NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059955

Metagenome / Metatranscriptome Family F059955

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059955
Family Type Metagenome / Metatranscriptome
Number of Sequences 133
Average Sequence Length 51 residues
Representative Sequence MACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVASGDV
Number of Associated Samples 112
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 45.86 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.98 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (84.211 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(24.812 % of family members)
Environment Ontology (ENVO) Unclassified
(33.083 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(39.098 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.85%    β-sheet: 10.26%    Coil/Unstructured: 85.90%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF14550Peptidase_S78_2 6.02
PF05065Phage_capsid 0.75
PF02130YbeY 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0319ssRNA-specific RNase YbeY, 16S rRNA maturation enzymeTranslation, ribosomal structure and biogenesis [J] 0.75
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.50 %
UnclassifiedrootN/A1.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2022920000|QLn_FPQQ8XI09P8SYAAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300000947|BBAY92_10128903Not Available668Open in IMG/M
3300002408|B570J29032_109253613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300002835|B570J40625_100070889All Organisms → Viruses → Predicted Viral4623Open in IMG/M
3300002835|B570J40625_100503129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1138Open in IMG/M
3300003394|JGI25907J50239_1056426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300004125|Ga0066182_10094223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300004481|Ga0069718_16268036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300005580|Ga0049083_10267162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300006025|Ga0075474_10146637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300006484|Ga0070744_10084719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300006637|Ga0075461_10260847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300006802|Ga0070749_10357981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300006802|Ga0070749_10706462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300006802|Ga0070749_10746984Not Available521Open in IMG/M
3300006810|Ga0070754_10286522All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300006916|Ga0070750_10103661All Organisms → Viruses → Predicted Viral1317Open in IMG/M
3300006916|Ga0070750_10128154All Organisms → Viruses → Predicted Viral1160Open in IMG/M
3300006916|Ga0070750_10402578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300006919|Ga0070746_10425929All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300006920|Ga0070748_1209093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300007169|Ga0102976_1133411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4386Open in IMG/M
3300007234|Ga0075460_10261823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300007234|Ga0075460_10275203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300007346|Ga0070753_1164817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300007538|Ga0099851_1132197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300007538|Ga0099851_1207085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300007540|Ga0099847_1080835All Organisms → Viruses → Predicted Viral1001Open in IMG/M
3300007541|Ga0099848_1246531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300007640|Ga0070751_1172408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage854Open in IMG/M
3300008012|Ga0075480_10534168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300008266|Ga0114363_1111046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage970Open in IMG/M
3300008448|Ga0114876_1122745All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage993Open in IMG/M
3300009026|Ga0102829_1344450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300009085|Ga0105103_10415610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300009165|Ga0105102_10465303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300009168|Ga0105104_10350859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage816Open in IMG/M
