NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060736

Metagenome / Metatranscriptome Family F060736

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060736
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 41 residues
Representative Sequence MRSPLAESQRAALIEAMLPDVPFDGWSRAALRAAARRIGIP
Number of Associated Samples 116
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.76 %
% of genes near scaffold ends (potentially truncated) 98.48 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.121 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.788 % of family members)
Environment Ontology (ENVO) Unclassified
(30.303 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.970 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 36.23%    β-sheet: 0.00%    Coil/Unstructured: 63.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF01327Pep_deformylase 83.33
PF01165Ribosomal_S21 6.82
PF02233PNTB 5.30
PF12769PNTB_4TM 1.52
PF02803Thiolase_C 0.76
PF04389Peptidase_M28 0.76
PF00005ABC_tran 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0242Peptide deformylaseTranslation, ribosomal structure and biogenesis [J] 83.33
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 6.82
COG1282NAD/NADP transhydrogenase beta subunitEnergy production and conversion [C] 5.30
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.48 %
UnclassifiedrootN/A26.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101470711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300003505|JGIcombinedJ51221_10104737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1127Open in IMG/M
3300004152|Ga0062386_101288771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales608Open in IMG/M
3300005176|Ga0066679_10815450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales594Open in IMG/M
3300005458|Ga0070681_10175949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2062Open in IMG/M
3300005526|Ga0073909_10117212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1074Open in IMG/M
3300005542|Ga0070732_10728909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300005556|Ga0066707_10815752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300005575|Ga0066702_10555058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales694Open in IMG/M
3300005575|Ga0066702_10875181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300005587|Ga0066654_10909255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300006797|Ga0066659_11353402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300006854|Ga0075425_101592932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300006876|Ga0079217_11051339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales602Open in IMG/M
3300009012|Ga0066710_104178290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens540Open in IMG/M
3300009088|Ga0099830_10847295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300009088|Ga0099830_11093738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium661Open in IMG/M
3300009137|Ga0066709_102054711Not Available791Open in IMG/M
3300009137|Ga0066709_103038934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens615Open in IMG/M
3300009553|Ga0105249_11899071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria668Open in IMG/M
3300010046|Ga0126384_11039747Not Available748Open in IMG/M
3300010046|Ga0126384_11712464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens595Open in IMG/M
3300010048|Ga0126373_12255212Not Available605Open in IMG/M
3300010303|Ga0134082_10141415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales969Open in IMG/M
