Basic Information | |
---|---|
Family ID | F059974 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 40 residues |
Representative Sequence | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPDWLKEILNED |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 30.83 % |
% of genes near scaffold ends (potentially truncated) | 15.04 % |
% of genes from short scaffolds (< 2000 bps) | 84.96 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (80.451 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.812 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.383 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.165 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.18% β-sheet: 0.00% Coil/Unstructured: 58.82% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF01464 | SLT | 35.34 |
PF13578 | Methyltransf_24 | 4.51 |
PF01258 | zf-dskA_traR | 1.50 |
PF05050 | Methyltransf_21 | 1.50 |
PF01844 | HNH | 0.75 |
PF01467 | CTP_transf_like | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 1.50 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 80.45 % |
All Organisms | root | All Organisms | 19.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352005|2200044140 | Not Available | 545 | Open in IMG/M |
3300001843|RCM34_1009256 | Not Available | 1715 | Open in IMG/M |
3300001849|RCM26_1055127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2113 | Open in IMG/M |
3300001849|RCM26_1055128 | Not Available | 1161 | Open in IMG/M |
3300001850|RCM37_1054305 | Not Available | 980 | Open in IMG/M |
3300001851|RCM31_10077687 | Not Available | 577 | Open in IMG/M |
3300002835|B570J40625_100002682 | All Organisms → cellular organisms → Bacteria | 33217 | Open in IMG/M |
3300002835|B570J40625_100411289 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300002835|B570J40625_100527068 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1102 | Open in IMG/M |
3300002835|B570J40625_100664296 | Not Available | 940 | Open in IMG/M |
3300004767|Ga0007750_1335867 | Not Available | 627 | Open in IMG/M |
3300004836|Ga0007759_11573733 | Not Available | 788 | Open in IMG/M |
3300006484|Ga0070744_10001732 | Not Available | 6574 | Open in IMG/M |
3300006484|Ga0070744_10026057 | Not Available | 1732 | Open in IMG/M |
3300006802|Ga0070749_10340426 | Not Available | 835 | Open in IMG/M |
3300006802|Ga0070749_10501198 | Not Available | 661 | Open in IMG/M |
3300006802|Ga0070749_10517059 | Not Available | 649 | Open in IMG/M |
3300006802|Ga0070749_10612239 | Not Available | 587 | Open in IMG/M |
3300007171|Ga0102977_1139451 | Not Available | 968 | Open in IMG/M |
3300007177|Ga0102978_1202110 | Not Available | 1523 | Open in IMG/M |
3300007544|Ga0102861_1175403 | Not Available | 585 | Open in IMG/M |
3300007597|Ga0102919_1122254 | Not Available | 819 | Open in IMG/M |
3300007622|Ga0102863_1216877 | Not Available | 562 | Open in IMG/M |
3300007708|Ga0102859_1039587 | Not Available | 1286 | Open in IMG/M |
3300007974|Ga0105747_1263411 | Not Available | 579 | Open in IMG/M |
3300007974|Ga0105747_1274718 | Not Available | 567 | Open in IMG/M |
3300007992|Ga0105748_10205150 | Not Available | 820 | Open in IMG/M |
3300007992|Ga0105748_10460173 | Not Available | 553 | Open in IMG/M |
3300008072|Ga0110929_1096644 | Not Available | 1522 | Open in IMG/M |
3300008107|Ga0114340_1058802 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1657 | Open in IMG/M |
3300008107|Ga0114340_1064693 | Not Available | 1559 | Open in IMG/M |
3300008110|Ga0114343_1069804 | Not Available | 1293 | Open in IMG/M |
3300008113|Ga0114346_1063862 | Not Available | 1786 | Open in IMG/M |
3300008113|Ga0114346_1151029 | Not Available | 991 | Open in IMG/M |
