Basic Information | |
---|---|
Family ID | F060372 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 45 residues |
Representative Sequence | MAIVIEYYVPEKFRKQSGKWIPLEQRGKIIPFPAPEKKSA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 55.64 % |
% of genes near scaffold ends (potentially truncated) | 26.32 % |
% of genes from short scaffolds (< 2000 bps) | 76.69 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.940 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.068 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.827 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.368 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 0.00% Coil/Unstructured: 95.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF02954 | HTH_8 | 13.53 |
PF00196 | GerE | 5.26 |
PF00158 | Sigma54_activat | 5.26 |
PF00072 | Response_reg | 3.01 |
PF13185 | GAF_2 | 3.01 |
PF13426 | PAS_9 | 2.26 |
PF02518 | HATPase_c | 2.26 |
PF07730 | HisKA_3 | 2.26 |
PF00078 | RVT_1 | 1.50 |
PF13620 | CarboxypepD_reg | 1.50 |
PF01590 | GAF | 1.50 |
PF01594 | AI-2E_transport | 1.50 |
PF10431 | ClpB_D2-small | 1.50 |
PF08447 | PAS_3 | 1.50 |
PF13191 | AAA_16 | 0.75 |
PF00155 | Aminotran_1_2 | 0.75 |
PF01609 | DDE_Tnp_1 | 0.75 |
PF14534 | DUF4440 | 0.75 |
PF08240 | ADH_N | 0.75 |
PF00165 | HTH_AraC | 0.75 |
PF01182 | Glucosamine_iso | 0.75 |
PF13492 | GAF_3 | 0.75 |
PF03466 | LysR_substrate | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 2.26 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 2.26 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 2.26 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 2.26 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.50 |
COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.75 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.75 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.75 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.75 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.94 % |
Unclassified | root | N/A | 24.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17326943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 21536 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100757804 | All Organisms → cellular organisms → Bacteria | 4171 | Open in IMG/M |
3300000789|JGI1027J11758_12917696 | Not Available | 508 | Open in IMG/M |
3300000955|JGI1027J12803_100151510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11721 | Open in IMG/M |
3300001867|JGI12627J18819_10098065 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300002914|JGI25617J43924_10071387 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300002917|JGI25616J43925_10195656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 784 | Open in IMG/M |
3300002917|JGI25616J43925_10300207 | Not Available | 598 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10071925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1349 | Open in IMG/M |
3300004152|Ga0062386_100616286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300004268|Ga0066398_10060898 | Not Available | 790 | Open in IMG/M |
3300005167|Ga0066672_10015320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3864 | Open in IMG/M |
3300005167|Ga0066672_10386502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
3300005174|Ga0066680_10077733 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300005332|Ga0066388_102457272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 946 | Open in IMG/M |