3300010341|Ga0074045_10748409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens619Open in IMG/M
3300010360|Ga0126372_10417633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1231Open in IMG/M
3300010361|Ga0126378_10324367Not Available1647Open in IMG/M
3300010361|Ga0126378_12185802Not Available631Open in IMG/M
3300010371|Ga0134125_12905294Not Available520Open in IMG/M
3300010396|Ga0134126_12961073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300011120|Ga0150983_12951765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens544Open in IMG/M
3300012212|Ga0150985_103614255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria674Open in IMG/M
3300012212|Ga0150985_107831721Not Available656Open in IMG/M
3300012212|Ga0150985_108861336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria670Open in IMG/M
3300012212|Ga0150985_121842758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300012285|Ga0137370_10825577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens575Open in IMG/M
3300012357|Ga0137384_11323122Not Available568Open in IMG/M
3300012361|Ga0137360_10847364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300012361|Ga0137360_11095356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300012469|Ga0150984_103457837Not Available641Open in IMG/M
3300012469|Ga0150984_105162441Not Available573Open in IMG/M
3300012917|Ga0137395_11254423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300012971|Ga0126369_10305131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1595Open in IMG/M
3300012977|Ga0134087_10480015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens621Open in IMG/M
3300014501|Ga0182024_11344513Not Available826Open in IMG/M
3300015051|Ga0137414_1197172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2094Open in IMG/M
3300015080|Ga0167639_1044074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300015241|Ga0137418_10721592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria760Open in IMG/M
3300016319|Ga0182033_10066422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2520Open in IMG/M
3300016357|Ga0182032_10052682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2649Open in IMG/M
3300016404|Ga0182037_10713536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria859Open in IMG/M
3300016404|Ga0182037_11727798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300016422|Ga0182039_10120310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1979Open in IMG/M
3300016445|Ga0182038_11752499Not Available560Open in IMG/M
3300017970|Ga0187783_11051845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens586Open in IMG/M
3300017973|Ga0187780_11431887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens510Open in IMG/M
3300018007|Ga0187805_10157548Not Available1033Open in IMG/M
3300018007|Ga0187805_10548884Not Available544Open in IMG/M
3300018090|Ga0187770_11522168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria545Open in IMG/M
3300020580|Ga0210403_10279809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1368Open in IMG/M
3300020582|Ga0210395_11221123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens552Open in IMG/M
3300021170|Ga0210400_10460662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1049Open in IMG/M
3300021178|Ga0210408_10064454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2863Open in IMG/M
3300021358|Ga0213873_10319570All Organisms → cellular organisms → Bacteria → Proteobacteria504Open in IMG/M
3300021372|Ga0213877_10252813Not Available586Open in IMG/M