3300008267|Ga0114364_1018636 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2932 | Open in IMG/M |
3300008267|Ga0114364_1043377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1660 | Open in IMG/M |
3300008267|Ga0114364_1120498 | Not Available | 781 | Open in IMG/M |
3300008267|Ga0114364_1123496 | Not Available | 765 | Open in IMG/M |
3300008267|Ga0114364_1185978 | Not Available | 526 | Open in IMG/M |
3300008448|Ga0114876_1167987 | Not Available | 780 | Open in IMG/M |
3300008450|Ga0114880_1034857 | Not Available | 2224 | Open in IMG/M |
3300008450|Ga0114880_1096750 | Not Available | 1149 | Open in IMG/M |
3300008450|Ga0114880_1133807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300009056|Ga0102860_1102036 | Not Available | 797 | Open in IMG/M |
3300009068|Ga0114973_10123490 | Not Available | 1455 | Open in IMG/M |
3300009151|Ga0114962_10156324 | Not Available | 1366 | Open in IMG/M |
3300009169|Ga0105097_10693698 | Not Available | 576 | Open in IMG/M |
3300009180|Ga0114979_10256532 | Not Available | 1046 | Open in IMG/M |
3300009181|Ga0114969_10175744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
3300009185|Ga0114971_10566691 | Not Available | 630 | Open in IMG/M |
3300009426|Ga0115547_1225442 | Not Available | 587 | Open in IMG/M |
3300009435|Ga0115546_1118979 | Not Available | 948 | Open in IMG/M |
3300011011|Ga0139556_1003951 | Not Available | 2198 | Open in IMG/M |
3300011995|Ga0153800_1015310 | Not Available | 769 | Open in IMG/M |
3300012345|Ga0157139_1003356 | Not Available | 837 | Open in IMG/M |
3300012663|Ga0157203_1002000 | Not Available | 4726 | Open in IMG/M |
3300012774|Ga0138283_1202909 | Not Available | 533 | Open in IMG/M |
3300012775|Ga0138280_1289431 | Not Available | 1524 | Open in IMG/M |
3300013004|Ga0164293_10008131 | Not Available | 8845 | Open in IMG/M |
3300013004|Ga0164293_10692506 | Not Available | 654 | Open in IMG/M |
3300013006|Ga0164294_10182812 | Not Available | 1496 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10098339 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2069 | Open in IMG/M |
3300014050|Ga0119952_1064610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10050534 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 3321 | Open in IMG/M |
3300017707|Ga0181363_1088848 | Not Available | 525 | Open in IMG/M |
3300017722|Ga0181347_1029642 | Not Available | 1706 | Open in IMG/M |
3300017722|Ga0181347_1108181 | Not Available | 787 | Open in IMG/M |
3300017722|Ga0181347_1138583 | Not Available | 670 | Open in IMG/M |
3300017736|Ga0181365_1013763 | Not Available | 2022 | Open in IMG/M |
3300017736|Ga0181365_1048105 | Not Available | 1068 | Open in IMG/M |
3300017747|Ga0181352_1182641 | Not Available | 544 | Open in IMG/M |
3300017754|Ga0181344_1073313 | Not Available | 1008 | Open in IMG/M |
3300017761|Ga0181356_1121186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300017766|Ga0181343_1198434 | Not Available | 550 | Open in IMG/M |
3300017774|Ga0181358_1133045 | Not Available | 864 | Open in IMG/M |
3300017777|Ga0181357_1128719 | Not Available | 945 | Open in IMG/M |
3300017780|Ga0181346_1029087 | Not Available | 2296 | Open in IMG/M |
3300017784|Ga0181348_1036408 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2053 | Open in IMG/M |
3300017785|Ga0181355_1172755 | Not Available | 862 | Open in IMG/M |
3300017785|Ga0181355_1229040 | Not Available | 720 | Open in IMG/M |
3300017788|Ga0169931_10181558 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1828 | Open in IMG/M |
3300019784|Ga0181359_1039545 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1826 | Open in IMG/M |
