Basic Information | |
---|---|
Family ID | F060800 |
Family Type | Metagenome |
Number of Sequences | 132 |
Average Sequence Length | 42 residues |
Representative Sequence | LILGDNEVAEGLWTLKTLADGSQQKLTEPDLLDFLRKL |
Number of Associated Samples | 114 |
Number of Associated Scaffolds | 132 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.24 % |
% of genes from short scaffolds (< 2000 bps) | 87.12 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.697 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.758 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.212 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.73% β-sheet: 15.15% Coil/Unstructured: 62.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 132 Family Scaffolds |
---|---|---|
PF01336 | tRNA_anti-codon | 85.61 |
PF13589 | HATPase_c_3 | 2.27 |
PF03129 | HGTP_anticodon | 1.52 |
PF02224 | Cytidylate_kin | 1.52 |
COG ID | Name | Functional Category | % Frequency in 132 Family Scaffolds |
---|---|---|---|
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.52 |
COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 1.52 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.52 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.52 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.24 % |
Unclassified | root | N/A | 0.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01C24DC | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → Desulfuromonas acetoxidans | 525 | Open in IMG/M |
3300000955|JGI1027J12803_109237797 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300001162|JGI12714J13572_1007953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300001593|JGI12635J15846_10351315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300001652|JGI20274J16320_101807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300003352|JGI26345J50200_1025954 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300004080|Ga0062385_10682786 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300004091|Ga0062387_100047181 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
3300004092|Ga0062389_104064001 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005176|Ga0066679_10700385 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300005178|Ga0066688_11030936 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005332|Ga0066388_106644913 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005434|Ga0070709_11375316 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005450|Ga0066682_10303450 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300005545|Ga0070695_100326369 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300005547|Ga0070693_100366085 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300005952|Ga0080026_10103843 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300005993|Ga0080027_10021817 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
3300006050|Ga0075028_100389293 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300006052|Ga0075029_100442106 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300006162|Ga0075030_100387009 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300006755|Ga0079222_10575947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 851 | Open in IMG/M |
3300006755|Ga0079222_12170058 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300006797|Ga0066659_10466239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
3300006854|Ga0075425_102274159 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300007076|Ga0075435_101658278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300007258|Ga0099793_10384927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300009038|Ga0099829_11704982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300009088|Ga0099830_11650175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 534 | Open in IMG/M |
3300009089|Ga0099828_11675412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300009638|Ga0116113_1038408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1091 | Open in IMG/M |
3300009646|Ga0116132_1041646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
3300009792|Ga0126374_11832413 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010046|Ga0126384_11366497 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 659 | Open in IMG/M |
3300010048|Ga0126373_12397015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300010048|Ga0126373_13129780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300010321|Ga0134067_10167120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300010322|Ga0134084_10145676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300010326|Ga0134065_10150586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