3300021384|Ga0213876_10461143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300021403|Ga0210397_10506163All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300021441|Ga0213871_10129039Not Available758Open in IMG/M
3300021560|Ga0126371_10836883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1066Open in IMG/M
3300022528|Ga0242669_1065818Not Available648Open in IMG/M
3300022532|Ga0242655_10127894Not Available725Open in IMG/M
3300022533|Ga0242662_10265212Not Available562Open in IMG/M
3300022557|Ga0212123_10346752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1017Open in IMG/M
3300025916|Ga0207663_10642916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria837Open in IMG/M
3300025918|Ga0207662_10004492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7344Open in IMG/M
3300025944|Ga0207661_11847685Not Available550Open in IMG/M
3300025961|Ga0207712_11463898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens611Open in IMG/M
3300026319|Ga0209647_1214370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens656Open in IMG/M
3300026333|Ga0209158_1341493Not Available519Open in IMG/M
3300026548|Ga0209161_10574137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales504Open in IMG/M
3300027643|Ga0209076_1128376Not Available714Open in IMG/M
3300027706|Ga0209581_1204835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300027775|Ga0209177_10057576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1122Open in IMG/M
3300027812|Ga0209656_10300501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria742Open in IMG/M
3300027826|Ga0209060_10297862Not Available737Open in IMG/M
3300027835|Ga0209515_10351939All Organisms → cellular organisms → Bacteria → Proteobacteria805Open in IMG/M
3300027869|Ga0209579_10383176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales761Open in IMG/M
3300027884|Ga0209275_10927173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300030988|Ga0308183_1100296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300031023|Ga0073998_11584312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300031057|Ga0170834_107087857Not Available546Open in IMG/M
3300031128|Ga0170823_11845156Not Available653Open in IMG/M
3300031469|Ga0170819_11653727Not Available510Open in IMG/M
3300031543|Ga0318516_10858481Not Available512Open in IMG/M
3300031640|Ga0318555_10145055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1269Open in IMG/M
3300031682|Ga0318560_10570082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens613Open in IMG/M
3300031708|Ga0310686_110303417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1302Open in IMG/M
3300031715|Ga0307476_10219208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1384Open in IMG/M
3300031719|Ga0306917_10265858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1318Open in IMG/M
3300031719|Ga0306917_10811705Not Available733Open in IMG/M
3300031724|Ga0318500_10482862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens622Open in IMG/M
3300031747|Ga0318502_10459047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300031751|Ga0318494_10211392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1107Open in IMG/M
3300031751|Ga0318494_10874546Not Available527Open in IMG/M
3300031754|Ga0307475_10887602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300031770|Ga0318521_10193423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1172Open in IMG/M
3300031771|Ga0318546_10321475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1074Open in IMG/M
3300031782|Ga0318552_10717981Not Available510Open in IMG/M