3300019784|Ga0181359_1099096 | Not Available | 1071 | Open in IMG/M |
3300019784|Ga0181359_1108391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300019784|Ga0181359_1144006 | Not Available | 825 | Open in IMG/M |
3300019784|Ga0181359_1153076 | Not Available | 789 | Open in IMG/M |
3300019784|Ga0181359_1182640 | Not Available | 691 | Open in IMG/M |
3300019784|Ga0181359_1203544 | Not Available | 636 | Open in IMG/M |
3300019784|Ga0181359_1245119 | Not Available | 547 | Open in IMG/M |
3300020159|Ga0211734_10200978 | Not Available | 797 | Open in IMG/M |
3300020159|Ga0211734_10832221 | Not Available | 1140 | Open in IMG/M |
3300020159|Ga0211734_11359445 | Not Available | 975 | Open in IMG/M |
3300020160|Ga0211733_10164354 | Not Available | 971 | Open in IMG/M |
3300020506|Ga0208091_1001999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 3128 | Open in IMG/M |
3300021960|Ga0222715_10414371 | Not Available | 734 | Open in IMG/M |
3300021961|Ga0222714_10123048 | Not Available | 1598 | Open in IMG/M |
3300021961|Ga0222714_10251811 | Not Available | 990 | Open in IMG/M |
3300021961|Ga0222714_10340033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300021961|Ga0222714_10390419 | Not Available | 738 | Open in IMG/M |
3300021961|Ga0222714_10644614 | Not Available | 523 | Open in IMG/M |
3300021962|Ga0222713_10148059 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1623 | Open in IMG/M |
3300021962|Ga0222713_10286957 | Not Available | 1055 | Open in IMG/M |
3300021962|Ga0222713_10310645 | Not Available | 1000 | Open in IMG/M |
3300021962|Ga0222713_10652783 | Not Available | 606 | Open in IMG/M |
3300021963|Ga0222712_10069672 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 2548 | Open in IMG/M |
3300022179|Ga0181353_1099312 | Not Available | 717 | Open in IMG/M |
3300022190|Ga0181354_1061904 | Not Available | 1243 | Open in IMG/M |
3300022190|Ga0181354_1178709 | Not Available | 646 | Open in IMG/M |
3300022190|Ga0181354_1200178 | Not Available | 595 | Open in IMG/M |
3300022407|Ga0181351_1034014 | Not Available | 2164 | Open in IMG/M |
3300022407|Ga0181351_1097650 | Not Available | 1141 | Open in IMG/M |
3300022407|Ga0181351_1257102 | Not Available | 539 | Open in IMG/M |
3300023179|Ga0214923_10002642 | Not Available | 23539 | Open in IMG/M |
3300023179|Ga0214923_10014642 | Not Available | 7523 | Open in IMG/M |
3300023179|Ga0214923_10030333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4521 | Open in IMG/M |
3300023184|Ga0214919_10328657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
3300024346|Ga0244775_10654325 | Not Available | 849 | Open in IMG/M |
3300025743|Ga0256321_113433 | Not Available | 714 | Open in IMG/M |
3300027320|Ga0208923_1046439 | Not Available | 774 | Open in IMG/M |
3300027733|Ga0209297_1350766 | Not Available | 535 | Open in IMG/M |
3300027782|Ga0209500_10199781 | Not Available | 903 | Open in IMG/M |
3300028025|Ga0247723_1026554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1875 | Open in IMG/M |
3300028025|Ga0247723_1114693 | Not Available | 664 | Open in IMG/M |
3300031784|Ga0315899_10793136 | Not Available | 868 | Open in IMG/M |
3300031787|Ga0315900_10912113 | Not Available | 589 | Open in IMG/M |
3300031857|Ga0315909_10294929 | Not Available | 1216 | Open in IMG/M |
3300033233|Ga0334722_10126101 | Not Available | 1928 | Open in IMG/M |
3300033984|Ga0334989_0186937 | Not Available | 1142 | Open in IMG/M |
3300033996|Ga0334979_0449006 | Not Available | 705 | Open in IMG/M |
3300034062|Ga0334995_0227456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300034062|Ga0334995_0295964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1063 | Open in IMG/M |