3300010326|Ga0134065_10159517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300010360|Ga0126372_11057239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300010360|Ga0126372_13199216 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 509 | Open in IMG/M |
3300010361|Ga0126378_11171455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 867 | Open in IMG/M |
3300010366|Ga0126379_11091527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300011120|Ga0150983_13625346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300011120|Ga0150983_14396470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300011269|Ga0137392_10539904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
3300011269|Ga0137392_10992458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 690 | Open in IMG/M |
3300011270|Ga0137391_10640671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
3300011271|Ga0137393_10125279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
3300011271|Ga0137393_11240138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 633 | Open in IMG/M |
3300011271|Ga0137393_11522150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 558 | Open in IMG/M |
3300012096|Ga0137389_11211468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 647 | Open in IMG/M |
3300012189|Ga0137388_10267497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1560 | Open in IMG/M |
3300012189|Ga0137388_11690207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300012203|Ga0137399_11513317 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 558 | Open in IMG/M |
3300012205|Ga0137362_10085461 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
3300012205|Ga0137362_11174182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300012211|Ga0137377_10981359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300012211|Ga0137377_11318267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 652 | Open in IMG/M |
3300012351|Ga0137386_10087946 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
3300012351|Ga0137386_10158880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
3300012361|Ga0137360_11039884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300012363|Ga0137390_10945965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300012685|Ga0137397_11167309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300012918|Ga0137396_10219579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
3300012923|Ga0137359_11091287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300012924|Ga0137413_10498152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300012927|Ga0137416_11626613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300012929|Ga0137404_10278914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
3300014657|Ga0181522_10104059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
3300015264|Ga0137403_10019153 | All Organisms → cellular organisms → Bacteria | 7370 | Open in IMG/M |
3300015264|Ga0137403_10085321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3186 | Open in IMG/M |
3300015373|Ga0132257_103330216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300016270|Ga0182036_10420763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300016270|Ga0182036_11262573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300016294|Ga0182041_11526959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300016319|Ga0182033_11555010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300017930|Ga0187825_10205630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300017930|Ga0187825_10371038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300018018|Ga0187886_1303083 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 595 | Open in IMG/M |
3300020199|Ga0179592_10015405 | All Organisms → cellular organisms → Bacteria | 3359 | Open in IMG/M |
3300020579|Ga0210407_10300881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
3300020580|Ga0210403_11356380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300020581|Ga0210399_10629074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300020582|Ga0210395_10633510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300020583|Ga0210401_11268747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300021168|Ga0210406_11362090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300021178|Ga0210408_10660714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
3300021477|Ga0210398_11016876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300021560|Ga0126371_10020022 | All Organisms → cellular organisms → Bacteria | 6166 | Open in IMG/M |
3300025906|Ga0207699_11132644 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 579 | Open in IMG/M |
3300025910|Ga0207684_10613284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
3300025922|Ga0207646_10612456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