3300031793|Ga0318548_10003688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00885335Open in IMG/M
3300031799|Ga0318565_10263562All Organisms → cellular organisms → Bacteria → Proteobacteria838Open in IMG/M
3300031805|Ga0318497_10326798Not Available855Open in IMG/M
3300031819|Ga0318568_10145884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1444Open in IMG/M
3300031823|Ga0307478_11327427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300031845|Ga0318511_10148353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1024Open in IMG/M
3300031845|Ga0318511_10449992Not Available593Open in IMG/M
3300031859|Ga0318527_10105412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1160Open in IMG/M
3300031897|Ga0318520_10024960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2910Open in IMG/M
3300031910|Ga0306923_10440314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1479Open in IMG/M
3300031912|Ga0306921_12347097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales558Open in IMG/M
3300031941|Ga0310912_11168404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria586Open in IMG/M
3300031946|Ga0310910_10042423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD00883166Open in IMG/M
3300031954|Ga0306926_11568054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300032010|Ga0318569_10409846Not Available632Open in IMG/M
3300032025|Ga0318507_10100202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1207Open in IMG/M
3300032035|Ga0310911_10035654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2514Open in IMG/M
3300032051|Ga0318532_10330093Not Available541Open in IMG/M
3300032055|Ga0318575_10555851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300032059|Ga0318533_10059188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2569Open in IMG/M
3300032060|Ga0318505_10029936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2210Open in IMG/M
3300032060|Ga0318505_10153519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1068Open in IMG/M
3300033134|Ga0335073_11878500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens555Open in IMG/M
3300033289|Ga0310914_11013906Not Available730Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.06%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.03%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.03%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.27%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.27%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.27%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.52%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.76%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.76%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.76%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.76%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.76%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015080Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10147071113300002245Forest SoilVKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIGVPA
JGIcombinedJ51221_1010473723300003505Forest SoilMKSPLAXSQRDALIEAMLPDVPFDGWSRAALRAAARRVGV
Ga0062386_10128877113300004152Bog Forest SoilMKSPLAESQRAALIKTILPEVPFDGWSRLALRAAARRCDIGP
Ga0066679_1081545023300005176SoilMKSPLADAERDRLIAAMLPDVPFDGWSQHALRLAAERIGMPVAEAR
Ga0070681_1017594913300005458Corn RhizosphereMKSPLAERQREQLVTAMLPDVAFDGWSRRALRIAGQRVDISMPEALA
Ga0073909_1011721233300005526Surface SoilMRSPYAERETERLIAAMLPDVAFDGWTRHALRNAARRA
Ga0070732_1072890923300005542Surface SoilMKSPLAEHDRGRLIEAMLPDVAFDGWSHAALRVAARQLGMP
