLLARLGSAAIESAVA |
Ga0137451_11544901 | 3300011438 | Soil | MVRRSLGVALWSLVGLLACFLGALNGLVGTRAGRALLARIASNAVERSIS |
Ga0137364_107430072 | 3300012198 | Vadose Zone Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVS |
Ga0137383_105226131 | 3300012199 | Vadose Zone Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVASTVVEGA |
Ga0137382_100624412 | 3300012200 | Vadose Zone Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVASTVVEGAVD |
Ga0137381_114852092 | 3300012207 | Vadose Zone Soil | MRRSLGVALWSLVGLLACFLGALNGLVGTRAGRTLLARVAS |
Ga0137376_101139472 | 3300012208 | Vadose Zone Soil | MRRSLGVALWTLVGLLACFLGALNALVGTRAGRTMLARVASTVVE |
Ga0137377_102208392 | 3300012211 | Vadose Zone Soil | MIRRSLGVALWSLVGLLACFLGALNALVGTHAGRSLLA |
Ga0137377_110317452 | 3300012211 | Vadose Zone Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLA |
Ga0137387_105824571 | 3300012349 | Vadose Zone Soil | MIRRSLGAALWTLVGLRAGFLGALSSLVGTGAGRALLAR |
Ga0137386_101488692 | 3300012351 | Vadose Zone Soil | MRRSLGVALWSLVGLLACFLGALNALVGTRAGRTLLARVASSVVESG |
Ga0137369_107309091 | 3300012355 | Vadose Zone Soil | MRRSLGVALWTLVGLLACFLGALNALVGTRAGRTLLARVASTVVEGA |
Ga0137375_103219851 | 3300012360 | Vadose Zone Soil | MFRRSLGVALWSLVGLLACFLGALNGLVGTRAGRSL |
Ga0137373_111190012 | 3300012532 | Vadose Zone Soil | MVRRSLGAALWSLVGLLACFLGALNGLVGTHAGRSLLARVASSVA |
Ga0137394_116024091 | 3300012922 | Vadose Zone Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSE |
Ga0137416_101076632 | 3300012927 | Vadose Zone Soil | MRRSLGVALWSLVGLLACFLGALNALVGTEAGRTLLA |
Ga0134077_101220352 | 3300012972 | Grasslands Soil | MRRSLGVALWTLVGLVACVFGALSALVGTHRGRALLARAAE |
Ga0134076_100409401 | 3300012976 | Grasslands Soil | VRRSLGVALWTLAGLVACVFGALSALVGTHRGRALLA |
Ga0134081_102202851 | 3300014150 | Grasslands Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRALLARVMENALAQV |
Ga0134078_100479821 | 3300014157 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALRQVFTG |
Ga0134069_12161002 | 3300017654 | Grasslands Soil | MRRSLGVALWSLVGLLACFLGALNALVGTHAGRTLLARV |
Ga0134074_12307251 | 3300017657 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALHQVFTGT |
Ga0184635_103519242 | 3300018072 | Groundwater Sediment | MFRRSLGVALWSLVGLLACFLGALNGLVGTRAGRSLLARIASNAI |
Ga0184629_107197241 | 3300018084 | Groundwater Sediment | MRRSLGVALWSLVGLLACFLGALNALVGTRAGRTMLARV |
Ga0066667_107830892 | 3300018433 | Grasslands Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRAL |
Ga0066669_102334691 | 3300018482 | Grasslands Soil | MVRRSLGVALWMLAGLLACFLGALASLVGTDAGRALLTRVTAGG |
Ga0066669_110806302 | 3300018482 | Grasslands Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALRQAFTG |
Ga0193713_10075233 | 3300019882 | Soil | MVRRSLGVALWSLVGLLACFLGALNGLVGTRAGRSLLA |
Ga0193733_11192632 | 3300020022 | Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVASTVV |
Ga0210379_100450461 | 3300021081 | Groundwater Sediment | MVRRSLGVFLWSLVGLLAVFLGALSSLVGTGAGRALLARLSAAALETVVAGK |
Ga0179596_100393762 | 3300021086 | Vadose Zone Soil | MFRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARV |
Ga0137417_10217753 | 3300024330 | Vadose Zone Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVASTVVEG |
Ga0137417_10217761 | 3300024330 | Vadose Zone Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVAST |
Ga0209519_101841021 | 3300025318 | Soil | MVRRSLGVALWSLVGLLACFLGALNGLVGTRAGRSLL |
Ga0209342_100607463 | 3300025326 | Soil | MVRRSLGVALWSIAGLLACFLGALSALVGTGAGRQLLARVAESSLGHVF |
Ga0207653_100490711 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLL |
Ga0207660_100051698 | 3300025917 | Corn Rhizosphere | MRRSLGVALWSMVGLLACFLGALNALVGTRAGRTMMARIASG |
Ga0207664_107178101 | 3300025929 | Agricultural Soil | MVRRSLGAALWTLVGLLAGFLGALSSLVGTEAGRDLLTRVTEGGLR |
Ga0208285_10177991 | 3300026005 | Rice Paddy Soil | LIRRSLGAALWFLAGLLACFLGALASLTGTGAGRTLLARSATRALANV |
Ga0207708_110122682 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRSLGVALWSMVGLLACFLGALNALVGTRAGRTMMARIASGAV |
Ga0209235_12477781 | 3300026296 | Grasslands Soil | MIRRSLGVALWSLVGLLACFLGALNALVGTQAGRTLLARIASAAVQNA |
Ga0209688_10498091 | 3300026305 | Soil | MRRSLGVALWTLVGLLACFLGALNALVATHAGRTLLARL |
Ga0209468_11303811 | 3300026306 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALHQVFTGTA |
Ga0209469_10956042 | 3300026307 | Soil | MVRRSLGVALWMIVGLLACFLGALSALVGTGAGRALLARVMENALAQVFTG |
Ga0209761_12852851 | 3300026313 | Grasslands Soil | MRRSLGVALWTLVGLVACVFGALSALVGTHRGRALLARAA |
Ga0209686_12142141 | 3300026315 | Soil | MRRSLGVALWTLVGLLACFLGALNALVGTHAGRTLLARVASTVVEGAVHGS |
Ga0209470_10785001 | 3300026324 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEG |
Ga0209801_10051561 | 3300026326 | Soil | MVRRSLGVALWMLAGLLASFLGALASLVGTDAGRALLTRVTAGALHQVFTGT |
Ga0209801_12365462 | 3300026326 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGAL |
Ga0209266_10751612 | 3300026327 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLA |
Ga0209375_12154192 | 3300026329 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALHQVFTGTMEIGD |
Ga0209267_10248133 | 3300026331 | Soil | MVRRSLGAALWTLVGLLAVFLGALSSLVGTEAGRQLLARVTERGLRQ |
Ga0209377_12282741 | 3300026334 | Soil | MRRSLGVALWSLVGLLACFLGALNGLVGTHAGRTLLARVASTVVQSA |
Ga0209804_10481871 | 3300026335 | Soil | MVRRSLGVALWMLAGLLACFLGALGSLVGTDAGRALLTRVTAGALHQVFTGTIEIGDV |
Ga0209059_10999052 | 3300026527 | Soil | MVRRSLGVALWMLAGLLACFLGALGSLVGTDAGRALLTRVTAGALHQVFTGTIEIGDVGG |
Ga0209056_100988921 | 3300026538 | Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRALLARVSEGALH |
Ga0208989_101973652 | 3300027738 | Forest Soil | MIRRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEGALR |
Ga0137415_101743041 | 3300028536 | Vadose Zone Soil | MISRSLGAALWTLVGLLAGFLGALSSLVGTGAGRTLLARVSEG |
Ga0307301_101639831 | 3300028719 | Soil | MRRSLGVALWTLVGLLACFLGALNALVGTRAGRTMLARVAGT |
Ga0307292_100905361 | 3300028811 | Soil | MRRSLGVALWTLVGLLACFLGAMNALVGTHAGRTLLA |
Ga0307308_102550321 | 3300028884 | Soil | MRRSLGVALWTLVGLLACFLGALNALVGTRAGRTMLARVASTVVEGA |
Ga0307469_102097561 | 3300031720 | Hardwood Forest Soil | MIRRSLGVALWSLVGLLACLLGALNALVGTRAGRTLLAQVASAAAEGVVS |
Ga0307469_105396051 | 3300031720 | Hardwood Forest Soil | MMRRSLSVALWSLVGLLACFLGALNALVGTRAGRTLLARIASSAVNS |
Ga0307479_102299342 | 3300031962 | Hardwood Forest Soil | MVRRSLGVALWSLAGLLACFLGALASLVGTSAGRAL |
Ga0307479_102563031 | 3300031962 | Hardwood Forest Soil | MVRRSLGVALWMLAGLLASFLGALASLVGTDAGRALLTRVTAGALHQVFT |
Ga0307470_100319421 | 3300032174 | Hardwood Forest Soil | MVRRSLGAALWTLVGLLAGFLGALSSLVGTEAGRDLLARVTEGGLRQ |
Ga0307471_1006403512 | 3300032180 | Hardwood Forest Soil | MIRRSLGVALWSLVGLLACLLGALNALVGTRAGRTLL |
Ga0214472_108124841 | 3300033407 | Soil | MVRRSLGVALWSLAGLLACFLGALNGLVGTRAGRSLLAR |
Ga0364924_099524_3_140 | 3300033811 | Sediment | MVRRSLGAALWTLVGVLACFLGGLSALVGTPAGRALVARVLQATLE |
Ga0364946_140432_422_553 | 3300033815 | Sediment | MVRRSLGAALWTLVGVLACFLGGLSALVGTPAGRALVARVLQAT |
Ga0364934_0404904_364_516 | 3300034178 | Sediment | MVRRSLGAMLWFLAGLLACFLGVLAGLTGTGAGRRLLANAASAALEGVIDG |
⦗Top⦘ |