3300009170|Ga0105096_10332840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300009183|Ga0114974_10359313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300009506|Ga0118657_11469680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300010160|Ga0114967_10416055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300010370|Ga0129336_10548274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage620Open in IMG/M
3300011010|Ga0139557_1073653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300012012|Ga0153799_1079275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage590Open in IMG/M
3300012013|Ga0153805_1013758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1385Open in IMG/M
3300012667|Ga0157208_10046108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300012775|Ga0138280_1027820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1153Open in IMG/M
3300013295|Ga0170791_15799323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300013372|Ga0177922_10418804All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300016723|Ga0182085_1217651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300016737|Ga0182047_1589690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300016746|Ga0182055_1206307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300017723|Ga0181362_1011910All Organisms → Viruses → Predicted Viral1870Open in IMG/M
3300017747|Ga0181352_1111190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300017747|Ga0181352_1196559All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300017761|Ga0181356_1016156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2779Open in IMG/M
3300017766|Ga0181343_1200411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300017766|Ga0181343_1204911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300017950|Ga0181607_10081333All Organisms → Viruses → Predicted Viral2091Open in IMG/M
3300017956|Ga0181580_11031223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300017963|Ga0180437_10952720All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300017989|Ga0180432_10252152All Organisms → Viruses → Predicted Viral1374Open in IMG/M
3300018036|Ga0181600_10585981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300018041|Ga0181601_10187899All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1225Open in IMG/M
3300018041|Ga0181601_10622595All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300018416|Ga0181553_10190842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1191Open in IMG/M
3300019281|Ga0182077_1258341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300020013|Ga0182086_1055883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300020013|Ga0182086_1147856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300020013|Ga0182086_1157238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300020151|Ga0211736_10473938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1201Open in IMG/M
3300020151|Ga0211736_10801616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300020160|Ga0211733_10433295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1191Open in IMG/M
3300020188|Ga0181605_10150952All Organisms → Viruses → Predicted Viral1100Open in IMG/M
3300020549|Ga0207942_1017112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage936Open in IMG/M
3300020551|Ga0208360_1017236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage982Open in IMG/M
3300020551|Ga0208360_1031335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage690Open in IMG/M
3300020553|Ga0208855_1012553All Organisms → Viruses → Predicted Viral1355Open in IMG/M
3300021379|Ga0213864_10276516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage853Open in IMG/M
3300021956|Ga0213922_1003439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5109Open in IMG/M
3300022069|Ga0212026_1069531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300022190|Ga0181354_1067171All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1190Open in IMG/M
3300022190|Ga0181354_1235601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300022198|Ga0196905_1031340All Organisms → Viruses → Predicted Viral1595Open in IMG/M
3300022200|Ga0196901_1142996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300022200|Ga0196901_1195939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300022929|Ga0255752_10017714All Organisms → cellular organisms → Bacteria5456Open in IMG/M
3300025135|Ga0209498_1071654All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1487Open in IMG/M
3300025610|Ga0208149_1074132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage846Open in IMG/M
3300025645|Ga0208643_1029113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1842Open in IMG/M
3300025759|Ga0208899_1051286All Organisms → Viruses → Predicted Viral1764Open in IMG/M