Ga0066707_1081575213300005556SoilMRSPLAESQRTALIEAMLPEVAFDGWSRPALRAAARR
Ga0066702_1055505823300005575SoilMRSPFAERERDRLIEAVLPDVAFDGWSRRALRVAAQRIGIPAGEAEAL
Ga0066702_1087518123300005575SoilMKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIGV
Ga0066654_1090925513300005587SoilMRSPFAERERDRLIEAVLPDVAFDGWSRRALRVAAQRVGIP
Ga0066659_1135340213300006797SoilMKSLLADAERDRLIAAILPDVPFDGWSQHALRVAAERIGVPVAEARA
Ga0075425_10159293223300006854Populus RhizosphereMRSPLAERQRAGLIESMLPDVPFDGWSRAALRAAA
Ga0079217_1105133913300006876Agricultural SoilMRSPLAEAETERLIAAILPDVAFDGWTAHALRNAS
Ga0066710_10417829013300009012Grasslands SoilMNSPFAERERERLSAAILPDVAFDGWSRHAGRPAAR
Ga0099830_1084729523300009088Vadose Zone SoilMRSPLAERETERLIAAMLPDVAFDGWSRLALRAAAHRAGMPADAAMALFP
Ga0099830_1109373823300009088Vadose Zone SoilMRSPFAEREQDRLIAAILPDVAFDGWSYHCLRIAARRLGIAPGEAMALGR*
Ga0066709_10205471123300009137Grasslands SoilMNSPFAERERERLIGAILPDVAFDGWSRHAVRNAARRADMP
Ga0066709_10303893423300009137Grasslands SoilMRSPFAERERDRLIEAVLPDIAFDGWSRRALRVAAQRIGIPAGEA
Ga0105249_1189907123300009553Switchgrass RhizosphereMRSPFAEAERERLIAAILPDVPFDGWTSRALHHAA
Ga0126384_1103974723300010046Tropical Forest SoilMKSPLAESQRAALIEAMLPAVAFDGWSRPALRAAARRIGMPVGEAV
Ga0126384_1171246423300010046Tropical Forest SoilMKSPLAESQRAALIEAMLPDVPFDGWSRAALRGAARRIGLPP
Ga0126373_1225521213300010048Tropical Forest SoilMRSPLAENQREALIEAMLPDVAFDGWSRATLRAAARRIGMPV
Ga0134082_1014141513300010303Grasslands SoilMKSPLADAERDRLIAAMLPDVPFDGWSQHALRVAAERIGVPVAEA
Ga0074045_1074840923300010341Bog Forest SoilMKSPLAETQRAALIEAMLPEVPFDGWSRAALRTAA
Ga0126372_1041763313300010360Tropical Forest SoilMRSPLAESQRVALVEAMLPEVAFDGWSRPALRAAARR
Ga0126378_1032436743300010361Tropical Forest SoilMKSPLAEHERDRLIEAMLPDVAFDGWSRAALRVAARQMDMPPAE
Ga0126378_1218580223300010361Tropical Forest SoilMKSPFAESERAALIEAVLPDVPFDGWSRAALRAAARRLNI
Ga0134125_1290529413300010371Terrestrial SoilMRSPLAERDRGRLIEAMLPDVAFDGWSHAALRIAARS
Ga0134126_1296107313300010396Terrestrial SoilMRSPLAEAQRERLVEAILPDVAFDGWTRAALRHAARRAGVPFAEAMAL
Ga0150983_1295176523300011120Forest SoilMRSPLAESQRDTLIEAMLPDVPFDGWSRAALRGAAR
Ga0150985_10361425513300012212Avena Fatua RhizosphereMKSLLADAERDRLIAAMLPDVPFDGWSQHALRVAAERIG
Ga0150985_10783172123300012212Avena Fatua RhizosphereMRSPLAESQRAALIEAMLPDVAFDGWTRAALRAAARQ
Ga0150985_10886133613300012212Avena Fatua RhizosphereVKSPLAESQRDALIEAMLPEVPFDGWSRAALRAAARRIG
Ga0150985_12184275823300012212Avena Fatua RhizosphereMRSPFADAERERLIAAILPDVPFDGWSLRALRSTSRPLISRS
Ga0137370_1082557723300012285Vadose Zone SoilMRSPLADSERDRLIAAILPDVAFDGWSQHALRLAA
Ga0137384_1132312213300012357Vadose Zone SoilMRSPLAERETERLIAAMLPDVAFDGWSRHALRNAARRADIPVGEAM
Ga0137360_1084736413300012361Vadose Zone SoilMKSPLAESQRAALIEAILPDVPFDGWSRPALRAAGRRIGVPLG
Ga0137360_1109535613300012361Vadose Zone SoilMRSPFAERETERLIAAMLPDVAFDGWSRHALRNAARRADIPVGEAM
Ga0150984_10345783723300012469Avena Fatua RhizosphereMRSALAESQRAALIGAMLPDVAFDGWTGAALRTGARR
Ga0150984_10516244123300012469Avena Fatua RhizosphereMRSPFADSERERLIQAMLPDVPFDGWSGRALRGAARRTGITYP
Ga0137395_1125442323300012917Vadose Zone SoilVRSPFAERETERLIWALLPDVAFDGWSRVALRAAARRAGVPPEAAIAMF
Ga0126369_1030513113300012971Tropical Forest SoilMRSPLADSERDRLIAAMLPDVPFDGWSQHALRLAAE
Ga0134087_1048001523300012977Grasslands SoilMRSPLADSERDRLIMAMLPDVAFDEWSQHALRLAADRIGIPTGE
Ga0182024_1134451333300014501PermafrostMKSPMAAGERDRLIEAMLPDIAFDGWSRQTLCAAA
Ga0137414_119717213300015051Vadose Zone SoilMKSPLADSERDRLIAAMLPDVAFDGWSRHALRLAAGRIGMPVGEAMALFRAARR
Ga0167639_104407413300015080Glacier Forefield SoilMKSPLAERDRDRLIEAMLPDVAFDGWSHAAVRLAA
