NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F060677

Metagenome Family F060677

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060677
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 43 residues
Representative Sequence MRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQM
Number of Associated Samples 91
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.45 %
% of genes near scaffold ends (potentially truncated) 96.21 %
% of genes from short scaffolds (< 2000 bps) 92.42 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.242 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(43.939 % of family members)
Environment Ontology (ENVO) Unclassified
(62.121 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(44.697 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.39%    β-sheet: 0.00%    Coil/Unstructured: 73.61%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF06147DUF968 10.61
PF09588YqaJ 2.27
PF04404ERF 0.76



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.24 %
UnclassifiedrootN/A0.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320005|FACEOR_FY84VJD01BSOY1All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig189568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10030306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1462Open in IMG/M
3300000955|JGI1027J12803_104761217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300000955|JGI1027J12803_109256898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1350Open in IMG/M
3300004633|Ga0066395_10168521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1124Open in IMG/M
3300005332|Ga0066388_102113499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1013Open in IMG/M
3300005332|Ga0066388_106262725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300005436|Ga0070713_100335351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.31400Open in IMG/M
3300005568|Ga0066703_10335843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium910Open in IMG/M
3300005713|Ga0066905_100896675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300005713|Ga0066905_101308332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium652Open in IMG/M
3300005764|Ga0066903_101690748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1204Open in IMG/M
3300005764|Ga0066903_104656400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium730Open in IMG/M
3300005764|Ga0066903_105216776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae687Open in IMG/M
3300005764|Ga0066903_107052724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300005764|Ga0066903_107313316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales571Open in IMG/M
3300006844|Ga0075428_102130298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300009792|Ga0126374_11501861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300010043|Ga0126380_10608134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium862Open in IMG/M
3300010043|Ga0126380_11549796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300010046|Ga0126384_10013144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5208Open in IMG/M
3300010046|Ga0126384_10301927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1317Open in IMG/M
3300010046|Ga0126384_11608717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300010046|Ga0126384_12289039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300010048|Ga0126373_11339767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium782Open in IMG/M
3300010359|Ga0126376_11640063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300010376|Ga0126381_104017210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300010398|Ga0126383_10773473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1042Open in IMG/M
3300010398|Ga0126383_12450772Not Available606Open in IMG/M
3300010398|Ga0126383_13341444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300011000|Ga0138513_100056690All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300011270|Ga0137391_10581327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium941Open in IMG/M
3300012205|Ga0137362_10161164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1922Open in IMG/M
