Basic Information | |
---|---|
Family ID | F060208 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 41 residues |
Representative Sequence | MEMNAQATKLQAAENDLKQLMADVTRAMEKAQEAVARIAS |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 91.73 % |
% of genes near scaffold ends (potentially truncated) | 92.48 % |
% of genes from short scaffolds (< 2000 bps) | 92.48 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (54.887 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.587 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.376 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.617 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 9.02 |
PF03401 | TctC | 2.26 |
PF13545 | HTH_Crp_2 | 0.75 |
PF13191 | AAA_16 | 0.75 |
PF05711 | TylF | 0.75 |
PF07995 | GSDH | 0.75 |
PF00857 | Isochorismatase | 0.75 |
PF01494 | FAD_binding_3 | 0.75 |
PF00296 | Bac_luciferase | 0.75 |
PF12710 | HAD | 0.75 |
PF02796 | HTH_7 | 0.75 |
PF00034 | Cytochrom_C | 0.75 |
PF00536 | SAM_1 | 0.75 |
PF00691 | OmpA | 0.75 |
PF00326 | Peptidase_S9 | 0.75 |
PF00067 | p450 | 0.75 |
PF02653 | BPD_transp_2 | 0.75 |
PF00512 | HisKA | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 9.02 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.26 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.50 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.75 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.75 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.75 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.75 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.75 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.75 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 54.89 % |
Unclassified | root | N/A | 45.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000837|AP72_2010_repI_A100DRAFT_1003278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2284 | Open in IMG/M |
3300000858|JGI10213J12805_10184238 | Not Available | 709 | Open in IMG/M |
3300000955|JGI1027J12803_106048571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1196 | Open in IMG/M |
3300000955|JGI1027J12803_109402812 | Not Available | 537 | Open in IMG/M |
3300001867|JGI12627J18819_10088151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
3300003911|JGI25405J52794_10113614 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300004479|Ga0062595_100222145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1194 | Open in IMG/M |
3300005166|Ga0066674_10509619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 541 | Open in IMG/M |
3300005174|Ga0066680_10456385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 807 | Open in IMG/M |
3300005332|Ga0066388_104047662 | Not Available | 747 | Open in IMG/M |
3300005332|Ga0066388_104479755 | Not Available | 711 | Open in IMG/M |
3300005332|Ga0066388_106202132 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005332|Ga0066388_107935028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300005364|Ga0070673_101548905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 626 | Open in IMG/M |
3300005434|Ga0070709_11791650 | Not Available | 502 | Open in IMG/M |
3300005564|Ga0070664_101151097 | Not Available | 731 | Open in IMG/M |