Ga0137418_1072159213300015241Vadose Zone SoilMRSPLAESQRDTLIEAMLPDVPFDGWSRAALRAAARRIGV
Ga0182033_1006642213300016319SoilVKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMPA
Ga0182032_1005268253300016357SoilMKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARRVGLSAGEA
Ga0182037_1071353613300016404SoilMRSPLAETQREALIEAMLPDVVFDGWSRAALRAGARRIGIPTE
Ga0182037_1172779823300016404SoilMKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARR
Ga0182039_1012031013300016422SoilMRSPLAESQRSALIEGMLPDVPFDGWSRAALRAAARRIGI
Ga0182038_1175249913300016445SoilMKSPFAESQRDALIEAMLPDVPFDGWSRAALRTAARRIGVSA
Ga0187783_1105184523300017970Tropical PeatlandVKSPLAERDRDRLIEAILPDVPFDGWSYMALRLAARRVGID
Ga0187780_1143188723300017973Tropical PeatlandMRSPLAESQREALIEAMLPDVAFDGWSRAALRAGAQ
Ga0187805_1015754813300018007Freshwater SedimentMKSPLAERDRGRLIEAILPNVAFDGWSHAALRGAAR
Ga0187805_1054888423300018007Freshwater SedimentVRSPLADRDRDRLIGAMLPDVAFDGWSHLALRVAARQLG
Ga0187770_1152216823300018090Tropical PeatlandMKSPLAERDRDRLIEAMLPDVAFEGWSNASLRAAAKRIDMPAAEAL
Ga0210403_1027980913300020580SoilMRSPLAENQRAALIEAMLPNVAFDGWSRSAVRAAARCIG
Ga0210395_1122112313300020582SoilVKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAAR
Ga0210400_1046066233300021170SoilVRSPLAESQREALIEAMLPEVAFDGWSRPALRAAARRIGMPA
Ga0210408_1006445453300021178SoilMRSPLAERESEALIEAMLPDVTFDGWSRPALRAAARRIGIPTGETLALFP
Ga0213873_1031957013300021358RhizosphereMKSPLADSERDRLIVAMLPDVPFDGWSQHALRRAADRIGMP
Ga0213877_1025281313300021372Bulk SoilMRSPLAETQRAALIEAMLPDVAFDGWSRPALRAGARRI
Ga0213876_1046114323300021384Plant RootsMKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRI
Ga0210397_1050616333300021403SoilMKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAAR
Ga0213871_1012903913300021441RhizosphereMRSPLAESQREALIEAMLPDVAFDGWSRATLRAAARRIGMPVAAAL
Ga0126371_1083688313300021560Tropical Forest SoilMKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARRVGLS
Ga0242669_106581813300022528SoilMKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAAQ
Ga0242655_1012789423300022532SoilMRSPLAESQREALIEAMLPEVAFDGWSRPALRAAARRIGMPG
Ga0242662_1026521213300022533SoilMRSPLAENQRAALIEAMLPNVAFDGWSRSAVRAAARCIGM
Ga0212123_1034675213300022557Iron-Sulfur Acid SpringMRSPFAERERERLIAAMLPDVAFDGWSRHALRNAARRADIPVGEALAL
Ga0207663_1064291623300025916Corn, Switchgrass And Miscanthus RhizosphereMKSPLAESQRGVLIEAMLPDVPFDGWSRPALRAAARRIDMP
Ga0207662_1000449213300025918Switchgrass RhizosphereMRSPLADSERDRLIAAMLPDVAFDGWSQHALRLAARRIGVPVGEAT
Ga0207661_1184768513300025944Corn RhizosphereMKSPFADSERERLIQAILPDVPFDGWSTRALRGAARRTGIPFPEA
Ga0207712_1146389823300025961Switchgrass RhizosphereMRSPFAEAERERLIAAILPDVPFDGWTSRALHHAARRIDIPAAE
Ga0209647_121437013300026319Grasslands SoilMKSPLADSERDRLIAAMLPDVAFDGWSRHALRLAAGRIGMPVGEAM
Ga0209158_134149323300026333SoilMKSPLADAERDRLIAAMLPDVPFDGWSQHALRIAAERIGMPVTEA
Ga0209161_1057413713300026548SoilMKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIGVPA
Ga0209076_112837623300027643Vadose Zone SoilMRSPLAESQRTALIEAMLPDVAFDGWSRPALRAAARRTGIP
Ga0209581_120483523300027706Surface SoilMKSPLADSEREALVAAMLPEVPFEGWSRAALRAAARRVGIPPGEA
Ga0209177_1005757633300027775Agricultural SoilMKSPLAESQREALIEAMLPDVPFDGWSRAALRAAARRIRL
Ga0209656_1030050113300027812Bog Forest SoilMKSPLAESQRAALIKTILPEVPFDGWSRLALRAAARRCD
Ga0209060_1029786223300027826Surface SoilMRSPLAEAERERLIEAILPDVPFDGWSAVALRQAAE
Ga0209515_1035193923300027835GroundwaterVRSPLAERERERLIEAILPEIAFDGWSRLALRRAAASAGVP
Ga0209579_1038317613300027869Surface SoilMKSPLAERDRDRLIEAALPDVPFDGWSHAALRVAAK
Ga0209275_1092717323300027884SoilMKSPLAEHDRDRLIEAILPDVAFDGWSHGALRSAARRLDMPA