3300005434|Ga0070709_10137355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1676 | Open in IMG/M |
3300005434|Ga0070709_11247876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 598 | Open in IMG/M |
3300005436|Ga0070713_102437082 | Not Available | 506 | Open in IMG/M |
3300005439|Ga0070711_100053378 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
3300005526|Ga0073909_10651682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 524 | Open in IMG/M |
3300005554|Ga0066661_10002807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7548 | Open in IMG/M |
3300005555|Ga0066692_10095126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1757 | Open in IMG/M |
3300005591|Ga0070761_10818074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300005719|Ga0068861_101163368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 744 | Open in IMG/M |
3300005921|Ga0070766_10008369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5280 | Open in IMG/M |
3300005921|Ga0070766_10808204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300006028|Ga0070717_10277909 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300006028|Ga0070717_10456903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1151 | Open in IMG/M |
3300006059|Ga0075017_100160084 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300006163|Ga0070715_10676215 | Not Available | 614 | Open in IMG/M |
3300006173|Ga0070716_101004738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300006175|Ga0070712_101742193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 545 | Open in IMG/M |
3300006176|Ga0070765_100155663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2043 | Open in IMG/M |
3300006797|Ga0066659_10128523 | Not Available | 1770 | Open in IMG/M |
3300006854|Ga0075425_102440727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 580 | Open in IMG/M |
3300006914|Ga0075436_101113258 | Not Available | 595 | Open in IMG/M |
3300007255|Ga0099791_10096259 | Not Available | 1359 | Open in IMG/M |
3300009038|Ga0099829_10612959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 905 | Open in IMG/M |
3300009038|Ga0099829_11020820 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300009143|Ga0099792_10149464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
3300009792|Ga0126374_10008881 | All Organisms → cellular organisms → Bacteria | 3827 | Open in IMG/M |
3300011269|Ga0137392_10273767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
3300011269|Ga0137392_11549265 | Not Available | 521 | Open in IMG/M |
3300011271|Ga0137393_10171829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1819 | Open in IMG/M |
3300012189|Ga0137388_10075678 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
3300012202|Ga0137363_10051046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2965 | Open in IMG/M |
3300012202|Ga0137363_11072832 | Not Available | 684 | Open in IMG/M |
3300012203|Ga0137399_10328740 | Not Available | 1267 | Open in IMG/M |
3300012203|Ga0137399_10891713 | Not Available | 749 | Open in IMG/M |
3300012205|Ga0137362_10204864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1698 | Open in IMG/M |
3300012205|Ga0137362_11304084 | Not Available | 611 | Open in IMG/M |
3300012210|Ga0137378_10305116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1481 | Open in IMG/M |
3300012211|Ga0137377_11632524 | Not Available | 568 | Open in IMG/M |