3300025922|Ga0207646_10614222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300025928|Ga0207700_10980021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300026301|Ga0209238_1011082 | All Organisms → cellular organisms → Bacteria | 3526 | Open in IMG/M |
3300026304|Ga0209240_1056070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 1479 | Open in IMG/M |
3300026312|Ga0209153_1289499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300026313|Ga0209761_1128404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
3300026333|Ga0209158_1093461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
3300026360|Ga0257173_1062261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300026524|Ga0209690_1267196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300026551|Ga0209648_10402869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300026830|Ga0207861_107264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300027562|Ga0209735_1012085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
3300027591|Ga0209733_1027146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin510 | 1544 | Open in IMG/M |
3300027645|Ga0209117_1144413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300027787|Ga0209074_10520128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300027812|Ga0209656_10024569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3642 | Open in IMG/M |
3300027825|Ga0209039_10291332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300027882|Ga0209590_10413424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300027903|Ga0209488_10103379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2137 | Open in IMG/M |
3300027911|Ga0209698_11132926 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 578 | Open in IMG/M |
3300030007|Ga0311338_10050529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5541 | Open in IMG/M |
3300031681|Ga0318572_10810084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300031720|Ga0307469_12250266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300031744|Ga0306918_10697465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300031754|Ga0307475_10009460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6419 | Open in IMG/M |
3300031770|Ga0318521_10004908 | All Organisms → cellular organisms → Bacteria | 5183 | Open in IMG/M |
3300031770|Ga0318521_11035312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300031792|Ga0318529_10163553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
3300031805|Ga0318497_10503252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300031941|Ga0310912_11422261 | Not Available | 523 | Open in IMG/M |
3300032010|Ga0318569_10606671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300032039|Ga0318559_10493077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300032042|Ga0318545_10008309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3066 | Open in IMG/M |
3300032059|Ga0318533_10398153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
3300032059|Ga0318533_10907172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300032174|Ga0307470_10045097 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
3300032180|Ga0307471_100894011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
3300033004|Ga0335084_11423030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.15% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.06% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.06% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.79% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.03% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.03% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.27% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.76% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.76% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.76% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001652 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 | Environmental | Open in IMG/M |
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026830 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 33 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_12548160 | 2170459005 | Grass Soil | RYALILGDNEVSEGSWTLKTLADGTQQKFTEPELLEFLHQGKRWSS |
JGI1027J12803_1092377971 | 3300000955 | Soil | RYALILGDNEVAEGSWTLKTLADGTQQKFTEPELLDFLKRHP* |
JGI12714J13572_10079532 | 3300001162 | Forest Soil | LILGDDEVSEGLWTLKTLADGSQAKYTEPDLLDHLRKSKAVSS* |
JGI12635J15846_103513151 | 3300001593 | Forest Soil | QYALILGENEIAEGIWTLKTLADGTQAKFTEAELMEHLKKGKAAE* |
JGI20274J16320_1018071 | 3300001652 | Forest Soil | ILGDNEVADGQWTLKNLADGSQQKLTEQALLNYLKSL* |
JGI26345J50200_10259542 | 3300003352 | Bog Forest Soil | LGARHALILGENEVASGEWTLKTLGDGSQQKLAEQALLEYLQKL* |
Ga0062385_106827861 | 3300004080 | Bog Forest Soil | LILGDNEVSEGSYTLKTLADGTQEKYAEPDLLEFLKGHQ* |
Ga0062387_1000471811 | 3300004091 | Bog Forest Soil | RHALILGEDEVASGQWTLKTLADGSQQKLTEQALLEYLHTASARS* |