3300005617|Ga0068859_103068328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 510 | Open in IMG/M |
3300005713|Ga0066905_101104797 | Not Available | 704 | Open in IMG/M |
3300005713|Ga0066905_101281812 | Not Available | 658 | Open in IMG/M |
3300005713|Ga0066905_101551918 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005713|Ga0066905_101604424 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005718|Ga0068866_11038937 | Not Available | 584 | Open in IMG/M |
3300005764|Ga0066903_100545066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1986 | Open in IMG/M |
3300005764|Ga0066903_101917278 | Not Available | 1135 | Open in IMG/M |
3300005764|Ga0066903_101972238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1120 | Open in IMG/M |
3300005764|Ga0066903_106323237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
3300005764|Ga0066903_107797762 | Not Available | 550 | Open in IMG/M |
3300005764|Ga0066903_108075147 | Not Available | 539 | Open in IMG/M |
3300005840|Ga0068870_10619412 | Not Available | 738 | Open in IMG/M |
3300006028|Ga0070717_11984102 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300006175|Ga0070712_100818257 | Not Available | 800 | Open in IMG/M |
3300006852|Ga0075433_11119251 | Not Available | 684 | Open in IMG/M |
3300007788|Ga0099795_10462717 | Not Available | 586 | Open in IMG/M |
3300010046|Ga0126384_11194339 | Not Available | 701 | Open in IMG/M |
3300010361|Ga0126378_10022429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter | 5488 | Open in IMG/M |
3300010366|Ga0126379_13446608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
3300010376|Ga0126381_102056646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 823 | Open in IMG/M |
3300010396|Ga0134126_12990778 | Not Available | 511 | Open in IMG/M |
3300010398|Ga0126383_12096971 | Not Available | 652 | Open in IMG/M |
3300012211|Ga0137377_10447644 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300012212|Ga0150985_113625339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1088 | Open in IMG/M |
3300012212|Ga0150985_118374042 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300012355|Ga0137369_10856253 | Not Available | 615 | Open in IMG/M |
3300012955|Ga0164298_10806097 | Not Available | 672 | Open in IMG/M |
3300012957|Ga0164303_10002452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 5365 | Open in IMG/M |
3300012988|Ga0164306_11888421 | Not Available | 519 | Open in IMG/M |
3300013297|Ga0157378_11907806 | Not Available | 643 | Open in IMG/M |
3300013297|Ga0157378_11930093 | Not Available | 640 | Open in IMG/M |
3300015371|Ga0132258_12989850 | Not Available | 1172 | Open in IMG/M |
3300016270|Ga0182036_10048097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2663 | Open in IMG/M |
3300016270|Ga0182036_11507663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300016294|Ga0182041_10174104 | Not Available | 1687 | Open in IMG/M |
3300016294|Ga0182041_12314545 | Not Available | 503 | Open in IMG/M |
3300016319|Ga0182033_10403112 | Not Available | 1156 | Open in IMG/M |
3300016319|Ga0182033_12066276 | Not Available | 519 | Open in IMG/M |
3300016341|Ga0182035_10933475 | Not Available | 767 | Open in IMG/M |