3300012683|Ga0137398_10810650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300012685|Ga0137397_10001322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17290 | Open in IMG/M |
3300012685|Ga0137397_10388562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1039 | Open in IMG/M |
3300012923|Ga0137359_10053603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3509 | Open in IMG/M |
3300012924|Ga0137413_10308371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
3300012924|Ga0137413_10861507 | Not Available | 701 | Open in IMG/M |
3300012925|Ga0137419_11970504 | Not Available | 502 | Open in IMG/M |
3300012929|Ga0137404_10349111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
3300012929|Ga0137404_11145339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300012929|Ga0137404_12237709 | Not Available | 511 | Open in IMG/M |
3300012930|Ga0137407_10582705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
3300012944|Ga0137410_11217999 | Not Available | 649 | Open in IMG/M |
3300015241|Ga0137418_10413198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1098 | Open in IMG/M |
3300015242|Ga0137412_10073009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2792 | Open in IMG/M |
3300015245|Ga0137409_10466684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
3300015264|Ga0137403_10021400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6929 | Open in IMG/M |
3300015264|Ga0137403_11532014 | Not Available | 518 | Open in IMG/M |
3300016445|Ga0182038_11947105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300018468|Ga0066662_10046333 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
3300018468|Ga0066662_10437814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
3300020199|Ga0179592_10305161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300020580|Ga0210403_10486497 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300020583|Ga0210401_10021988 | All Organisms → cellular organisms → Bacteria | 6108 | Open in IMG/M |
3300020583|Ga0210401_10093023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2833 | Open in IMG/M |
3300020583|Ga0210401_10341005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
3300020583|Ga0210401_11299246 | Not Available | 585 | Open in IMG/M |
3300021171|Ga0210405_10039758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3744 | Open in IMG/M |
3300021180|Ga0210396_10025137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5513 | Open in IMG/M |
3300021180|Ga0210396_10031474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4904 | Open in IMG/M |
3300021181|Ga0210388_10009016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7903 | Open in IMG/M |
3300021401|Ga0210393_11640056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300021403|Ga0210397_10125242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1767 | Open in IMG/M |
3300021404|Ga0210389_10699347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 794 | Open in IMG/M |
3300021404|Ga0210389_11054118 | Not Available | 629 | Open in IMG/M |
3300021405|Ga0210387_10167855 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
3300021432|Ga0210384_10068358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3201 | Open in IMG/M |
3300021432|Ga0210384_11274298 | Not Available | 640 | Open in IMG/M |
3300021477|Ga0210398_10240879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1474 | Open in IMG/M |