Ga0308183_110029623300030988SoilVKSPFADSERERLIQAILPDVPFDGWSTRALRGAARR
Ga0073998_1158431213300031023SoilMKSPLADSERDRLIAAMLPDVAFDGWSRHALRLAAGRVGI
Ga0170834_10708785723300031057Forest SoilMRSPLAEEQRAALIEAMLPNVPFDSWSRAALRAAARRIG
Ga0170823_1184515623300031128Forest SoilMRSPLAEEQRAALIEAMLANVPFDSWSRAALRAAAR
Ga0170819_1165372723300031469Forest SoilMKSPLAEDQRATLIEAMLPNVPFDGWSRPALRAAARHIG
Ga0318516_1085848113300031543SoilMRSPLAESQRAALIEAMLPDVPFDGWSRAALRAAARR
Ga0318555_1014505543300031640SoilMRSPLAENQRAALVAAMLPNVPFDGWSRPVLRAAARRIGMPADEA
Ga0318560_1057008213300031682SoilVKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMPAPEALALF
Ga0310686_11030341743300031708SoilMKSPLSDARREALIEAMLPDAPFDGWTRAGLRKAARRLAVPVGEALALS
Ga0307476_1021920813300031715Hardwood Forest SoilVNSPLADAQRAALIEAILPDVPFDGWSRAALRAAARRCDIG
Ga0306917_1026585843300031719SoilMRSPLAESQREALIEAMLPDVAFDGWSRAALRAGARRIGIPTEEA
Ga0306917_1081170513300031719SoilMRSPLAENQRAALIEAMLPNVAFDGWSRSAVRAAA
Ga0318500_1048286213300031724SoilMKSPLAESQREALIEAMLPDVAFDGWSRSALRAAARRIGIPAGE
Ga0318502_1045904713300031747SoilVKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMPAPEALALFS
Ga0318494_1021139213300031751SoilMRSPLAENQRAALIEAMLPNVAFDGWSRSAVRTAA
Ga0318494_1087454613300031751SoilMRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAARRVGMP
Ga0307475_1088760223300031754Hardwood Forest SoilMKSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRGGVP
Ga0318521_1019342333300031770SoilMRSPLAEEQRAALIEAILPTVPFDGWSRPALRAAARRAGIPAD
Ga0318546_1032147533300031771SoilMRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAARLV
Ga0318552_1071798123300031782SoilMNSPLAEQQRTALIEAILPEVAFDGWSRAALRAAAR
Ga0318548_1000368883300031793SoilMRSPLADDQRAALIAAMLPNVAFDGWSRPALRAAARRVG
Ga0318565_1026356213300031799SoilMRSPLAENQRAALIEAMLPNVPFDGWSRLALRSAARRVGLS
Ga0318497_1032679833300031805SoilMRSPLAEEQRAALIEAILPNVPFDGWSRPALRAAARRAGI
Ga0318568_1014588413300031819SoilMRSPLAESQRDALIEAMLPDVPFDGWSRAALRAAARRIAMPPGEA
Ga0307478_1132742713300031823Hardwood Forest SoilMKSPLAERERDRLIEAMLPDIAFDGWSHAALRVAARQL
Ga0318511_1014835333300031845SoilMRSPLAENQRAALIEAMLPNVAFDGWSRSAVRTAARC
Ga0318511_1044999223300031845SoilMRSPLAEEQRAALIEAILPNVPFDGWSRPALRAGSSSG
Ga0318527_1010541213300031859SoilMRSPLAESQRDALIEAMLPDVPFDGWSRAALRTAARRIGIPP
Ga0318520_1002496053300031897SoilMKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAARRVGLSAGEALAL
Ga0306923_1044031443300031910SoilMRSPLAEKQRAALIEAMLPSVPFDGWSRPALRSAARRVGMPAD
Ga0306921_1234709713300031912SoilMRSPLAEGQRAALIEAVLPHVPFDGWSRPALRAAARHIGMPA
Ga0310912_1116840423300031941SoilMRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAA
Ga0310910_1004242313300031946SoilMRSPLADDQRTALIAAMLPNVAFDGWSRPALRAAARRVGMP
Ga0306926_1156805413300031954SoilMRSPFAERERDRLIAAMLPDVAFDGWSGHALRATARRID
Ga0318569_1040984623300032010SoilMRSPLAESQRGALIEAMLPDVPFDGWSRSALRAAARRT
Ga0318507_1010020233300032025SoilVKSPLAESQRDALIAAMLPDVPFDGWSRAGLRAAARRIGMP
Ga0310911_1003565443300032035SoilMRSPLAESQRAALIEAMLPDVPFDGWSRAALRAAARRIGIP
Ga0318532_1033009323300032051SoilMKSPLAESQREALIEAMLPDVAFDGWSRSALRAAA
Ga0318575_1055585113300032055SoilMRSPLAEKQRAELIEAMLPSVPFDGWSRPALRSAARRVG
Ga0318533_1005918813300032059SoilMRSPLAEEQRAALIEAILPNVPFDGWSRPALRAGSSSGSVS
Ga0318505_1002993613300032060SoilMRSPLADDQRAALIAAMLPNVAFDGWSRPALRAAARRDRKY
Ga0318505_1015351933300032060SoilMRSPLAESQREALIEAMLPDVAFDGWSRAALRAGARRIGIP
Ga0335073_1187850013300033134SoilMKSPLAEQDRDRLIEAMLPDIAFDGWSNAALRVAA
Ga0310914_1101390613300033289SoilMKSPLAEDQRAALIEAMLPNVPFDGWSRLALRSAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.