3300016341|Ga0182035_11508991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300016357|Ga0182032_10157478 | Not Available | 1687 | Open in IMG/M |
3300016357|Ga0182032_10303116 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300016357|Ga0182032_10835665 | Not Available | 780 | Open in IMG/M |
3300016371|Ga0182034_12036824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300016387|Ga0182040_11893976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
3300016404|Ga0182037_10468945 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300016404|Ga0182037_11668464 | Not Available | 568 | Open in IMG/M |
3300016422|Ga0182039_10975130 | Not Available | 759 | Open in IMG/M |
3300018081|Ga0184625_10658929 | Not Available | 506 | Open in IMG/M |
3300018085|Ga0187772_11414257 | Not Available | 516 | Open in IMG/M |
3300018469|Ga0190270_10276423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1480 | Open in IMG/M |
3300018920|Ga0190273_10799310 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300021168|Ga0210406_10548345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 909 | Open in IMG/M |
3300021478|Ga0210402_11499261 | Not Available | 602 | Open in IMG/M |
3300025910|Ga0207684_10038613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4052 | Open in IMG/M |
3300025915|Ga0207693_10885657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 685 | Open in IMG/M |
3300025919|Ga0207657_11456301 | Not Available | 513 | Open in IMG/M |
3300025938|Ga0207704_10339551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1165 | Open in IMG/M |
3300027181|Ga0208997_1025682 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300027669|Ga0208981_1136599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
3300027907|Ga0207428_10999594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 588 | Open in IMG/M |
3300028712|Ga0307285_10044010 | Not Available | 1101 | Open in IMG/M |
3300028875|Ga0307289_10089265 | Not Available | 1253 | Open in IMG/M |
3300030916|Ga0075386_11037320 | Not Available | 519 | Open in IMG/M |
3300031543|Ga0318516_10184772 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300031546|Ga0318538_10111798 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
3300031572|Ga0318515_10055577 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
3300031572|Ga0318515_10610411 | Not Available | 579 | Open in IMG/M |
3300031573|Ga0310915_10034824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3169 | Open in IMG/M |
3300031573|Ga0310915_10770478 | Not Available | 677 | Open in IMG/M |
3300031668|Ga0318542_10399201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
3300031668|Ga0318542_10688171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. AZCC_0083 | 534 | Open in IMG/M |
3300031682|Ga0318560_10821599 | Not Available | 502 | Open in IMG/M |
3300031719|Ga0306917_10167860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1641 | Open in IMG/M |
3300031724|Ga0318500_10372641 | Not Available | 707 | Open in IMG/M |
3300031736|Ga0318501_10442225 | Not Available | 705 | Open in IMG/M |
3300031751|Ga0318494_10412050 | Not Available | 784 | Open in IMG/M |
3300031765|Ga0318554_10707440 | Not Available | 565 | Open in IMG/M |