3300021559|Ga0210409_10228329 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300021560|Ga0126371_10751681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300025898|Ga0207692_10061076 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300025928|Ga0207700_10196576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1697 | Open in IMG/M |
3300025928|Ga0207700_10487123 | Not Available | 1090 | Open in IMG/M |
3300025929|Ga0207664_10849892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300025929|Ga0207664_11601734 | Not Available | 573 | Open in IMG/M |
3300025939|Ga0207665_10465794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
3300026309|Ga0209055_1000084 | All Organisms → cellular organisms → Bacteria | 59328 | Open in IMG/M |
3300026328|Ga0209802_1199582 | Not Available | 771 | Open in IMG/M |
3300026334|Ga0209377_1057107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1721 | Open in IMG/M |
3300026469|Ga0257169_1077672 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300026490|Ga0257153_1038891 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300026551|Ga0209648_10099529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2384 | Open in IMG/M |
3300027070|Ga0208365_1035189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 663 | Open in IMG/M |
3300027071|Ga0209214_1045171 | Not Available | 594 | Open in IMG/M |
3300027073|Ga0208366_1018831 | Not Available | 754 | Open in IMG/M |
3300027575|Ga0209525_1083968 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300027667|Ga0209009_1152849 | Not Available | 587 | Open in IMG/M |
3300027727|Ga0209328_10139359 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300027842|Ga0209580_10392156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300027846|Ga0209180_10501240 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300027855|Ga0209693_10036797 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
3300027903|Ga0209488_10002239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16040 | Open in IMG/M |
3300028800|Ga0265338_10957914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300028906|Ga0308309_10102008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2221 | Open in IMG/M |
3300030730|Ga0307482_1066395 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300030991|Ga0073994_12009037 | Not Available | 777 | Open in IMG/M |
3300031231|Ga0170824_123611348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1014 | Open in IMG/M |
3300031708|Ga0310686_105571356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
3300031708|Ga0310686_116337787 | Not Available | 526 | Open in IMG/M |
3300031715|Ga0307476_11071340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300031715|Ga0307476_11276301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300031718|Ga0307474_10001109 | All Organisms → cellular organisms → Bacteria | 19646 | Open in IMG/M |
3300031718|Ga0307474_10138951 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
3300031754|Ga0307475_10000199 | All Organisms → cellular organisms → Bacteria | 36587 | Open in IMG/M |
3300031754|Ga0307475_10224717 | Not Available | 1503 | Open in IMG/M |
3300031962|Ga0307479_10000849 | All Organisms → cellular organisms → Bacteria | 27618 | Open in IMG/M |
3300032180|Ga0307471_100711952 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300032180|Ga0307471_102075918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 714 | Open in IMG/M |
3300032205|Ga0307472_100358685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 1200 | Open in IMG/M |