3300012209|Ga0137379_10310428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1488Open in IMG/M
3300012210|Ga0137378_11651081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300012285|Ga0137370_10916577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300012354|Ga0137366_11086898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300012360|Ga0137375_11097876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300012917|Ga0137395_10918999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300012923|Ga0137359_10540759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1025Open in IMG/M
3300012930|Ga0137407_12163499All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300012948|Ga0126375_11748067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300012971|Ga0126369_13057463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium548Open in IMG/M
3300015371|Ga0132258_12281967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1358Open in IMG/M
3300016270|Ga0182036_11090868All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300016270|Ga0182036_11186194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300016270|Ga0182036_11730518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300016294|Ga0182041_11222674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300016319|Ga0182033_12031690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300016357|Ga0182032_10988033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium718Open in IMG/M
3300016404|Ga0182037_10171524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1656Open in IMG/M
3300016404|Ga0182037_10821835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium802Open in IMG/M
3300016445|Ga0182038_10282672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1349Open in IMG/M
3300018072|Ga0184635_10296854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300021560|Ga0126371_10941034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1007Open in IMG/M
3300025885|Ga0207653_10051810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1367Open in IMG/M
3300026557|Ga0179587_11103285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300031544|Ga0318534_10288331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium946Open in IMG/M
3300031544|Ga0318534_10768948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031545|Ga0318541_10236714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1014Open in IMG/M
3300031545|Ga0318541_10279703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium929Open in IMG/M
3300031546|Ga0318538_10293387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300031546|Ga0318538_10508210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300031546|Ga0318538_10648770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300031546|Ga0318538_10700819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300031549|Ga0318571_10032914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1454Open in IMG/M
3300031561|Ga0318528_10580238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300031564|Ga0318573_10463994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300031564|Ga0318573_10559704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300031640|Ga0318555_10629600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300031679|Ga0318561_10686481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300031679|Ga0318561_10736675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031680|Ga0318574_10043405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2336Open in IMG/M
3300031713|Ga0318496_10437363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300031724|Ga0318500_10492607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300031744|Ga0306918_10021331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3931Open in IMG/M
3300031747|Ga0318502_10393669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium824Open in IMG/M
3300031747|Ga0318502_10828501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300031763|Ga0318537_10032545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1860Open in IMG/M
3300031777|Ga0318543_10101513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1236Open in IMG/M