3300034071|Ga0335028_0042735 | Not Available | 3098 | Open in IMG/M |
3300034117|Ga0335033_0359014 | Not Available | 729 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.03% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.27% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.51% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.51% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.76% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 3.76% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.01% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.01% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.26% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.50% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.50% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.75% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.75% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.75% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025743 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2200261230 | 2199352005 | Freshwater | MSKTSNVQRLAVLKIWLEELKRKGKIKKQPEWLKEILNED |
RCM34_10092567 | 3300001843 | Marine Plankton | MSKTSNLQKLAVLKIWLEETKRKVKPKKKNPEWLKDILDED* |
RCM26_10551276 | 3300001849 | Marine Plankton | MSKTSNNQKLAVLKIWLEELKKKTNVKKKNPDWLKEILDED* |
RCM26_10551283 | 3300001849 | Marine Plankton | MSKTSNLQKLAVLKIWLEETKRKVKPKKKNPDWLKDILDED* |
RCM37_10543053 | 3300001850 | Marine Plankton | MSKTSNNQKLAVLKIWLEEQKTKGKIKKKNPDWLKDILNED* |
RCM31_100776872 | 3300001851 | Marine Plankton | MSKTSNLQKLAVLKIWLEETKRKVKPKKKNPDWLKEILDED* |
B570J40625_10000268247 | 3300002835 | Freshwater | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPNWLKEILNED* |
B570J40625_1004112893 | 3300002835 | Freshwater | MSKTSNLQRLQVLKIWLEELKTKGKIKKKNPDWLKDILNEE* |
B570J40625_1005270684 | 3300002835 | Freshwater | MSKTSNNQKLAVLRIWLEEQKTKGKIKKKNPDWLKDILHED* |
B570J40625_1006642962 | 3300002835 | Freshwater | MSKTSNHQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED* |
Ga0007750_13358673 | 3300004767 | Freshwater Lake | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPTWLKEILNED* |
Ga0007759_115737332 | 3300004836 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPVWLNQILNED* |
Ga0070744_100017327 | 3300006484 | Estuarine | MSKTSNNQKLAVLKIWLEEQKRKGRIKKQPAWLKEILNED* |
Ga0070744_100260572 | 3300006484 | Estuarine | MSNTSNNQKLAVLKIWLEEQKRKGRIKKQPAWLKEILNED* |
Ga0070749_103404262 | 3300006802 | Aqueous | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPDWLKEILNED* |
Ga0070749_105011981 | 3300006802 | Aqueous | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPDWLKDILHED* |
Ga0070749_105170593 | 3300006802 | Aqueous | MSKTSNLQRLSVLKIWLEEQKRKGRIKKQPAWLKEILDEN* |
Ga0070749_106122391 | 3300006802 | Aqueous | MSKTSNHQKLAVLKIYLEELKRKVKPKKKNPDWLKEILDED* |
Ga0102977_11394513 | 3300007171 | Freshwater Lake | MSKTSNNQKLAVLKIWLEELKKKVNVKKKNPDWLKEILDED* |
Ga0102978_12021102 | 3300007177 | Freshwater Lake | MSKTSNNQKLAVLRIWLEELKKKVNVKKKNPDWLKEILDED* |
Ga0102861_11754032 | 3300007544 | Estuarine | MSKTSNLQRLSVLKIWLEEQKTKGRIKKKNPTWLNQILNED* |
Ga0102919_11222542 | 3300007597 | Estuarine | MSKTSNVQRLAVLKIWLEELKRKGKIKKQPEWLKEILNEE* |
Ga0102863_12168771 | 3300007622 | Estuarine | MSKTSSNQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED* |
Ga0102859_10395871 | 3300007708 | Estuarine | MSNTSNNQKLAVLKIWLEEQKRKGKIKKQPAWLKEILNED* |
Ga0105747_12634114 | 3300007974 | Estuary Water | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPTWLKEIL |
Ga0105747_12747181 | 3300007974 | Estuary Water | KQFMSKTSNHQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED* |