3300032829|Ga0335070_11653745 | Not Available | 581 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.27% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.02% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.50% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.75% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_01294570 | 2088090014 | Soil | MSLGMITAMAIVIQVYVPEKFRKPSEKWIPPEQRGKVIPFPAPEKKSA |
INPhiseqgaiiFebDRAFT_1007578042 | 3300000364 | Soil | MAIVIQVYVPEKFRKPSEKWIPPEQRGKVIPFPAPEKKSA* |
JGI1027J11758_129176961 | 3300000789 | Soil | MRSDLLRVRMGMVTAMAIVIEYYIPEKFRKQGGKWIPPEQRGKVIPFPYGNR |
JGI1027J12803_1001515103 | 3300000955 | Soil | MSLGMITAMAIVIQVYVPEKFRKPSEKWIPPEQRGKVIPFPAPEKKSA* |
JGI12627J18819_100980653 | 3300001867 | Forest Soil | MAKVIEFCVREKFRKPSGKWIPPEQRGKIIPFTAPEKKSA* |
JGI25617J43924_100713872 | 3300002914 | Grasslands Soil | MAKVIEFYVPKKFRKPSGKWSPPEECGKIIPFXTPEKKSA* |
JGI25616J43925_101956562 | 3300002917 | Grasslands Soil | MAIVIEYYVPEKFQKQSGKWIPIEQRGKIIPFPAPEKKSA* |
JGI25616J43925_103002072 | 3300002917 | Grasslands Soil | MAIVIEYYVPEKFRKQSGKWIPLEQRGKIIPFPAPEKKSA* |
JGIcombinedJ51221_100719253 | 3300003505 | Forest Soil | MRSNLLRVRLGVVAAMAKVIEYHVPEKFRKQSGKWIPPEQRGKVILFPAPEKKSA* |
Ga0062386_1006162862 | 3300004152 | Bog Forest Soil | MAKVIKYYVPEKFRKNAGRWIPPDQRGKIIPFPAPEQMSA* |
Ga0066398_100608982 | 3300004268 | Tropical Forest Soil | VEVTAIVKVIEFYVPEKFRKTSGKWIPSEQRGKIIPFIAPEKKSA* |
Ga0066672_100153201 | 3300005167 | Soil | MAKLIEFYVPDGFQKIAKWIPPEQRGKVIPFPAPEKKSA* |
Ga0066672_103865021 | 3300005167 | Soil | MAKVIEFYVPDGFQKIAKWIPPEQRGKIIPFPAPEKKSA* |
Ga0066680_100777332 | 3300005174 | Soil | VGVVMAKLIEFYVPDGFQKIAKWIPPEQRGKVIPFRAPEKKSA* |
Ga0066388_1024572721 | 3300005332 | Tropical Forest Soil | MGSHSLPVRLGMVTAMAIVIEYYLPEKFRKQSGKWIPPEQRGKIILFPAPEKKSA* |
Ga0070709_101373553 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVIDYYVPEKFRKQSGKWIPPEQRGKIIPFPTPERKSA* |
Ga0070709_112478761 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKLIEFYVPDGIKTSAKWIPPEQRGKVIPFPVPQKTGA*SVWLETEG |
Ga0070713_1024370821 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVIEFYVPEKFRKQSEKWTPLDYRGKIIPFPAPEKKSA* |
Ga0070711_1000533782 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKVIEYYVPEKFRKQSGKRIPPEQRGKIIPFPAPEKKSA* |
Ga0073909_106516821 | 3300005526 | Surface Soil | RLVIRRGVRLGMVMAMAKIIQYYMPEKFRKQSGKWISPGQGGKIIRFPAPEKKSA* |
Ga0066661_100028076 | 3300005554 | Soil | LGVVMAKVIEFYVPDGFQKIAKWIPPEQRGKIIPFPAPEKKSA* |
Ga0066692_100951264 | 3300005555 | Soil | MAVVIEFYVPQKFRKLSGKWIPPEQRGTIIRFPAPEKKSA* |
Ga0070761_108180742 | 3300005591 | Soil | MVIVIEFYVPEQFRKQCGKWIPPEQRGKIIPFPAPEKKSA* |
Ga0068861_1011633682 | 3300005719 | Switchgrass Rhizosphere | MEIVIEYYVPEKFRKQSGKWIPPEQRGKIIPFPAPEKKSA* |
Ga0070766_100083697 | 3300005921 | Soil | MRSHPLRVRLGMVAAMAIVIEFYVPEKFRKNKAEKWIPRRQHGMIIRFPAPEEKSA* |
Ga0070766_108082041 | 3300005921 | Soil | MVIVIEFYVPEKFCKQCGKWIPPEQRGKIIPFPAPEKKSA* |
Ga0070717_102779091 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSVVTAMAIVIDYYVPEKFRKQSGKWIPPEQRGKIIPFPTPERKSA* |
Ga0070717_104569034 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVIDYYVPEKFRKQSGKWMPPEQRGKIIPFPAPERKSA* |
Ga0075017_1001600843 | 3300006059 | Watersheds | MAKVIEYYVPEKFRKQSGKWIRPEQRGKVILFPAQEVSMTC* |
Ga0070715_106762152 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVIEYYVPEKFQKQSGKWIPYEERSKIIPFRTPERKSA* |