3300031779|Ga0318566_10641101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300031794|Ga0318503_10238994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300031805|Ga0318497_10419636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300031819|Ga0318568_10518477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium743Open in IMG/M
3300031819|Ga0318568_10881449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031833|Ga0310917_10646309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium717Open in IMG/M
3300031845|Ga0318511_10202231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium883Open in IMG/M
3300031845|Ga0318511_10452805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031846|Ga0318512_10143922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1147Open in IMG/M
3300031846|Ga0318512_10733352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300031879|Ga0306919_10176428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1575Open in IMG/M
3300031890|Ga0306925_12151704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300031894|Ga0318522_10209207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium739Open in IMG/M
3300031897|Ga0318520_10006402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei4812Open in IMG/M
3300031910|Ga0306923_10095656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3347Open in IMG/M
3300031910|Ga0306923_11901913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300031912|Ga0306921_10023704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium6770Open in IMG/M
3300031912|Ga0306921_10143968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2786Open in IMG/M
3300031912|Ga0306921_11319058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium797Open in IMG/M
3300031912|Ga0306921_12619001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300031941|Ga0310912_10594435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium861Open in IMG/M
3300031941|Ga0310912_10607022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium851Open in IMG/M
3300031942|Ga0310916_10181062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1756Open in IMG/M
3300031942|Ga0310916_10418670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1140Open in IMG/M
3300031942|Ga0310916_11513379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300031945|Ga0310913_10052499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2665Open in IMG/M
3300031945|Ga0310913_11121558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300031945|Ga0310913_11226567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300031946|Ga0310910_11168096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300031947|Ga0310909_11337153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300031954|Ga0306926_10654321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1278Open in IMG/M
3300031954|Ga0306926_11768706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300031959|Ga0318530_10041286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1703Open in IMG/M
3300031981|Ga0318531_10423914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300032010|Ga0318569_10102723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1293Open in IMG/M
3300032035|Ga0310911_10757752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300032035|Ga0310911_10799023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300032039|Ga0318559_10463900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300032042|Ga0318545_10147214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium836Open in IMG/M
3300032055|Ga0318575_10354262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium744Open in IMG/M
3300032063|Ga0318504_10174145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium998Open in IMG/M
3300032065|Ga0318513_10354238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium715Open in IMG/M
3300032076|Ga0306924_10302594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1835Open in IMG/M
3300032090|Ga0318518_10047546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2030Open in IMG/M
3300032091|Ga0318577_10271939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium811Open in IMG/M