3300031769|Ga0318526_10163378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
3300031771|Ga0318546_10865166 | Not Available | 636 | Open in IMG/M |
3300031777|Ga0318543_10236268 | Not Available | 814 | Open in IMG/M |
3300031777|Ga0318543_10344133 | Not Available | 667 | Open in IMG/M |
3300031778|Ga0318498_10286313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
3300031819|Ga0318568_10397510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 858 | Open in IMG/M |
3300031833|Ga0310917_11114472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
3300031835|Ga0318517_10112356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1202 | Open in IMG/M |
3300031859|Ga0318527_10028617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2052 | Open in IMG/M |
3300031890|Ga0306925_10260247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1869 | Open in IMG/M |
3300031890|Ga0306925_10411604 | Not Available | 1448 | Open in IMG/M |
3300031890|Ga0306925_10947841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
3300031897|Ga0318520_10677990 | Not Available | 643 | Open in IMG/M |
3300031897|Ga0318520_11053744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300031910|Ga0306923_10393211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1578 | Open in IMG/M |
3300031910|Ga0306923_11564772 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300031912|Ga0306921_11182805 | Not Available | 852 | Open in IMG/M |
3300031959|Ga0318530_10205799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
3300032010|Ga0318569_10347979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300032025|Ga0318507_10427564 | Not Available | 576 | Open in IMG/M |
3300032025|Ga0318507_10551688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300032035|Ga0310911_10230725 | Not Available | 1057 | Open in IMG/M |
3300032035|Ga0310911_10246437 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300032035|Ga0310911_10385312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300032039|Ga0318559_10010537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3290 | Open in IMG/M |
3300032041|Ga0318549_10248166 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300032041|Ga0318549_10450525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
3300032063|Ga0318504_10509606 | Not Available | 577 | Open in IMG/M |
3300032065|Ga0318513_10526909 | Not Available | 578 | Open in IMG/M |
3300032066|Ga0318514_10037131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2311 | Open in IMG/M |
3300032066|Ga0318514_10095930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1498 | Open in IMG/M |
3300032067|Ga0318524_10426445 | Not Available | 693 | Open in IMG/M |
3300032068|Ga0318553_10319093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
3300032076|Ga0306924_12327386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
3300032094|Ga0318540_10297201 | Not Available | 779 | Open in IMG/M |
3300032180|Ga0307471_103921938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 526 | Open in IMG/M |
3300033289|Ga0310914_10433476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1190 | Open in IMG/M |