Ga0070716_1010047382 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVIDYYVPEKFRKQSGKWIPLEQRGKIIPFPAPERKSA* |
Ga0070712_1017421932 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLGMITAMAIVIQFYVPERFRKPREKWIPPEQRGKVIPFPTPEKKSA* |
Ga0070765_1001556633 | 3300006176 | Soil | MAIVIEFYVPEKFRKNKAEKWIPRRQHGMIIRFPAPEEKSA* |
Ga0066659_101285232 | 3300006797 | Soil | MAKLIEFYVPDGFQKIAKWIPPEQRGKVIPFRAPEKKSA* |
Ga0075425_1024407272 | 3300006854 | Populus Rhizosphere | MIAAMAIVIEYYVPENFRKQSGKWIPPKQRGKIIPFRHR |
Ga0075436_1011132581 | 3300006914 | Populus Rhizosphere | MAKVIEFYVPEKFRKPSGKRIPPEQWGKIIPFTAPEKKSA* |
Ga0099791_100962593 | 3300007255 | Vadose Zone Soil | MVTAMAIFIEYYVPEKFRKQSGKWIPAERRGKIIRFPVPEK |
Ga0099829_106129591 | 3300009038 | Vadose Zone Soil | MVTAMAKVIEYYVAEKFRKQSGKWIPPEQRGKVILFPAPEKKSA* |
Ga0099829_110208202 | 3300009038 | Vadose Zone Soil | MVTAMEIVIEYYVPEKFRKRSGKWIPPEQRGKIIPFPAPEKKSA* |
Ga0099792_101494643 | 3300009143 | Vadose Zone Soil | MAIVIDYYVPEKFRKQSGKWIPSEQRGKIILFPASEKKSA* |
Ga0126374_100088813 | 3300009792 | Tropical Forest Soil | MVTAMAIVIEYYLPEKFRKQSGKWIPPEQRGKIILFPAPEKKSA* |
Ga0137392_102737672 | 3300011269 | Vadose Zone Soil | MAIVIEYYVPEKFRKQSGKWIPPKQRGKIIAFPTPEKKSA* |
Ga0137392_115492652 | 3300011269 | Vadose Zone Soil | MVTAMAKVIEFYVPKKFRKPSGKWSPPEECGKIIPFPAPEKKSA* |
Ga0137393_101718291 | 3300011271 | Vadose Zone Soil | MVTAMAKVIEFYVPEKFRKPIGKWSPPEQCGKIIPFPAPEKKSA* |
Ga0137388_100756784 | 3300012189 | Vadose Zone Soil | MAIVIEYYVPQKFRKQSGKWIPPEQRGKVILFPAPEKKSA* |
Ga0137363_100510462 | 3300012202 | Vadose Zone Soil | MAIVIEYYVPEKFQKQSGKWIPLEQRGKIIPFPAPEKKSA* |
Ga0137363_110728323 | 3300012202 | Vadose Zone Soil | VRLEKVTAMAIVIEYYVPEKLRRESEKRTPIEQRGKVIPFPVAVK |
Ga0137399_103287402 | 3300012203 | Vadose Zone Soil | MAIVIEYYVPEKFRKQSGKWIPPKQRGKIIPFLTPEKKSA* |
Ga0137399_108917131 | 3300012203 | Vadose Zone Soil | MAIVIEYYVPEKFQKQSEKWIPLEQRGKIIPFPAPEKKSA* |
Ga0137362_102048641 | 3300012205 | Vadose Zone Soil | LAASLERLEKVTAMAIVIEYYVPEKFRKQSGKWIPPKQRGKIIAFLTPEKKSA* |
Ga0137362_113040841 | 3300012205 | Vadose Zone Soil | MRLGMVTAMAIVIEYYVPEKFRKQSAKWIPPEQRGKIISFPLLEKKSA* |
Ga0137378_103051161 | 3300012210 | Vadose Zone Soil | MAIVIEYYVPQKFRKQSGKWIPPEQRGKVILFPAPEKSA* |
Ga0137377_116325242 | 3300012211 | Vadose Zone Soil | AKVIEFYVPEKFRKPSGKRIPPEQWGKIIPFTAPEKKSA* |
Ga0137398_108106502 | 3300012683 | Vadose Zone Soil | MAIVIDYYVPEKFRKQSGKWIPPEQRGKVILFPAPEKKSA* |
Ga0137397_1000132214 | 3300012685 | Vadose Zone Soil | MVTAMAIFIEYYVPEKFRKQSGKWIPAERRGKIIRFPVPEKKSA* |
Ga0137397_103885622 | 3300012685 | Vadose Zone Soil | VRLEMVTAMAIVIEYYVPEKFQKQRGTWIPPEQRGKIIPFPMPERKSA* |
Ga0137359_100536032 | 3300012923 | Vadose Zone Soil | MAIVIEYYVPEKFRRENEKRTPIEQRGKVIPFPVAVKKSA* |
Ga0137413_103083713 | 3300012924 | Vadose Zone Soil | LIEYYVPEKFQKQSGKWVPPEQRGKIIPFPTPERKSA* |
Ga0137413_108615073 | 3300012924 | Vadose Zone Soil | MAIVIDYYVPEKFRKQSGKWIPPEQRGKIILFPASEKKSA* |
Ga0137419_119705042 | 3300012925 | Vadose Zone Soil | MAILIEYYVPEKFQKQSGKWVPPEQRGKIIPFPAMERKSA* |
Ga0137404_103491113 | 3300012929 | Vadose Zone Soil | MVTAMAIVIEYYVPEKFRKQTGKWTPAEQRGKVIPFPVAVKKSA* |
Ga0137404_111453391 | 3300012929 | Vadose Zone Soil | LVRLEKVTAMAIVIEYYVPEKFRRENEKRTPTEHRGKVIPFPVAVKKSA* |
Ga0137404_122377092 | 3300012929 | Vadose Zone Soil | SRSPIEYYLPEKFRKPSGKWIPPERRGKIIRFPVPEKKSA* |
Ga0137407_105827051 | 3300012930 | Vadose Zone Soil | RRRNLAASLVRLEKVTAMAIVIEYYVPEKFRRENEKRTPIEQRGKVIPFPVAVKKSA* |