3300032180|Ga0307471_100816592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1100Open in IMG/M
3300032261|Ga0306920_100108559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae4112Open in IMG/M
3300032261|Ga0306920_101630684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium916Open in IMG/M
3300032261|Ga0306920_101765300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300033289|Ga0310914_10252231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1585Open in IMG/M
3300033289|Ga0310914_10485838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1117Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil43.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.18%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.12%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320005Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2-EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORA_15717302032320005SoilMRRRNELALLPKSPLLITESADEFDALRDAFEQEIKPRG
KansclcFeb2_088286802124908045SoilMRRNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIE
AF_2010_repII_A1DRAFT_1003030633300000597Forest SoilMPRTNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIER
JGI1027J12803_10476121723300000955SoilLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQM
JGI1027J12803_10925689833300000955SoilMPRTNELTLLPKLPLLITESADEFDALRDAFEQEINPXXXXGDVP*
Ga0066395_1016852123300004633Tropical Forest SoilLLPKLPLLITESADEFDDLRDAFVREIKPQGIIERMYVDDFS*
Ga0066388_10211349923300005332Tropical Forest SoilMPRINELTLLPKLPLLITESADEFDALRDAFEREIKPRGIIE*
Ga0066388_10626272513300005332Tropical Forest SoilMPRTNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIE
Ga0070713_10033535123300005436Corn, Switchgrass And Miscanthus RhizosphereMRRNELTLLPKLPLLITEAADEFDALRDAFEQEIKPRGIIEHMYVHDISSIVWEI
Ga0066703_1033584323300005568SoilMRRNELTLLPKLPLLITEAADEFDALRDAFEQEIKPRGIIEHMY
Ga0066905_10089667523300005713Tropical Forest SoilMPRTNELTLLPKLPLLITESADEFDALRDAFEREIKPRGII
Ga0066905_10130833213300005713Tropical Forest SoilMPRTNELTLLPKLPLLITESADEFDALRDAFEQEIKPR
Ga0066903_10169074813300005764Tropical Forest SoilMRRRNELTHLPKLPLLITESADEFDALRDAFEREIKPRGIIEQ
Ga0066903_10465640013300005764Tropical Forest SoilMRRRSELTLLPKLPLLTTESADEFDALRDAFEQEIKPRGI
Ga0066903_10521677633300005764Tropical Forest SoilMRPRNELALLPKSPLLITESADEFDALRDAFEREIKP
Ga0066903_10705272413300005764Tropical Forest SoilMRRRNELALLPKLPLLITESADEFDALRDAFEREIKPRGIIEQMYVHD
Ga0066903_10731331613300005764Tropical Forest SoilMPRIKELALLPKLPLLISESADEFDALRNAFEREIKPRGIIEQMYVHDI
Ga0075428_10213029823300006844Populus RhizosphereMRRRNELALLPKLPLLITESADEFDALREAFEQEIKPRGI
Ga0126374_1150186113300009792Tropical Forest SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDIC
Ga0126380_1060813433300010043Tropical Forest SoilMRRRNELALLPKSPLVITESADEFDALRDAFEQEI
Ga0126380_1154979623300010043Tropical Forest SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIKPRGIIEQMYV
Ga0126384_1001314473300010046Tropical Forest SoilMRQKPLLLATLLPKLPLLITESADEFDDLRDAFVREIKPQGIIERMYVDDFS*
Ga0126384_1030192713300010046Tropical Forest SoilMRRRNELTLLAKLPLLTESAEEFEALRDAFEQEIKPRGIIEQMYVH
Ga0126384_1160871713300010046Tropical Forest SoilMRRTNKLTLLPKSPLLITETADEFDALRDAFEREIKPRGIIEQMYVHDIS
Ga0126384_1228903913300010046Tropical Forest SoilMRRNELALLPKLPLLITESADEFDALRDAFEREIKP
Ga0126373_1133976713300010048Tropical Forest SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGII
Ga0126376_1164006313300010359Tropical Forest SoilMRRNELALLPKLPLLITESAEEFDALRDAFERKIKPRDIIEQMY
Ga0126381_10401721013300010376Tropical Forest SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPR
Ga0126383_1077347313300010398Tropical Forest SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREMKPRGI
Ga0126383_1245077213300010398Tropical Forest SoilMEQENMRGTNELTLLPTLPLLITESADEFSALRDAFE
Ga0126383_1334144413300010398Tropical Forest SoilMRRRNELAVLPKLPLLITESAEEFDALRDAFEREIKPRG
Ga0138513_10005669023300011000SoilMRRRDKLTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMY
Ga0137391_1058132723300011270Vadose Zone SoilMGRRNELALLPKLPLLITESVDEFDAIRDAFEREIKPHGIIEQMYVHDV
Ga0137362_1016116433300012205Vadose Zone SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRG
Ga0137379_1031042823300012209Vadose Zone SoilMRPRNELALLPKVPVLITESADEFDALRDAFEREIKPRGIIDHMYVDEAAGQGCLD*