Ga0105748_102051502 | 3300007992 | Estuary Water | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPTWLKEILDEN* |
Ga0105748_104601733 | 3300007992 | Estuary Water | MSKTSNLQRLSVLKIWLEEQKRKGRIKKQPAWLKEILNED* |
Ga0110929_10966445 | 3300008072 | Water Bodies | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPEWLKEILNED* |
Ga0114340_10588023 | 3300008107 | Freshwater, Plankton | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPDWLKEILNED* |
Ga0114340_10646933 | 3300008107 | Freshwater, Plankton | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPTWLKEILDEN* |
Ga0114343_10698044 | 3300008110 | Freshwater, Plankton | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPNWLKEIMNED* |
Ga0114346_10638623 | 3300008113 | Freshwater, Plankton | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED* |
Ga0114346_11510292 | 3300008113 | Freshwater, Plankton | MSKTSNNQRLAVLKIWLEELKRKGKIKKQPDWLKEILNED* |
Ga0114364_10186364 | 3300008267 | Freshwater, Plankton | MSKTSNNQKLAVLRIWLEEQKTKGKIKKKNPDWLKDILNED* |
Ga0114364_10433773 | 3300008267 | Freshwater, Plankton | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPDWLKEVMNED* |
Ga0114364_11204983 | 3300008267 | Freshwater, Plankton | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPDWLKEIMNED* |
Ga0114364_11234963 | 3300008267 | Freshwater, Plankton | MSKTSNNQKIAVLKIWLEEQKRKGRIKKQPTWLKEILNED* |
Ga0114364_11859782 | 3300008267 | Freshwater, Plankton | MSNTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED* |
Ga0114876_11679871 | 3300008448 | Freshwater Lake | MSKTSNLQRLSVLKIWLEEQKRKGRIKKQPAWLNQILNED* |
Ga0114880_10348572 | 3300008450 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPAWLKEILNED* |
Ga0114880_10967501 | 3300008450 | Freshwater Lake | MSKTSNLQRLSVLKIWLEELKRKGKIKKQPDWLKEILNED* |
Ga0114880_11338072 | 3300008450 | Freshwater Lake | MSKSSNLQRLQVLKIWLEELKTKGKIKKKNPDWLKDILNEE* |
Ga0102860_11020361 | 3300009056 | Estuarine | QKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED* |
Ga0114973_101234903 | 3300009068 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPVWLKEILNED* |
Ga0114962_101563244 | 3300009151 | Freshwater Lake | MSKTSNNQKIAVLKIWLEEQKRKGKIKKQPAWLKEILNED* |
Ga0105097_106936983 | 3300009169 | Freshwater Sediment | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPNWMKEILNED* |
Ga0114979_102565321 | 3300009180 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED* |
Ga0114969_101757444 | 3300009181 | Freshwater Lake | MSKTSNLQKLPVLKIWLEELKKKVKVKRKNPTWLKGILDEE* |
Ga0114971_105666913 | 3300009185 | Freshwater Lake | MSNTSNNQKLAVLKIWLEEQKRKGKIKKQPVWLKEILNED* |
Ga0115547_12254422 | 3300009426 | Pelagic Marine | MSKTSNLQRLSVLKIWLEEQKRKGRIKKQPTWLKEILNED* |
Ga0115546_11189793 | 3300009435 | Pelagic Marine | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPNWLKEILNED* |
Ga0139556_10039515 | 3300011011 | Freshwater | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPAWLKE |
Ga0153800_10153101 | 3300011995 | Freshwater | KTSNNQKLAVLKIWLEEQKTKGRIKKKNPVWLNQILNED* |
Ga0157139_10033563 | 3300012345 | Freshwater | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEILEEN* |
Ga0157203_10020005 | 3300012663 | Freshwater | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPAWLKEILDEN* |
Ga0138283_12029092 | 3300012774 | Freshwater Lake | MSKTSNLQKLSVLKIWLEEQKIKGRIKKKNPTWLKEILEEN* |
Ga0138280_12894313 | 3300012775 | Freshwater Lake | MSKTSNNQKIAVLKIWLEEQKRKGKIKKQPTWLKEILNED* |
Ga0164293_1000813115 | 3300013004 | Freshwater | MSKTSNLQKLPVLKIWLEELKTKGKIKKKNPDWLKDILNEE* |
Ga0164293_106925062 | 3300013004 | Freshwater | MSKTSNVQRLAVLKIWLEELKRKGKIKKQPEWLKEILNED* |
Ga0164294_101828121 | 3300013006 | Freshwater | MSKSSNLQKLPVLRIWLEELKTKGKIKKKNPDWLKDILNED* |