Ga0137410_112179991 | 3300012944 | Vadose Zone Soil | MVTAMAIFIEYYVPEKLRKQSGKWISPERGGKIIRFPVAEKKSA* |
Ga0137418_104131981 | 3300015241 | Vadose Zone Soil | PVRSSGQRRRNLAASLVRLEKVTAMAIVIEYYVPEKFRRENEKRTPIEQRGKVIPFPVAVKKSA* |
Ga0137412_100730094 | 3300015242 | Vadose Zone Soil | SVVTAMAILIEYYVPEKFQKQSGKWVPPEQRGKIIPFPTPERKSA* |
Ga0137409_104666842 | 3300015245 | Vadose Zone Soil | MVTAMAIFIEYYVPEKFRKPSGKWIPPEQRGKIIRFPAPEKKSA* |
Ga0137403_100214005 | 3300015264 | Vadose Zone Soil | MAIVIEYYVPEKFRRESEKRTPIEQRGKVIPFPVAVKKSA* |
Ga0137403_115320142 | 3300015264 | Vadose Zone Soil | MVTVMAIVIEYYVPEKFRKQRGKWSPAEQRGKVIPFPVAVK |
Ga0182038_119471051 | 3300016445 | Soil | VIEYYVPDKFRKIGKWIPPSLRGKVIRFPEAQKKTA |
Ga0066662_100463332 | 3300018468 | Grasslands Soil | MAKLIEFYVPDGFQKIAKWIPPEQRGKVIPFPAPEKKSA |
Ga0066662_104378142 | 3300018468 | Grasslands Soil | VGVVMAKLIEFYVPDGFQKIAKWIPPEQRGKVIPFRAPEKKSA |
Ga0179592_103051612 | 3300020199 | Vadose Zone Soil | MAIVIEYYVPEKFQKQSGKWIPLEQRGKIIPFPAPEKKSA |
Ga0210403_104864971 | 3300020580 | Soil | MRSHLLRMRLGMVTPMAIVIEFYVPEKFRKQSGKWISPEQRGKVIPFPAPQSKSA |
Ga0210401_100219885 | 3300020583 | Soil | MAMAKMIEFYIPDKFRKQTGKWIPPEQRGKIIPFPVP |
Ga0210401_100930234 | 3300020583 | Soil | MRSHLLRMRLEMVTPMAIVIEFYVPEKFRKQSGKWISPEQRGKVIPFPAQQKKSA |
Ga0210401_103410052 | 3300020583 | Soil | MAKVIEYDVPKKFRKQSGKWIPPEQRGKVILFPAPEKKSA |
Ga0210401_112992461 | 3300020583 | Soil | MRSHLLRMRLGMVTPMAIVIGFYVPEKFRKQSGKWISPEQRGKVIPFPAKQKKSA |
Ga0210405_100397583 | 3300021171 | Soil | MRSHLLRMRLGMVTPMAIVIKFYVPEKFRKQSGRWISPEQRGKVIPFPAPQKKSA |
Ga0210396_100251371 | 3300021180 | Soil | AMAKVIEYYVPEKFLKQSRKWIPPEQRGKVILFPALEKKSA |
Ga0210396_100314745 | 3300021180 | Soil | MRLGMVTPMAIVIEFYLPEKFRKQGGKWISPGQRGTVIPFPAQQKKSA |
Ga0210388_100090162 | 3300021181 | Soil | MVAAMAIVIEFYVPEKFRKNKAEKWIPRRQHGMIIRFPAPEEKSA |
Ga0210393_116400562 | 3300021401 | Soil | AMVIVIEFYVPEKFCKQCGKWIPPEQRGKIIPFPAPEKKSA |
Ga0210397_101252423 | 3300021403 | Soil | MRSHLLRVRLGVVTAMAKVIEYYVPEKFLKQSRKWILPEQRGKVILFPALEKKSA |
Ga0210389_106993473 | 3300021404 | Soil | VRLGKVVAMAIVIEFYVPQKFRKLGGKWIPPEQRGTIIRFPAPEKKSA |
Ga0210389_110541182 | 3300021404 | Soil | MVTAMAKVIEFYVPDKFRKQRGKRIPSEQRGRIIPFPAPEKKSA |
Ga0210387_101678553 | 3300021405 | Soil | MVIVIEFYVPEKFCKQCGKWIPPEQRGKIIPFPAPEKKSA |
Ga0210384_100683582 | 3300021432 | Soil | MRSHLLRMRLGMVTPMAIVIKFYVPEKFRKQSGRWISPEQRGKVIPFPTPQKKSA |
Ga0210384_112742982 | 3300021432 | Soil | VQLEMVTAMATVIEFYVPEKFRKQSEKWTPLDYRGKIIPFPAPEKKSA |
Ga0210398_102408792 | 3300021477 | Soil | MVIVIEFYVPEKFCKQCGKWIPPEQRGKIIPFPAPEK |
Ga0210409_102283292 | 3300021559 | Soil | MVKAMAKLIEFYVPEKFRKPIGKWSPPEQCGKIIPFPKPEKKSA |
Ga0126371_107516811 | 3300021560 | Tropical Forest Soil | MGSHSLPVRLGMVTAMAIVIEYYLPEKFRKQSGKWIPPEQRGKIILFPAPEKKSA |
Ga0207692_100610762 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIMIEYYVPEKFRKQSGKWIPLEQRGKIIPFPAPERKSA |
Ga0207700_101965761 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TRERKRIVRSVVTAMAIVIDYYVPEKFRKQSGKWIPPEQRGKIIPFPTPERKSA |
Ga0207700_104871231 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVIEYYLPEKFQKQRGRWIPPEQRGKVIPFPIPEKKSA |
Ga0207664_108498923 | 3300025929 | Agricultural Soil | SVVTAMAIVIDYYVPEKFRKQSEKWIPLEQRGKIIPFPAPERKSA |
Ga0207664_116017343 | 3300025929 | Agricultural Soil | MAIVIDYYVPEKFRKQSEKWIPLEQRGKIIPFPAP |
Ga0207665_104657943 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVIDYYVPEKFRKQSGKWIPLEQRGKIIPFPAPERKSA |