3300033290|Ga0318519_10378375 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.26% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A100DRAFT_10032783 | 3300000837 | Forest Soil | MEMNTQATKLQCAENDLKELMADVTRAMDRAQEAVAR |
JGI10213J12805_101842381 | 3300000858 | Soil | MSAQTPKLQAAENDLKQLMADVTRAMEKAQQAVARMTAKAA |
JGI1027J12803_1060485711 | 3300000955 | Soil | MGDMEMNAHASELQAAENNLKQLIAEVTRAMEKAQEAVAK |
JGI1027J12803_1094028121 | 3300000955 | Soil | MGDMEMNAHASVLQAAENNLKQLMAEVTRAMEKAQE |
JGI12627J18819_100881514 | 3300001867 | Forest Soil | MNAQAAKLQAAENDLKQLMADVSLAMEKAEEAVARIAPRQRPHP |
JGI25405J52794_101136141 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MSAQPAKLQAAENDLKQLMADVTKAMEKAQEAVARMAAKAAAP |
Ga0062595_1002221452 | 3300004479 | Soil | MNAQATKLEAAENDLKQLMADVTRAIEKAQDAVARTVSKAA |
Ga0066674_105096191 | 3300005166 | Soil | MEMNAQATKLQAAENDLKQLMADVTRAMEKAQEAVARIAS |
Ga0066680_104563852 | 3300005174 | Soil | MNAQATKLQAAENDLKQLMADVTRAMEKAQEAVARIASKAA |
Ga0066388_1040476621 | 3300005332 | Tropical Forest Soil | MRAQATKLEDAENDLKQLMADVTRAMKKAEDAVARIASKAAPLT |
Ga0066388_1044797551 | 3300005332 | Tropical Forest Soil | MEMDAQATKLQTAENDLKQLMADVTRAMEKAQDAVTRIAPKA |
Ga0066388_1062021321 | 3300005332 | Tropical Forest Soil | MSAQTPKLQAAEHDLKQLMADVTRAMEKAQEAVARLAAKA |
Ga0066388_1079350282 | 3300005332 | Tropical Forest Soil | MKAQATKLQNPENDLKQRMADVTRAAAKAQEAVARIASKAA |
Ga0070673_1015489051 | 3300005364 | Switchgrass Rhizosphere | MNEQATKLETAESDLKQLMADVSRAMEKAQEAVARLTSTVGAA |
Ga0070709_117916501 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTDDPKLQSAETDLKQLMADVTRAMEKAQQAIARVTAKETAV |
Ga0070664_1011510971 | 3300005564 | Corn Rhizosphere | MNEDATKLESAENNLKELMADVSRAMKKAEEAITRITTAGAATG |
Ga0068859_1030683281 | 3300005617 | Switchgrass Rhizosphere | MNAQAPKIEDAENDLKQLMADVTRAMEKAQQAVARIA |
Ga0066905_1011047971 | 3300005713 | Tropical Forest Soil | MNAQATKLQAAENDLKQLMADVTRVMEKAQEAVARIAFKAAAPQ* |
Ga0066905_1012818121 | 3300005713 | Tropical Forest Soil | MNAQATKLQAAENDLKQLMADVARAVEKAQEAVARI |
Ga0066905_1015519182 | 3300005713 | Tropical Forest Soil | MSAQPAKLQAAENDLKQLMADVTRAMEKAQEAVARLAAKAAA |
Ga0066905_1016044242 | 3300005713 | Tropical Forest Soil | MEMNAQATKLQAAENDLKQLMADVARAVEKAQEAVARI |
Ga0068866_110389372 | 3300005718 | Miscanthus Rhizosphere | MNPQATKLQAVENDLKQLMADVTRTMEKAQEAVARIASK |
Ga0066903_1005450661 | 3300005764 | Tropical Forest Soil | MDVSAQTPKLQAAEHDLKQLMADVTRAMEKAQEAVARLAAKA |
Ga0066903_1019172783 | 3300005764 | Tropical Forest Soil | MNAQATKLYAAENDLKQLMADVARAAEKAQEAVARI |
Ga0066903_1019722385 | 3300005764 | Tropical Forest Soil | MNAQATKLQTAENDLKQLIADVARAVEKAQEAVARITSKAAA |
Ga0066903_1063232371 | 3300005764 | Tropical Forest Soil | MDAQATKLQTAENDLKQLMADVTRAMEKAQDAVTRIAPKA |
Ga0066903_1077977621 | 3300005764 | Tropical Forest Soil | MANGEMEMNAQATKLHAAENDLKQLMADVARAAEKAQEAV |
Ga0066903_1080751471 | 3300005764 | Tropical Forest Soil | MNKGMEMDAQATKLQTAENDLKQLMADVTRAMEKAQDAVTRI |
Ga0068870_106194122 | 3300005840 | Miscanthus Rhizosphere | MNAEETKLQAVENDLKQLMVDVTRAMEKAQEAVARIASKPAPPTG |
Ga0070717_119841021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VANGEMEMNAQATKLHAAENDLKQLMADVARAAEKAQEAVARI |
Ga0070712_1008182571 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTDDTKLQSAETDLKQLMADVTRAMEKAQQAIARV |