(restricted) Ga0172367_100983395 | 3300013126 | Freshwater | MSKTSNNQKLAVLKIWLEELKRKVKPKKKNPDWLKEINDED* |
Ga0119952_10646104 | 3300014050 | Freshwater | MSKTSNLQKLSVLKIWLEEQKRKGRIKKQPAWLKEILDEN* |
(restricted) Ga0172376_100505343 | 3300014720 | Freshwater | MSKTSNNQKLAVLKIWLEELKRKVKPKKKNPNWLKEILDED* |
Ga0181363_10888481 | 3300017707 | Freshwater Lake | SNNQKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED |
Ga0181347_10296425 | 3300017722 | Freshwater Lake | KKQFMSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEILEEN |
Ga0181347_11081813 | 3300017722 | Freshwater Lake | KKQFMSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEILNED |
Ga0181347_11385831 | 3300017722 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKE |
Ga0181365_10137631 | 3300017736 | Freshwater Lake | MSKTSNLQRLSVLKIWLEEQKTKGRIKKKNPTWLKEILEEN |
Ga0181365_10481054 | 3300017736 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEIL |
Ga0181352_11826413 | 3300017747 | Freshwater Lake | MSKSSNNQKLAVLRIWLEEQKTKGKIRKKNPDWLKDILNED |
Ga0181344_10733134 | 3300017754 | Freshwater Lake | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPAWLKEILEEN |
Ga0181356_11211863 | 3300017761 | Freshwater Lake | MSKTSNNQKLAVLRIWLEEQKTKGKIRKKNPDWLKDILHED |
Ga0181343_11984343 | 3300017766 | Freshwater Lake | MSKTSNHQKLAVLKIYLEELKRKVKPKKKNPDWLK |
Ga0181358_11330451 | 3300017774 | Freshwater Lake | NNQKLAVLKIWLEEQKRKGKIKKQPNWLKEIMNED |
Ga0181357_11287191 | 3300017777 | Freshwater Lake | FMSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED |
Ga0181346_10290871 | 3300017780 | Freshwater Lake | KVKKQFMSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEILEEN |
Ga0181348_10364086 | 3300017784 | Freshwater Lake | MSNTSNNQKLAVLKIWLEEQKTKGRIKKKNPAWLKEILNED |
Ga0181355_11727552 | 3300017785 | Freshwater Lake | MSKTSNNQRLAVLKIWLEELKRKGKIKKQPDWLKEILNED |
Ga0181355_12290403 | 3300017785 | Freshwater Lake | MSKSSNNQKLAVLRIWLEEQKTKGKIRKKNPDWLKDILHED |
Ga0169931_101815586 | 3300017788 | Freshwater | MSKTSNNQKLAVLKIWLEELKRKVKPKKKNPNWLKEILDED |
Ga0181359_10395453 | 3300019784 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPDWLKEILNED |
Ga0181359_10990961 | 3300019784 | Freshwater Lake | MSKTSNHQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED |
Ga0181359_11083913 | 3300019784 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKRKGRIKKQPAWLKEILNED |
Ga0181359_11440063 | 3300019784 | Freshwater Lake | MSKTSNNQKIAVLKIWLEEQKRKGRIKKQPTWLKEILNED |
Ga0181359_11530762 | 3300019784 | Freshwater Lake | MSKTSNLQKLPVLRIWLEELKTKVKVKKKNPDWLKDILDEE |
Ga0181359_11826402 | 3300019784 | Freshwater Lake | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPDWLKEILNED |
Ga0181359_12035442 | 3300019784 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED |
Ga0181359_12451193 | 3300019784 | Freshwater Lake | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPTWLKEILNED |
Ga0211734_102009781 | 3300020159 | Freshwater | MSKTSNLQRLSVLKIWLEEQKRKGRIKKQPAWLKEILNED |
Ga0211734_108322213 | 3300020159 | Freshwater | MSNTSNNQKLAVLKIWLEEQKRKGKIKKQPVWLKEILNED |
Ga0211734_113594452 | 3300020159 | Freshwater | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPNWLKEILNED |
Ga0211733_101643543 | 3300020160 | Freshwater | MSNTSNNQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED |
Ga0208091_10019996 | 3300020506 | Freshwater | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPNWLKEILNED |
Ga0222715_104143714 | 3300021960 | Estuarine Water | MSKTSNNQKLAVLKIWLEELKQKVKPKKKNPDWLKEILDED |
Ga0222714_101230486 | 3300021961 | Estuarine Water | MSKTSNHQKLAVLKIWLEEQKRKGKIKKQPDWLKEILNED |