3300025759|Ga0208899_1176529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage702Open in IMG/M
3300025769|Ga0208767_1104364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1126Open in IMG/M
3300025769|Ga0208767_1174456All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300025803|Ga0208425_1076165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300025818|Ga0208542_1108040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage793Open in IMG/M
3300025889|Ga0208644_1381673All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300026138|Ga0209951_1024724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
3300026439|Ga0256361_1022511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1076Open in IMG/M
3300027563|Ga0209552_1148109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage605Open in IMG/M
3300027659|Ga0208975_1089483All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage903Open in IMG/M
3300027679|Ga0209769_1076972All Organisms → Viruses → Predicted Viral1096Open in IMG/M
3300027693|Ga0209704_1180384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300027763|Ga0209088_10174986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300027798|Ga0209353_10057490All Organisms → Viruses → Predicted Viral1782Open in IMG/M
3300027808|Ga0209354_10261610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300027808|Ga0209354_10379572All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage552Open in IMG/M
3300027899|Ga0209668_10339958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage972Open in IMG/M
3300028394|Ga0304730_1304745All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300029930|Ga0119944_1029227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300031758|Ga0315907_10922867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300031772|Ga0315288_10469440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1252Open in IMG/M
3300031784|Ga0315899_10132277All Organisms → Viruses → Predicted Viral2553Open in IMG/M
3300031787|Ga0315900_10877714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300031873|Ga0315297_11025583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300031952|Ga0315294_10410437All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300031952|Ga0315294_11249254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage599Open in IMG/M
3300031963|Ga0315901_10219056All Organisms → Viruses → Predicted Viral1633Open in IMG/M
3300032342|Ga0315286_12127470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300032397|Ga0315287_12613452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300032401|Ga0315275_10728289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1102Open in IMG/M
3300033992|Ga0334992_0178996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1069Open in IMG/M
3300033994|Ga0334996_0400208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300033996|Ga0334979_0337567All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
3300034061|Ga0334987_0812253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300034066|Ga0335019_0363470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300034092|Ga0335010_0580885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300034092|Ga0335010_0593242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300034101|Ga0335027_0547153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage715Open in IMG/M
3300034111|Ga0335063_0039858All Organisms → Viruses → Predicted Viral2993Open in IMG/M
3300034117|Ga0335033_0306917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300034119|Ga0335054_0295365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage952Open in IMG/M
3300034280|Ga0334997_0667449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous24.81%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.28%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.28%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.02%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.26%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.51%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.01%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.50%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.50%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.50%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.75%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.75%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.75%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.75%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.75%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