Ga0137378_1165108113300012210Vadose Zone SoilLLPKVPVLITESADEFDALRDAFEREIKPRGIIDHMYVDEAAGQGCLD*
Ga0137370_1091657713300012285Vadose Zone SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEQEIRPRGIIEQMYVQ
Ga0137366_1108689823300012354Vadose Zone SoilMRPRNELALLPKVPVLITESADEFDALRDAFEREIKPRGI
Ga0137375_1109787623300012360Vadose Zone SoilMRRRNELTLLPKLPLLITESADEFDALRDAFKQEIKPRGIIEQMYVHDISS
Ga0137395_1091899923300012917Vadose Zone SoilMRRNELTLLPKLPLLITEAADEFDALRDAFEQEIKPRGIIEHMYVHDISSIV
Ga0137359_1054075923300012923Vadose Zone SoilMGRRNELALLPKLPLLITESVDEFDAIRDAFEREIKPHGIIEQMYVHD
Ga0137407_1216349913300012930Vadose Zone SoilMARRNSDERMLLPKPPLLITESASEFEALREALEREIKPRGIIEQT
Ga0126375_1174806713300012948Tropical Forest SoilMRRRNELAVLPKLPLLITESADEFDALRDAFEQEIKP
Ga0126369_1305746323300012971Tropical Forest SoilMRRRNELALLPKSPLLITESADEFDALRDAFEQEIKPRGIIEHM
Ga0132258_1228196713300015371Arabidopsis RhizosphereMRRRNELALLPKLPLLITESADEFGALRDAFEREIKPRGIIEQMYVHDICSIV
Ga0182036_1109086813300016270SoilMRRTNKLTLLPKSPLLITETADEFEALRDAFEREIKPRGIIEQMYVH
Ga0182036_1118619413300016270SoilMGRRNELALLPKLPLLITESAEEFDALRDAFEQEIKPRGII
Ga0182036_1173051813300016270SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREIKP
Ga0182041_1122267413300016294SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEREIKPRGIIEQ
Ga0182033_1203169013300016319SoilMRRRNELALLPKLPLLITESAGEFDALRDAFEQEIKPRGIIEQMYV
Ga0182032_1098803313300016357SoilMGRTNELTLLPKSPLLITESAEEFDALRDAFEREIKPQGIIEQMYVH
Ga0182037_1017152413300016404SoilLTLLPKLPLLITESADEFDALRDAFEREIKPRGIIEQ
Ga0182037_1082183523300016404SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIKP
Ga0182038_1028267233300016445SoilMGRTNELTLLPKSPLLITESAEEFDALRDAFEREIKPQGIIE
Ga0184635_1029685413300018072Groundwater SedimentMRPKNELALLPKLPLLITESADEFGALCDAFEREIKPRGI
Ga0126371_1094103413300021560Tropical Forest SoilMPRTNELTLLPKLPLLITESANEFDALRDAFEQEIKPRGIIE
Ga0207653_1005181013300025885Corn, Switchgrass And Miscanthus RhizosphereMRRNELALLPKLPLLITESADEFDALRDAFKQEIKQRGIIE
Ga0179587_1110328523300026557Vadose Zone SoilMGRRNELALLPKLPLLITESVDEFDAIRDAFEREIKPHGIIEQMYVHDLS
Ga0318534_1028833123300031544SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIE
Ga0318534_1076894813300031544SoilMRRRNELALLPKSPLLITESAHEFDALRDAFEQEIKPRGIIEQ
Ga0318541_1023671413300031545SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIK
Ga0318541_1027970323300031545SoilMRRNELTLLPKLPLLITEAADEFDVLKQVLRQPGQ
Ga0318538_1029338713300031546SoilMTRINELTLLPKLPLLITESADEFDALRDAFEEEIKPRGIIEQ
Ga0318538_1050821023300031546SoilMRRNELALLPKLPLLITESAEEFDALRDAFEQEIKPRGIIEQM
Ga0318538_1064877023300031546SoilMRRTNKLTLLPKSPLLITETADEFEALRDAFEREIKPRGIIEQMYVHDISSVVWE
Ga0318538_1070081923300031546SoilMRLRNELALLPKSPLLITETADEFDALRDAFEGEIKPQGIIEQMYVHD
Ga0318571_1003291413300031549SoilMRRNELTLLPKLPLLITEAADEFDALRDAFEQEIKPRGIIEHMYVHDI
Ga0318528_1058023823300031561SoilMNRTNELTLLPKLPLLITESPDEFDAVWDAFEREIKPRGI
Ga0318573_1046399413300031564SoilMRRNELAVLPKLPLLITESPDEFDALRDAFEREIKPRGIIEQMYVHDIC
Ga0318573_1055970413300031564SoilMGRTNELTLLPKSPLLITESAEEFDALRDAFEREIKPQGIIEQM
Ga0318555_1062960013300031640SoilMHRLLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDFC
Ga0318561_1068648133300031679SoilMRRTNKLTLLPKSPLLITETADEFEALRDAFEREIKPRGIIEQMY
Ga0318561_1073667513300031679SoilMRRRNELALLPKLPLLITESADEFDALRDAFEREIKPRGI
Ga0318574_1004340513300031680SoilMPRTNELTLLPKLPLLTTESADEFDALCDAFEQEIK
Ga0318496_1043736323300031713SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIKPRGIIEQMYLHDICS
Ga0318500_1049260723300031724SoilMRRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGIIE
Ga0306918_1002133153300031744SoilMRRRNELAVLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDFCS
Ga0318502_1039366913300031747SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGI
Ga0318502_1082850123300031747SoilMNRTNELTLLPKLPLLITESPDEFDAVWDAFEREIKPRGIIE
Ga0318537_1003254513300031763SoilMNRTNELTLLPKLPLLITESPDEFDAVWDAFEREIKPRGIIEQMYVHDI
Ga0318543_1010151313300031777SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEREIKPRGIIEQM
Ga0318566_1064110123300031779SoilMGRRNELALLPKLPLLITESAEEFDALRDAFEQEIKPRGIIEQMYVHD
Ga0318503_1023899423300031794SoilMRRNELAVLPKLPLLITESPDEFDALRDAFEREIKPRGII