Ga0075433_111192511 | 3300006852 | Populus Rhizosphere | VNGGIEMDAQATKLQTAENDLKQLMADVTRAMEKAQ |
Ga0099795_104627172 | 3300007788 | Vadose Zone Soil | MRRAANGEIEMNAQEPKLEDAENDLKQLMADVTRAMEKAQQAVARIAS |
Ga0126384_111943391 | 3300010046 | Tropical Forest Soil | MEMNAQATKLQAAENDLKQLMADVTRVMEKAQEAVARIAFKAAAPQ* |
Ga0126378_100224291 | 3300010361 | Tropical Forest Soil | MNTLETKLQAAEDDLKQLMADVTRAMERAQEAVARMASNGA |
Ga0126379_134466082 | 3300010366 | Tropical Forest Soil | MEMNAQATKIQAAENDLKQLMADVTRAIEKAQEAVARISS |
Ga0126381_1020566461 | 3300010376 | Tropical Forest Soil | MEMNAQATKLEAAENDLKQLMADVTRAIEKAQDAVARI |
Ga0134126_129907782 | 3300010396 | Terrestrial Soil | MQMNAQATKLEGAENDLKQLMADVTRAMEKAQEAVAR |
Ga0126383_120969712 | 3300010398 | Tropical Forest Soil | MEMNAQATKLQAAENDLKQLMADVARAVEKAQEAVARIT |
Ga0137377_104476441 | 3300012211 | Vadose Zone Soil | MEMNAQATKLQAAENNLKQLMADVTQAMEKAQEAVARIAPKAA |
Ga0150985_1136253391 | 3300012212 | Avena Fatua Rhizosphere | MNVQATKLQAVETDLKQLMADVTRAMEKAQEAVARI |
Ga0150985_1183740421 | 3300012212 | Avena Fatua Rhizosphere | MGDKMNAQATKLQAVENDLKELMADVTRAMVKAQEAVA |
Ga0137369_108562531 | 3300012355 | Vadose Zone Soil | MEMIAQATKLQAAENDLKQLMADVTQAMEKAQEAVARIASKPAA |
Ga0164298_108060972 | 3300012955 | Soil | MEMNAQATKLHAVENDLKQLMADVTRAMEKAQEAVARIASK |
Ga0164303_100024527 | 3300012957 | Soil | MEMNAQAPKLEAAENDLKQLMADVTRAIEKAQEAVARI |
Ga0164306_118884211 | 3300012988 | Soil | MEMNAPATKLQAVENDLKQLMADVTQAMEKAQEAVARIA |
Ga0157378_119078061 | 3300013297 | Miscanthus Rhizosphere | MNEDATKLESAESNLKKLMADVSRAMEKAEEAITRIT |
Ga0157378_119300931 | 3300013297 | Miscanthus Rhizosphere | MKMNEQATKLETAASDLKQLMADVSRAMEKAQDAVA |
Ga0132258_129898502 | 3300015371 | Arabidopsis Rhizosphere | MEMNPQATKLQAVENDLKQLMADVTRTMEKAQEAVARIASK |
Ga0182036_100480974 | 3300016270 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAHEVAARIASKP |
Ga0182036_115076631 | 3300016270 | Soil | RATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAASLRLPDDH |
Ga0182041_101741041 | 3300016294 | Soil | MEMKTQATKLQAAEDELKQLMADVSRAMRKAEEAIARIAPN |
Ga0182041_123145451 | 3300016294 | Soil | MNAQPTKLQDAENDLKQLMADVTRAVEKAQEAVARLTSKATA |
Ga0182033_104031121 | 3300016319 | Soil | VANGEMEMNAQATKLQAAEDDLKQLMADVARAAEKAQEAVARI |
Ga0182033_120662761 | 3300016319 | Soil | MNTQATKLQAAEDDLKQLMADVTRAMEKAQEVAARIASKAA |
Ga0182035_109334752 | 3300016341 | Soil | MNKQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIAS |
Ga0182035_115089912 | 3300016341 | Soil | MNTQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIASKAVA |
Ga0182032_101574782 | 3300016357 | Soil | MGMNTQATKLQAAEDDLKQQMADVTRAMERAQEAVARITSNEAATSRHEVGG |
Ga0182032_103031161 | 3300016357 | Soil | MNTQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIASKA |
Ga0182032_108356651 | 3300016357 | Soil | KMNAQVTKLQAAENDLKELMADMTRAIKKAEEPLGR |
Ga0182034_120368242 | 3300016371 | Soil | NRGMKMNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAASLRLPDDH |
Ga0182040_118939762 | 3300016387 | Soil | VANGEMEMNAQATKLQAAETDLKQLMVDVARAVEKAQE |
Ga0182037_104689452 | 3300016404 | Soil | VANGEMEMNAQATKLQAAENDLKQLMADVARAAEKAQEAVARITS |