.75%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.75%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.75%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.75%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.75%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.75%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.75%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2022920000Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled)EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300004125Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300025135Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026439Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
QL_na_15228002022920000Saline WaterMSCNIVLTQGFALDCKDSVGGIKSIHLVSFAATGFTVVSGEVTDTTVVSG
BBAY92_1012890323300000947Macroalgal SurfaceMSCSINLTQGFALDCKDSIGGVKSIHLVDFASTGFTVASGEVTATSVASGSV
B570J29032_10925361313300002408FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSLTNT
B570J40625_10007088963300002835FreshwaterMACLLTQGFTLDCKDAIGGIKSIHLISWTASKFTIASGEVTATTVA
B570J40625_10050312923300002835FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSMTNTTNVSI
JGI25907J50239_105642613300003394Freshwater LakeMSCNINLTQGFALDCKDSIGGIKSIHLISWAATGFTVASGEVTATTIASGNVYDYELPKGVGSMTT
Ga0066182_1009422313300004125Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSLTNTTNVSI
Ga0069718_1626803613300004481SedimentMACLLTQGFTLDCKDAVGGIKSIHLISWVDSKFTVASGEVTATTV
Ga0049083_1026716213300005580Freshwater LenticMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSLT
Ga0075474_1014663723300006025AqueousMACNLTQGFTLDCKDAVGGIKSIHLIDWVADGFAISDG
Ga0070744_1008471913300006484EstuarineMPCLLTQSIALDCKDAVGGIKSIHLVNWAKTGFTVASGEVTATTIVSG
Ga0075461_1026084723300006637AqueousMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTATTVASGSV
Ga0070749_1035798113300006802AqueousMSCAITQGFTLDCKDAVGGIKSIHLIDWAASGFSIG
Ga0070749_1070646213300006802AqueousMSCAITQGFTLDCKDAVGGIKSIHLIDWAASGFSIGGGEVTATTVATGSVFTYELPKGT
Ga0070749_1074698423300006802AqueousMSCTINLTQGFALDCKDSVGGIKSISLIDFAATGFTTASGEVTATSVASGSV
Ga0070754_1028652223300006810AqueousMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVT
Ga0070750_1010366133300006916AqueousMACNLTQGFNLDCKDAVGGVKSIHLIDWASTGFTVSGGEVTATTVVSGDVYTYELPKGVGSMTTTTN
Ga0070750_1012815423300006916AqueousMSCALTTGFTLDCKDSVGGIKSIHLIDWADGLFTIASGEATATTATSGSTFTYELPKA
Ga0070750_1040257813300006916AqueousMSCSINLTQGFALDCKDSVGGIKSISLISWVADGFTTASGEVTAIAATGTVTSGSTYTYELPKGVGSMTITTNISAEN
Ga0070746_1042592913300006919AqueousMACNLTQSFNLDCKDAVGGIKSIHLIDWVADGFAISDGEVTGITATGSVASGSTYTYELP
Ga0070748_120909323300006920AqueousMACNLTQSFNLDCKDAVGGIKSIHLIDWVADGFAISDGEVTGITATGSVA
Ga0102976_113341153300007169Freshwater LakeMACLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSVASGDVYT
Ga0075460_1026182313300007234AqueousMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTA
Ga0075460_1027520323300007234AqueousMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTATTVA
Ga0070753_116481713300007346AqueousMSCAITQGFTLDCKDAVGGIKSIHLIDWAASGFSVGGGEVTATTIATGSVF
Ga0099851_113219723300007538AqueousMSCAITQGFTLDCKDSVGGVKSIHLIDWAASGFSVGGGEVTATT
Ga0099851_120708523300007538AqueousMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVT
Ga0099847_108083523300007540AqueousMACNLTQGFNLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVASGDVYTYEL
Ga0099848_124653123300007541AqueousMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTATTVASGSVYTYELPKG
Ga0070751_117240823300007640AqueousMSCAITQGFTLDCKDAVGGIKSIHLIDWAASGFSIGGGEVTATTVATGSVFT
Ga0075480_1053416813300008012AqueousMSCAITQGFTLDCKDAVGGIKSIHLIDWAASGFSIGGGEVTATTVATGSVF
Ga0114363_111104613300008266Freshwater, PlanktonMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVAS
Ga0114876_112274513300008448Freshwater LakeMACLLTQGFTLDCKDAVGGIKSSHLITWVDSKFTVA
Ga0102829_134445013300009026EstuarineMPCLLTSGFPLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSMTNTTNVSIENGTSFNQADIAFKLRRLS
Ga0105103_1041561013300009085Freshwater SedimentMSCNINLTQGFALDCKDSVGGIKSIHLISWAATGFTVASGEVTATTVVSGNVYDYELPKGVGSMTTTTNV
Ga0105102_1046530323300009165Freshwater SedimentMACNLTAGFTLDCKDSVGGVKAIHLIDFASTGFTVSGGEVTATTIASGSV
Ga0105104_1035085923300009168Freshwater SedimentMACLLTQVFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVT
Ga0105096_1033284023300009170Freshwater SedimentMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVTATTVA
Ga0114974_1035931323300009183Freshwater LakeMPCLLTQSIALDCKDAVGGIKSIHLVNWAKTGFTVASGEVTATTIVS
Ga0118657_1146968023300009506Mangrove SedimentMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTAT
Ga0114967_1041605513300010160Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSMTNTTN
Ga0129336_1054827423300010370Freshwater To Marine Saline GradientMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTATTVAS
Ga0139557_107365323300011010FreshwaterMSCNIVLTQGFALDCKDSVGGIKSIHLISWAATGFTVASGE
Ga0153799_107927523300012012FreshwaterMSCNIVLTQGFALDCKDSVGAIKSIHSISWAATGFTVASGEVTATTIASGNVYDYELPKGVGSMTTTT
Ga0153805_101375833300012013Surface IceMSCNIVLTQGFALDCKDSVGGIKSIHLISWAATGFTVASGEVTATTIASGNV
Ga0157208_1004610823300012667FreshwaterMACLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSV
Ga0138280_102782023300012775Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSMTNTTNA
Ga0170791_1579932313300013295FreshwaterMPCLLTQSIALDCKDAVGGIKSIHLVNWAKTGFTVASGEVTATT
Ga0177922_1041880423300013372FreshwaterMPCLLTSGFTLDCKEAVGGIKSIHLISWTASKFTAVSGEITATTVVSGDVYTYEL
Ga0182085_121765113300016723Salt MarshMSCNLTQGFTLDCKDAIGGIKSIHLIDWAASGFSIGGGEV
Ga0182047_158969013300016737Salt MarshMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVVSGDVYTYEL
Ga0182055_120630723300016746Salt MarshMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVASGDVYTYELP
Ga0181362_101191043300017723Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSLTNTT
Ga0181352_111119013300017747Freshwater LakeMPCLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTIA
Ga0181352_119655923300017747Freshwater LakeMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVASGEVTAT
Ga0181356_101615613300017761Freshwater LakeMPCLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSVASGDVYFYDIPK
Ga0181343_120041123300017766Freshwater LakeMACLLTQGFTLDCKDAVGGIKSIHLISWVDSKFTVASGEVTATTVA
Ga0181343_120491113300017766Freshwater LakeMPCLLTQGFTLDCKDAVGGIKSIHLISWVDSKFTVASGEVTATTVAS
Ga0181607_1008133343300017950Salt MarshMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTV
Ga0181580_1103122313300017956Salt MarshMACNLTQGFTLDCKDSVGGIKSIHVIDWASSGFTVAGGEVTASTVASG
Ga0180437_1095272013300017963Hypersaline Lake SedimentMACNLTQGFNLDCKDAVGGIKSIHLIDWVADGFAISDGEVTGI
Ga0180432_1025215233300017989Hypersaline Lake SedimentMACNLTQGFNLDCKDAVGGIKSIHLIDWVADGFAISDGEVTGITATGSVASGSTYTYEL
Ga0181600_1058598123300018036Salt MarshMSCNLTQGFTLDCKDAIGGIKSIHLIDWAASGFSIG
Ga0181601_1018789933300018041Salt MarshMSWNLTQGFTLDCKDAIGGIKSIHLIDWAASGFSIGGGEVTATTVASGDVYTYELPKGTG
Ga0181601_1062259513300018041Salt MarshMSCSINLTQGFALDCKDSVGGIKSIHLIDFASTGFTVSGGEVTATTVVSGSVYTYELPKGVGSM
Ga0181553_1019084233300018416Salt MarshMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEV
Ga0182077_125834123300019281Salt MarshMACNLTQGFTLDCKDSVGGIKSIHVIDWASSGFTVA
Ga0182086_105588313300020013Salt MarshMACNLTQGFNLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVVSGDVYTYELPKG
Ga0182086_114785613300020013Salt MarshMSCNLTQGFTLDCKDAIGGIKSIHLIDWAASGFSIGGGEVTATTVASGDVYTYELPKGT
Ga0182086_115723823300020013Salt MarshMSCSINLTQGFALDCKDSVGGIKSIHLIDFASTGFTVASGE
Ga0211736_1047393833300020151FreshwaterMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTAT
Ga0211736_1080161613300020151FreshwaterMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVASGEVTATSVASGSV
Ga0211733_1043329523300020160FreshwaterMPCLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSVASGDV
Ga0181605_1015095223300020188Salt MarshMACNLTQGFTLDCKDAVGGIKSIHLIDFASTGFTVSGGEVTA
Ga0207942_101711223300020549FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYE
Ga0208360_101723623300020551FreshwaterMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVTATTVASGDVYDYE
Ga0208360_103133513300020551FreshwaterMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVTATTVASGDVYDY
Ga0208855_101255333300020553FreshwaterMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVASGVVTA
Ga0213864_1027651623300021379SeawaterMACNLTQGFTLDCKDSVGGIKSIHVIDWASSGFTV
Ga0213922_100343913300021956FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVASGIVTATTVVSGDVYTYE
Ga0212026_106953123300022069AqueousMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVVL
Ga0181354_106717133300022190Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVV
Ga0181354_123560123300022190Freshwater LakeMSCNINLTQGFALDCKDSVGGIKSIHLISWAATGFTVASGEVTATTIASG
Ga0196905_103134033300022198AqueousMSCAITQGFTLDCKDSVGGVKSIHLIDWAASGFSVGGGEVTATTVATGSVFTYELPKGTGSMVVTTN
Ga0196901_114299623300022200AqueousMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVVSGDVYTYELPKG
Ga0196901_119593913300022200AqueousMSCAINLTQGFALDCKDSVGGIKSIHLISWVSDGFTVAS
Ga0255752_1001771413300022929Salt MarshMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVASGDV
Ga0209498_107165433300025135SedimentMSCSINLTQGFALDCKDSVGGIKSISLVDFAATGFTVASGEVTATSVASGSVYTYELPKGVGSMTITTNI
Ga0208149_107413213300025610AqueousMACNLTQGFTLDCKDAVGGIKSIHLIDWVADGFAISDGEVT
Ga0208643_102911313300025645AqueousMPCLLTQGFALDCKDAIGGIKSIHLISWTASKFTIASGEVTATTVASGDVYDYELPKGTGSLTNTTNVSVEN
Ga0208899_105128633300025759AqueousMACNLTQGFNLDCKDAVGGVKSIHLIDWASTGFTVSGGEVTATTVVSGDVYTYELPKGV
Ga0208899_117652923300025759AqueousMSCSINLTQGFALDCKDSVGGIKSIHLIDFASTGFTVASGEV
Ga0208767_110436423300025769AqueousMACNLTQGFVLDCKDSTGGVKSIWLIDWASSGFTVASGEVTATTVASGD
Ga0208767_117445613300025769AqueousMSCSINLTQGFALDCKDSVGGVKSIHLIDFASTGFTVASGEVTATSVASGSVYTYE
Ga0208425_107616523300025803AqueousMSCSINLTQGFALDCKDSVGGIKSIHLIDFASTGFTVASGEVTATSVASGSVYTYELPKG
Ga0208542_110804023300025818AqueousMACNLTQGFTLDCKDAVGGIKSIHLINWASTGFSVGGGEVTATTVTGG
Ga0208644_138167323300025889AqueousMSCAITQGFTLDCKDAVGGIKSIHLIDWAASGFSIGG
Ga0209951_102472413300026138Pond WaterMACNLTQGFTLDCKDAVGGIKSIHLIDWASTGFTVSGGEVTATTVASGDVYTY
Ga0256361_102251113300026439FreshwaterMACSLTQGFTLDCKDAVGGIKSIHLIDWAASGFSIGGSEVTATT
Ga0209552_114810923300027563Freshwater LakeMPCLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVAS
Ga0208975_108948313300027659Freshwater LenticMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVASGEVTATSVASGS
Ga0209769_107697223300027679Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVY
Ga0209704_118038423300027693Freshwater SedimentMSCNINLTQGFALDCKDSVGGIKSIHLISWAATGFTVASGEVTATT
Ga0209088_1017498613300027763Freshwater LakeMPCLLTQSIALDCKDAVGGIKSIHLVNWAKTGFTVASGEVTATTIVSGDVYTYDIPKAT
Ga0209353_1005749043300027798Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYEL
Ga0209354_1026161023300027808Freshwater LakeMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYTYELPKATGSMTNTTNVSI
Ga0209354_1037957223300027808Freshwater LakeMPCLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSVASGDVYFYDIPKATA
Ga0209668_1033995823300027899Freshwater Lake SedimentMACLLTQGFTLDCKDAVGGIKSIHLISWVDSKFTVASGEV
Ga0304730_130474513300028394Freshwater LakeMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVSGDVYT
Ga0119944_102922713300029930AquaticMACLLTSGFSLDCKDSVGGVKSIHLMNWTASKFTVASGEVTATTFASGDVFDYELPKGTGSMTTTTNV
Ga0315907_1092286723300031758FreshwaterMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVASGEVT
Ga0315288_1046944033300031772SedimentMPCLLTQSFALDCKDAIGGIKSIHLVNWTKTGFTVASGEVTATTIVSGDVYTYDIPKA
Ga0315899_1013227743300031784FreshwaterMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVASGEVTA
Ga0315900_1087771413300031787FreshwaterMPCLLTSGFALDCKDAVGGIKSIHLINWATSGFTVASGEVTATSVASGSVY
Ga0315297_1102558313300031873SedimentMPCLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSVASGDVYF
Ga0315294_1041043733300031952SedimentMPCLISQSFALDCKDAVGGVKSIYLVNWAKTGFTVASGEVTATSVASGDVY
Ga0315294_1124925413300031952SedimentMPCLLTQSFALDCKDAIGGIKSIHLVNWTKTGFTVASGEVTATTIVSGDVYTYDIPKATGSMTNTTNVSVENGT
Ga0315901_1021905613300031963FreshwaterMACNLTAGFTLDCKDSVGGVKAIHLVDFASTGFTVSGGEVTATTIASGSVY
Ga0315286_1212747013300032342SedimentMPCLLTSGFTLDCKEAVGGVKSIHLISWVTSKFTAVSGEITATTVVSGDVYTYELPKGTASLT
Ga0315287_1261345223300032397SedimentMACLLTSGFTLDCKEAIGGIKSIHLITWVTSKFTVVSGVVTATTVVSGDVYTYELPKGTGSLTNTTN
Ga0315275_1072828913300032401SedimentMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVVS
Ga0334992_0178996_953_10693300033992FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGV
Ga0334996_0400208_447_6443300033994FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVASGVVTATTVVSGDVYTYELPKATGSLTNTT
Ga0334979_0337567_1_1203300033996FreshwaterMACNLTAGFTLDCKDSVGGVKAIHLVDFASTGFTVSGGEV
Ga0334987_0812253_2_1783300034061FreshwaterMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVTATTVASGDVYDYELPKGT
Ga0335019_0363470_1_1383300034066FreshwaterMACLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVVSGVVTATTVV
Ga0335010_0580885_2_1513300034092FreshwaterMPCLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTIASGEVTGTTVASGDV
Ga0335010_0593242_396_5633300034092FreshwaterMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVTATTVASGDVYDYELP
Ga0335027_0547153_585_7133300034101FreshwaterMPCLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTIASGEVTGT
Ga0335063_0039858_2_1093300034111FreshwaterMPCLLTSGFTLDCKEAIGGIKSIHLISWTASKFTVA
Ga0335033_0306917_3_1733300034117FreshwaterMPCLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTIASGEVTGTTVASGDVYDYELPK
Ga0335054_0295365_782_9523300034119FreshwaterMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTVASGEVTATTVASGDVYDYELPK
Ga0334997_0667449_2_1303300034280FreshwaterMACLLTQGFTLDCKDAVGGIKSIHLITWVDSKFTIASGEVTGT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.