Ga0222714_102518113 | 3300021961 | Estuarine Water | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPEWLKEILNED |
Ga0222714_103400333 | 3300021961 | Estuarine Water | MSKTSNNQKLAVLKIWLEELKRKVKPKKKNPDWLKEIIDED |
Ga0222714_103904192 | 3300021961 | Estuarine Water | MSKSSNNQKLAVLKIYLEELKRKGKIKKQPEWLKEIMNED |
Ga0222714_106446143 | 3300021961 | Estuarine Water | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPTWLKEILEEN |
Ga0222713_101480592 | 3300021962 | Estuarine Water | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPDWLKEILDEN |
Ga0222713_102869573 | 3300021962 | Estuarine Water | MSKTSNNQRLAVLKIWLEEQKRKGKIKKQPNWLKEILNED |
Ga0222713_103106453 | 3300021962 | Estuarine Water | MSKTSNNQKLAVLKIWLEEQKTKGKIRKKNPDWLKDILNED |
Ga0222713_106527832 | 3300021962 | Estuarine Water | MSKSSNNQKLAVLRIWLEEQKTKGKIKKKNPDWLKDILNED |
Ga0222712_100696728 | 3300021963 | Estuarine Water | MSKTSNHQKLAVLKIWLEEQKRKGKIKKQPDWLKEILDEN |
Ga0181353_10993123 | 3300022179 | Freshwater Lake | MSKTSNNQKLAVLRIWLEEQKTKGKIKKKNPDWLKDILNED |
Ga0181354_10619043 | 3300022190 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEILNED |
Ga0181354_11787093 | 3300022190 | Freshwater Lake | MSKTSNNQKIAVLKIWLEEQKTKGRIKKKNPAWLKEILNED |
Ga0181354_12001781 | 3300022190 | Freshwater Lake | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPTWLKEIL |
Ga0181351_10340143 | 3300022407 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLKEILEEN |
Ga0181351_10976503 | 3300022407 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPAWLNQILNED |
Ga0181351_12571021 | 3300022407 | Freshwater Lake | VKKQFMSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPTWLNQILNED |
Ga0214923_1000264235 | 3300023179 | Freshwater | MSKTSNLQRLSVLKIWLEEQKRKGKIKKQPAWLKEILNED |
Ga0214923_100146426 | 3300023179 | Freshwater | MSKTSNLQKLSVLKIWLEEQKRKGRIKKQPAWLKEILDEN |
Ga0214923_100303333 | 3300023179 | Freshwater | MSKSSNLQKLPVLRIWLEELKTKGKIKKKNPDWLKDILNEE |
Ga0214919_103286571 | 3300023184 | Freshwater | MSKTSNLQKLSVLKIWLEEQKRKGRIKKQPAWLKE |
Ga0244775_106543252 | 3300024346 | Estuarine | MSNTSNNQKLAVLKIWLEEQKRKGRIKKQPAWLKEILNED |
Ga0256321_1134333 | 3300025743 | Freshwater | MSKTSNNQKLAVLKIWLEEQKTKGRIKKKNPVWLNQILNED |
Ga0208923_10464393 | 3300027320 | Estuarine | MSNTSNNQKLAVLKIWLEEQKRKGKIKKQPAWLKEILNED |
Ga0209297_13507662 | 3300027733 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPVWLKEILNED |
Ga0209500_101997813 | 3300027782 | Freshwater Lake | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPTWLKEILNED |
Ga0247723_10265543 | 3300028025 | Deep Subsurface Sediment | MSKTSNHQKLAVLKIYLEELKRKVKPKKKNPDWLKEILDED |
Ga0247723_11146932 | 3300028025 | Deep Subsurface Sediment | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPTWLKEILDEN |
Ga0315899_107931363 | 3300031784 | Freshwater | MSKTSNNQKLAVLKIWLEELKRKGKIKKQPDWLKEVMNED |
Ga0315900_109121133 | 3300031787 | Freshwater | MSKTSNNQKLAVLKIWLEEQKRKGKIKKQPNWLKEIMNED |
Ga0315909_102949295 | 3300031857 | Freshwater | MSKSSNLQRLQVLKIWLEELKTKGKIKKKNPDWLKDILNEE |
Ga0334722_101261013 | 3300033233 | Sediment | MSNTSNNQKLAILKIWLEEQKRKGRIKKQPSWLKEIINED |
Ga0334989_0186937_234_356 | 3300033984 | Freshwater | MSKTSNVQRLAVLKIWLEELKRKGKIKKQPEWLKEILNEE |
Ga0334979_0449006_127_252 | 3300033996 | Freshwater | MSKTSNLQKLPVLKIWLEELKTKGKIKKKNPDWLKDILNEE |
Ga0334995_0227456_663_788 | 3300034062 | Freshwater | MSKTSNNQKLAVLRIWLEEQKTKGKIKKKNPDWLKDILHED |
Ga0334995_0295964_554_679 | 3300034062 | Freshwater | MSKTSNLQRLQVLKIWLEELKTKGKIKKKNPDWLKDILNEE |
Ga0335028_0042735_1976_2098 | 3300034071 | Freshwater | MSKTSSNQKLAVLKIWLEELKRKGKIKKQPEWLKEILNED |
Ga0335033_0359014_618_728 | 3300034117 | Freshwater | SNVQRLAVLKIWLEELKRKGKIKKQPEWLKEILNED |
⦗Top⦘ |