Ga0182037_116684641 | 3300016404 | Soil | VANGEMEMNAQATKLHAAENDLKQLMADVARAAEKAQEAVARITSKA |
Ga0182039_109751301 | 3300016422 | Soil | MEMKAQATKLQAAEDDLKRLMSDVSRAMRKAEEAIARI |
Ga0184625_106589291 | 3300018081 | Groundwater Sediment | MNEDATKLESAESNLKELMADVSRAMEKAQEAVARLTSTAGAAT |
Ga0187772_114142572 | 3300018085 | Tropical Peatland | MEMNAQATKFQAAENNLKELMADVSRAMEKAQEAVARIA |
Ga0190270_102764232 | 3300018469 | Soil | MNAQAPKLEDAENDLKQLMADVTRAMEKAQEAVARMPPTP |
Ga0190273_107993102 | 3300018920 | Soil | MNAQGTKLQSVENDLKELMADVTRAMEKAQEAVAR |
Ga0210406_105483451 | 3300021168 | Soil | MNAQAPKLEDAENDLKQLMADVTRAMEKAQQAVARIASKPA |
Ga0210402_114992611 | 3300021478 | Soil | MGDMQKSTQAMKLQAAENDLKELMADVARAMEKAQEEVARIASNAVALE |
Ga0207684_100386131 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAQATKLQAAENGLKQLMADVTRTIEKAQQAVARISSRPRRPQQR |
Ga0207693_108856571 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAQATKIQAAENDLKQLMADVTQAIEKAQQAVARISPKAA |
Ga0207657_114563011 | 3300025919 | Corn Rhizosphere | MNEQATKLETAASDLKQLMADVSRAMEKAQDAVARLTSTVGAA |
Ga0207704_103395513 | 3300025938 | Miscanthus Rhizosphere | MNEQATKLETAESDLKQLMADVSRAMEKAQEAVARLTSTVG |
Ga0208997_10256821 | 3300027181 | Forest Soil | MNAQAPKLEDAENDLKQLMADVTRAMEKAQQAVARIASKPAAAI |
Ga0208981_11365992 | 3300027669 | Forest Soil | VNAQATKLQAVESDLKQLMVDVTRAMEKAQEAVARIA |
Ga0207428_109995941 | 3300027907 | Populus Rhizosphere | MNEQATKLETAESDLKQLMADVSRAMEKAQEAVARLTS |
Ga0307285_100440102 | 3300028712 | Soil | MNAQATKLHAVENDLKQLMADVTRAMEKAQEDVAR |
Ga0307289_100892651 | 3300028875 | Soil | MGGEWDMEMNAQATKIQAAENNLKQLMADVTRAMEKAQEAVARIAA |
Ga0075386_110373201 | 3300030916 | Soil | MNAQATKLHAVENDLKQLMADVTRAMEKAQEAVARIAS |
Ga0318516_101847721 | 3300031543 | Soil | MNKQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIASK |
Ga0318538_101117981 | 3300031546 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAAPLRLP |
Ga0318515_100555771 | 3300031572 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAQEVAARI |
Ga0318515_106104111 | 3300031572 | Soil | MNAQATKLQAAENDLKQLMTDVSLAMEKAQEAVARIA |
Ga0310915_100348244 | 3300031573 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAASLRLPDDH |
Ga0310915_107704784 | 3300031573 | Soil | VANGEMEMNAQATKLHAAENDLKQLMADVARAAEK |
Ga0318542_103992012 | 3300031668 | Soil | VANGEMEMNAQAPKLQAAESDLKQLMADVARAMEKVQEAVARTTSKAA |
Ga0318542_106881711 | 3300031668 | Soil | MKAQATKLQAAENDLKQLMADVTRAMEKAQEAVARRASK |
Ga0318560_108215992 | 3300031682 | Soil | TQATKLQAAEDDLKKLMADVTRAMERAQEAVARITSNEAATSRHEVGG |
Ga0306917_101678601 | 3300031719 | Soil | MEMNAQATKLQAAENDLKQLMTDVSLAMEKAQEAVARIAP |
Ga0318500_103726412 | 3300031724 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAHEVAARIASKPAAASL |
Ga0318501_104422251 | 3300031736 | Soil | MNAQATKLHAAENDLKQLMADVARAAEKAQEAVARITSKAA |
Ga0318494_104120501 | 3300031751 | Soil | MKMNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAAPLR |
Ga0318554_107074401 | 3300031765 | Soil | MNKQGTKLQAAEDDLKQLMADVTRAMEKAQEVAAR |
Ga0318526_101633784 | 3300031769 | Soil | VANGEMEMNAQATKLQAAETDLKQLMVDLARAVEKAQETV |
Ga0318546_108651662 | 3300031771 | Soil | MNARATKLQAAETDLKQLMADVARAVEKAQEAVARITSKVAAAPLR |
Ga0318543_102362681 | 3300031777 | Soil | VANGEMEMNAQATKLQAAENDLKQLMADVTRAMEKAQEAVARIGFK |