Ga0318497_1041963613300031805SoilMRRRNELAVLLKLPLLTSESADEFDALRDAFEREIKPRGIIE
Ga0318568_1051847713300031819SoilMRRRNELALLPKLPLLITESAGEFDALRDAFEQEIKPRGIIEQM
Ga0318568_1088144913300031819SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYV
Ga0310917_1064630913300031833SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREIKPR
Ga0318511_1020223123300031845SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIKPRGIIEQMYVHDI
Ga0318511_1045280523300031845SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGIIEQMYVHDI
Ga0318512_1014392223300031846SoilMGRTNELTLLPKSPLLITESAEEFDALRDAFEREIKPQGIIEQMYVHDICSI
Ga0318512_1073335213300031846SoilMRRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGIIEQM
Ga0306919_1017642813300031879SoilMPRINELTLLPKLPLLITESADEFDALRDAFEEEIKPRGIIEQ
Ga0306925_1215170413300031890SoilMRRRNELALLPKSPLLITESADEFDALRDAFEQEIEPRGIIEQMY
Ga0318522_1020920713300031894SoilMRRNELALLPKLPLLITESAEEFAALRDAFEREIKP
Ga0318520_1000640213300031897SoilMRRRNELAVLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDFCSIV
Ga0306923_1009565613300031910SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDF
Ga0306923_1190191323300031910SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHEICCIV
Ga0306921_1002370483300031912SoilLTLLPKLPLLITESADEFDALRDAFEREIKPRGIIEQM
Ga0306921_1014396843300031912SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDFCSIV
Ga0306921_1131905823300031912SoilMRRNESALLPKLPLLITESAEEFDALRDAFEREIKP
Ga0306921_1261900113300031912SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGIIEQ
Ga0310912_1059443513300031941SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKP
Ga0310912_1060702213300031941SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEQEIKPRVIIEQ
Ga0310916_1018106213300031942SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDMSAI
Ga0310916_1041867013300031942SoilMRRNELALLPKLPLLITESAEEFDALRDAFEQEIKPRGIIEQMYVH
Ga0310916_1151337913300031942SoilMPQTNELTLLPKLPLLITESPDEFDALRDAFEQEIKPRGIIEQMYVH
Ga0310913_1005249943300031945SoilMNRTNELTLLPKLPLLITESPDEFDAVWDAFEREIKPRGIIEQMYVH
Ga0310913_1112155813300031945SoilMGRRNELALLPKLPLLITESAEEFDALRDAFEQEIKPRGIIE
Ga0310913_1122656713300031945SoilMRKNELALLPKLPLLITESADEFEALRDAFEREIKPQGIIEQMY
Ga0310910_1116809613300031946SoilMPRKNELTVLPKLPLLITESAEEFDALRDAFEREIKPRGVIEQ
Ga0310909_1133715313300031947SoilMRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMY
Ga0306926_1065432123300031954SoilMRRRNELGVLPKLPLLITESAEEFDALREAFEREIKPRGIIEQMYVH
Ga0306926_1176870623300031954SoilMRRRNELATLPKLPLLITESAEEFDALRDAFEREIKPRG
Ga0318530_1004128633300031959SoilLTLLPKLPLLITESADEFDALRDAFEREIKPRGIIE
Ga0318531_1042391423300031981SoilMRRRNELAVLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMYVHDFC
Ga0318569_1010272313300032010SoilMRRRNELTLLPKLPLLITESADEFDALRDAFEREIKPRGIIEQMY
Ga0310911_1075775213300032035SoilMRRTNKLTLLPKSPLLITETADEFEALRDAFEREIKPRGIIEQMYVHDICSIVWEIL
Ga0310911_1079902313300032035SoilMRRRNELTLLPKLPLLITESADEFDALRDAFKQEIK
Ga0318559_1046390023300032039SoilMRRRNELAVLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQMY
Ga0318545_1014721423300032042SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIKPRGIIEQMYLHDI
Ga0318575_1035426223300032055SoilMRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGII
Ga0318504_1017414523300032063SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIKPRGIIEQMY
Ga0318513_1035423813300032065SoilMRRRNELALLPKLPLLITESAEEFDALRDAFEREIKPR
Ga0306924_1030259413300032076SoilMSRRNELTLLPKLPLLITESADEFDALRAAFQQEIKPRGIIEQMYV
Ga0318518_1004754633300032090SoilMRRRNELAVLPKLPLLITESADEFDALRDAFEQEIKPR
Ga0318577_1027193913300032091SoilMRRNELAVLPKLPLLITESPDEFDALRDAFEREIKPRGIIEQMYVH
Ga0307471_10081659213300032180Hardwood Forest SoilMPRINELTLLPKVPLLITESADEFDALRDAFEQEIKPRGIIEQMYVH
Ga0306920_10010855913300032261SoilMRRRNELALLPKLPLLITESAEEFDALRDAFEREIKPRGIIEQMYVHDI
Ga0306920_10163068423300032261SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEIKPRGIIEQM
Ga0306920_10176530013300032261SoilMRKNELALLPKLPLLITESADEFEALRDAFEREIK
Ga0310914_1025223133300033289SoilMRRRNELAVLPKLPLLITESAEEFDALREAFEREIK
Ga0310914_1048583833300033289SoilMRRRNELALLPKLPLLITESADEFDALRDAFEQEI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.