Ga0209055_100008462 | 3300026309 | Soil | LGVVMAKVIEFYVPDGFQKIAKWIPPEQRGKIIPFPAPEKKSA |
Ga0209802_11995822 | 3300026328 | Soil | MAKLIEFYVPDGFQKIAKWIPPEQRGKVIPFRAPEKKSA |
Ga0209377_10571071 | 3300026334 | Soil | MVVAMAVVIEFYVPQKFRKLSGKWIPPEQRGTIIRFPAPEKKSA |
Ga0257169_10776721 | 3300026469 | Soil | MEIVIEYYVPEKFRKRSGKWIPPEQRGKIIPFPAPEKKSA |
Ga0257153_10388912 | 3300026490 | Soil | MAKVIEYYVPEKFRKQSGKWIPPEQRGKIISFPLLEKKSA |
Ga0209648_100995292 | 3300026551 | Grasslands Soil | MVTAMAKVIEFYVPKKFRKPSGKWSPPEECGKIIPFPTPEKKSA |
Ga0208365_10351893 | 3300027070 | Forest Soil | MRSHLLRVRLGVVATMAIVIEYYVPEEFGKRNGKWIPSEQRGKIIPFPA |
Ga0209214_10451711 | 3300027071 | Forest Soil | MVTAMAKAIEFYVPEKFRKPSGKRIPPEQWGKIILFTAPKKKSA |
Ga0208366_10188312 | 3300027073 | Forest Soil | MRSNLLRVRLGVVAAMAKVIEYHVPEKFRKQSGKWISPEQRGKVIPFPAKQKKSA |
Ga0209525_10839682 | 3300027575 | Forest Soil | MAIVIEFYVPDRFRKQSGKWIPPERRAKIIPFPAPEKESA |
Ga0209009_11528491 | 3300027667 | Forest Soil | LGMVTAMAIVIEFYVPDRFRKQSGKWILPERRARIIPFPA |
Ga0209328_101393592 | 3300027727 | Forest Soil | MRSHLLRMRLGMVTPMAIVIGFYVPEKFRKQSGKWISPEQRGKVIPFPA |
Ga0209580_103921563 | 3300027842 | Surface Soil | QAMRSHPLRVRLGMVTAMAIVIELYVPEKFRKQSEKWIPPQQRGSIIRFPAPEEKSA |
Ga0209180_105012401 | 3300027846 | Vadose Zone Soil | MLVGGYSEKTGYAHSLRVWLGMVTTMAIVIEYYLPEKFRKQSGKWIPPEQRGTIIRFPAPEKKSA |
Ga0209693_100367971 | 3300027855 | Soil | MVAAMAIVIEFYVPEKFRKNKAEKWIPRRQHGMIIRF |
Ga0209488_1000223912 | 3300027903 | Vadose Zone Soil | MAIVIDYYVPEKFRKQSGKWIPSEQRGKIILFPASEKKSA |
Ga0265338_109579141 | 3300028800 | Rhizosphere | RRRDRAQRVARRVVTAMAIVIEYYLPEKFQKKRGRWIPPEQRGKVIPFPIAEKKSA |
Ga0308309_101020083 | 3300028906 | Soil | MVTAMAKVIEYYVPEKFRKQSGKWISPEQRGKVILFPAPEKKSA |
Ga0307482_10663953 | 3300030730 | Hardwood Forest Soil | MVMAMAIVIEFYVPEKFRKQSEKWIPPQQRGSIIRFPAPEEESA |
Ga0073994_120090372 | 3300030991 | Soil | MAIVIEYYVPEKFQKQSGKWIPPEQRGKIIPFSTTERKSA |
Ga0170824_1236113482 | 3300031231 | Forest Soil | MRSHLLRVRLGMVTVMAKVIEYYVPEKFRKQSGKWIPLEQRGKIILFPAPEKKSA |
Ga0310686_1055713563 | 3300031708 | Soil | MVTAMTKVIEFYLPEKFRKQSGKWISPEQRGKVILFPAPEKKSA |
Ga0310686_1163377871 | 3300031708 | Soil | LVTTMVIVIEFYVPEKFREQCGKWIPPEQRGKIIPFPAPEKKSA |
Ga0307476_110713402 | 3300031715 | Hardwood Forest Soil | VWLGMVKAMAKVIKFYVPEKFRKQSGKWVSPGRHGKLILFPAPEKKSA |
Ga0307476_112763011 | 3300031715 | Hardwood Forest Soil | AMRSRPLRVRLGMAVAMAIVIEFYVPQKFRKLGGKWIPPEQRRTIIRFPAPEKKSA |
Ga0307474_100011097 | 3300031718 | Hardwood Forest Soil | MTIVIEFYVPEKFRKQSGELIPPEQREKIIPFPAPEKKSA |
Ga0307474_101389512 | 3300031718 | Hardwood Forest Soil | MRSHLLRVRLGMVMAMAKVIEFYVPEKFRKPNGKWNPPEQRGKIIPFTAPEKKSA |
Ga0307475_100001992 | 3300031754 | Hardwood Forest Soil | MAMAIVIEFYVPEKFRKQSEKWIPPQQRGSIIRFPAPEEESA |
Ga0307475_102247173 | 3300031754 | Hardwood Forest Soil | MRSHLLRMRLGMVTPMAIVIEFYVPEKFRKQSGKWISPEQRGKVIPFPARQKKSA |
Ga0307479_1000084933 | 3300031962 | Hardwood Forest Soil | MRSHLLRMRLGMVTPMAIVIEFYVPEKFRKQSGKWISPEQRGKVIPFPARQKEVSMT |
Ga0307471_1007119523 | 3300032180 | Hardwood Forest Soil | HLLRVRLGMVTAMAKVIEFYVPEKFRKPSGKRIPPEQSGKIIPFTAPEKKSA |
Ga0307471_1020759182 | 3300032180 | Hardwood Forest Soil | MRSHLLRMRLGMVTPMAIVIEFYVPEKFRKQSGKWISPEQRGKVIPFPAPQKKSA |
Ga0307472_1003586852 | 3300032205 | Hardwood Forest Soil | MVTAMAKVIEFYVPEKFRKPSGKRIPPEQSGKIIPFTAPEKKSA |
Ga0335070_116537451 | 3300032829 | Soil | MAKVIEFYVPGRFKKSGKWVAPEQRGKIIPFPVPQKESA |
⦗Top⦘ |