Ga0318543_103441331 | 3300031777 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIA |
Ga0318498_102863132 | 3300031778 | Soil | MNTQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIASKPAAAPLRLPDDH |
Ga0318568_103975101 | 3300031819 | Soil | ETEMNKQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIASKPAAASLRLPDDH |
Ga0310917_111144721 | 3300031833 | Soil | VANGEMEMNAQATKLQAAETDLKQLMVDVARAMEKAQE |
Ga0318517_101123563 | 3300031835 | Soil | MKMNARATKLQAAENDLKQLMANVTRAMEKAQEVAARIASKPAAAPLRLPDDH |
Ga0318527_100286173 | 3300031859 | Soil | MNAQATKLQAAENDLKQLMADVTRAMEKAQEAVARIAFKAAA |
Ga0306925_102602471 | 3300031890 | Soil | MNARATKLQAAEDDLKQLMADVTRAMEKAHEVAARIA |
Ga0306925_104116041 | 3300031890 | Soil | MNAQATELQAENDLKQLMADLTRAMEKAQEAVAKIAPKTAAT |
Ga0306925_109478413 | 3300031890 | Soil | MNAQATKLQAAETDLKQLMVDVARAVEKAQEAVARITSKAA |
Ga0318520_106779901 | 3300031897 | Soil | MEMSAQATRLEAAENDLKELMADVTSAIEKAQLDVTKIDP |
Ga0318520_110537442 | 3300031897 | Soil | NARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAASLRLPDDH |
Ga0306923_103932113 | 3300031910 | Soil | MNTEDTKLQSAETDLKQLMADVTRAMEKAQKAIARVTSKE |
Ga0306923_115647722 | 3300031910 | Soil | MRARATKILAAENDLKLLMADVTRAMEKAQDAVAR |
Ga0306921_111828052 | 3300031912 | Soil | VADGEMEMNAQATKLHAAENDLKQLMADVARAAEKAQEAVARIT |
Ga0318530_102057991 | 3300031959 | Soil | MNAQATKLQAAETDLKQLMVDVARAVEKAQEAVARITSKAAAAT |
Ga0318569_103479791 | 3300032010 | Soil | MNAQATKLQAAETDLKQLMVDVARAVEKAQEAVARIT |
Ga0318507_104275642 | 3300032025 | Soil | MEMNAQATKLYAAENDLKQLMADVARAAEKAQEAVARIT |
Ga0318507_105516882 | 3300032025 | Soil | NGETEMNKQGTKLQAAEDDLKQLMADVTRAMEKAQEVAARIASKPAAASLRLPDDH |
Ga0310911_102307253 | 3300032035 | Soil | MNAQATKLHAAENDLKQLMADVARAAEKAQEAVARITSKAATA |
Ga0310911_102464371 | 3300032035 | Soil | MKMNARATKLQAAENDLKQLMADVTRTMEKAQEVAARIASKPAA |
Ga0310911_103853123 | 3300032035 | Soil | VANGEMEMNAQATKLQAAETDLKQLMVDVARAMEKAQEAV |
Ga0318559_100105372 | 3300032039 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAAPLRLPDDH |
Ga0318549_102481661 | 3300032041 | Soil | MNAQATKLQAAENDLKQLMADVTRAMEKAQEAVARVA |
Ga0318549_104505251 | 3300032041 | Soil | VANGEMEMNAQATKLQAAETDLKQLMVDVARAVEKA |
Ga0318504_105096061 | 3300032063 | Soil | MNAQATKLQAAENDLKQLMTDVSLAMEKAQEAVARIAPR |
Ga0318513_105269091 | 3300032065 | Soil | VANGEMEMNAQATKLHAAENDLKQLMADVARAAEKAQEAV |
Ga0318514_100371311 | 3300032066 | Soil | MNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAASLR |
Ga0318514_100959303 | 3300032066 | Soil | MNAQATKLHAAEDDLKQLMADVARAAEKAQEAVARITSKAATATT |
Ga0318524_104264452 | 3300032067 | Soil | MEMNAQATKLHAAENDLKQVMADVARAAEKAQEAVARITSKAAIATT |
Ga0318553_103190932 | 3300032068 | Soil | MNAQATKLHAAEDDLKQLMADVARAAEKAQEAVARITS |
Ga0306924_123273861 | 3300032076 | Soil | MTAPTTKLQAAEHDLKQLMVDVTRAAEKAQQAVARITGKAMANAVTE |
Ga0318540_102972013 | 3300032094 | Soil | MEMNAQATKLHAAENDLKQLMADVARAAEKAQEAVARITSKA |
Ga0307471_1039219381 | 3300032180 | Hardwood Forest Soil | ANGEMEMNAQAPKVEDAENDLQQLMADVTRAMEKAQ |
Ga0310914_104334763 | 3300033289 | Soil | MKAHATKLQAAENDLKQLMADVTRAMQKAEEAVARIVSET |
Ga0318519_103783751 | 3300033290 | Soil | MKMNARATKLQAAENDLKQLMADVTRAMEKAQEVAARIASKPAAA |
⦗Top⦘ |