Ga0062389_1040640011 | 3300004092 | Bog Forest Soil | ALILGDNEVSEGLWTLKTLSDGTQQKLPEPEIIEYLRQSMSDAKL* |
Ga0066679_107003851 | 3300005176 | Soil | ALILGDNEVAEGTWTLKTLADGTQQKFTEPHLLDFLKKL* |
Ga0066688_110309362 | 3300005178 | Soil | YALILGDNEVSEGSWTLKTLVDGTQQKFTEPELLEFLKQRKSGS* |
Ga0066388_1066449131 | 3300005332 | Tropical Forest Soil | GDNEVSEGLWTLKTLASGEQTKLTEPELLQFLRQQKLLDRDL* |
Ga0070709_113753162 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ALILGDNEVSEAMWTLKTLSTGEQQKLPEPDLIEFLRKQKNVSS* |
Ga0066682_103034501 | 3300005450 | Soil | ILGDNEVSEGLWTLKTLADGSQLKLPEPALIEHLRKSKAVSS* |
Ga0070695_1003263691 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KYALILGDNEVSEAMWTLKTLSTGEQQKLPEPEVINFLRQQKNVSS* |
Ga0070693_1003660852 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GDNEVSEAMWTLKTLSTGEQQKLPEPEVINFLRQQKNVSS* |
Ga0080026_101038432 | 3300005952 | Permafrost Soil | ALILGDDEVSSGEWTLKTLADGSQAKYTETDLLDYLRDATATAQK* |
Ga0080027_100218173 | 3300005993 | Prmafrost Soil | RYALILGDDEASSGEWTLKTLADGSQAKYTEPDLLEYLREAKPGGE* |
Ga0075028_1003892931 | 3300006050 | Watersheds | LILGDNEVSEGLWTLKTLADGSQAKFTEPELLERLRKQKAL* |
Ga0075029_1004421062 | 3300006052 | Watersheds | ALILGDNEVASGEWTLKTLATGEQAKIKEGHLIEHLKNAG* |
Ga0075030_1003870091 | 3300006162 | Watersheds | GAKYALILGDNEVSEGLWTLKTLADGSQAKFTEPDLLEHLRKQKALSS* |
Ga0079222_105759472 | 3300006755 | Agricultural Soil | LILGDNEVSSGERTLKTLATGEQQKLREPGLLDFLRKK* |
Ga0079222_121700581 | 3300006755 | Agricultural Soil | LGAKYALILGDNEVAEGLWTLKTLADGSQAKFTEPDLLAHLRKSKGVSS* |
Ga0066659_104662391 | 3300006797 | Soil | NEVSEGLWTLKTLADGSQAKYTEPDLLEHLRKQKALSS* |
Ga0075425_1022741591 | 3300006854 | Populus Rhizosphere | LILGDDEVAEGLWTLKTLSDGSQIKLPEPDLIDHLRKSV* |
Ga0075435_1016582782 | 3300007076 | Populus Rhizosphere | ILGDNEVAEGSWTLKTLADGSQQKFTEPELLEFLGNRRARD* |
Ga0099793_103849271 | 3300007258 | Vadose Zone Soil | NEVSEALWTLKTLADGTQQKLTEPDLLQFLRDQKRVSS* |
Ga0099829_117049821 | 3300009038 | Vadose Zone Soil | KLGARFALILGDNEVTSGEWTLKTLADGSQAKFTEPDLLEHLKKQL* |
Ga0099830_116501752 | 3300009088 | Vadose Zone Soil | NEVSEGLWTLKTLADGSQAKYTEPDLLEHLRKTL* |
Ga0099828_116754122 | 3300009089 | Vadose Zone Soil | ALILGDNEVSEGLWTLKTLADGSQLKLPEPALIEHLRKSKAVSS* |
Ga0116113_10384081 | 3300009638 | Peatland | ALILGEDEVASGTFTLKRLADAEQRRLTETELLGHLRSGE* |
Ga0116132_10416463 | 3300009646 | Peatland | ARYALILGEDEVASGQWTVKTLADGTQGKYSEAGLLEFLRKQKS* |
Ga0126374_118324131 | 3300009792 | Tropical Forest Soil | RYALILGDNEVASGEWTLKTLATGEQTKFKEEADLLGFLRKSKAVSS* |
Ga0126384_113664971 | 3300010046 | Tropical Forest Soil | LILGDNEVAEGTWTLKSLADGTQHKLTEPQLLDFLKNWK* |
Ga0126373_123970151 | 3300010048 | Tropical Forest Soil | ALILGEDEVASGLWTLKTLADGSQQKYAEAELLAFLRKACRSTRLP* |
Ga0126373_131297801 | 3300010048 | Tropical Forest Soil | EDEVASGLWTLKTLADGSQQKYAEAELLAFLRKAGSSPRLP* |
Ga0134067_101671202 | 3300010321 | Grasslands Soil | LGDNEVSQGLWTLKTLADGSQAKYTEPDLLEHLKKQL* |
Ga0134084_101456762 | 3300010322 | Grasslands Soil | ILGDNEVSEGLWTLKMLADGSQAKFTEPDLLEHLRKQKALSS* |
Ga0134065_101505862 | 3300010326 | Grasslands Soil | GDNEVSEGLWTLKTLADGAQLKLPEPALIEHLRKSKAVSS* |
Ga0134065_101595171 | 3300010326 | Grasslands Soil | LGAKYALILGDNEVSEGLWTLKTLADGSQAKYTEPDLLEHLKKQL* |
Ga0126372_110572391 | 3300010360 | Tropical Forest Soil | LGAKYALILGDNEVAEGSWTLKTLADGSQRKFTEPELLDFLLRGRS* |
Ga0126372_131992161 | 3300010360 | Tropical Forest Soil | GDDELIEGLWTMETLARGEQPKLNEPELLQFLRPHKLLDRDL* |
Ga0126378_111714551 | 3300010361 | Tropical Forest Soil | ALILGDNEVTSGEWTVKTLASGEQAKFSEANLVEFLRKSKAVSS* |
Ga0126379_110915271 | 3300010366 | Tropical Forest Soil | LILGDNEVVEGSWALKTLADGTQQKFTESELLDFLKRSL* |
Ga0150983_136253461 | 3300011120 | Forest Soil | DNEVSEGLWTLKTLADGSQTKYTEADLLEYLRKSVE* |
Ga0150983_143964702 | 3300011120 | Forest Soil | VSEGSWTLKTLADGSQAKYTEPDLLEHLRKQRALSS* |
Ga0137392_105399042 | 3300011269 | Vadose Zone Soil | GDNEVSEGLWTLKTLSDGTQQKLTESDLLEFLRQQGKVSS* |
Ga0137392_109924581 | 3300011269 | Vadose Zone Soil | AKHALILGDNEVSEGLWTLKTLADGSQLKLPEPALIEHLRKSKAVSS* |
Ga0137391_106406711 | 3300011270 | Vadose Zone Soil | ALILGDNEVSEGLWSLKTLADGSQQKLTEPQLLDFLRKS* |
Ga0137393_101252793 | 3300011271 | Vadose Zone Soil | GAKHALILGDNEVSEGLWTLKTLADGSQAKFTEPDLLEYLKKQL* |
Ga0137393_112401381 | 3300011271 | Vadose Zone Soil | NEVSEGLWTLKTLADGSQLKLPEPALIEHLRKSKAVSS* |
Ga0137393_115221501 | 3300011271 | Vadose Zone Soil | NEVSEGLWTLKTLADGSQGKYTEADLLEHLRKSL* |
Ga0137389_112114682 | 3300012096 | Vadose Zone Soil | DGLIPGDNGVFEGLWALKALAEGSQLKLAEPGLIEQLRKSKAVSS* |
Ga0137388_102674971 | 3300012189 | Vadose Zone Soil | NEVSEGLWTLKTLSTGEQTKFTASDLLEFLRQQKNVSS* |
Ga0137388_116902072 | 3300012189 | Vadose Zone Soil | LGAKHALILGDNEVSEGLWTLKTLADGSQAKYTEPELLEYLRKSKVVAGL* |
Ga0137399_115133172 | 3300012203 | Vadose Zone Soil | ILGDNEVSEGSWTLKTLAEGTQQKFTEPELLEFLRSTKG* |
Ga0137362_100854613 | 3300012205 | Vadose Zone Soil | EGLWTLKTLSTGEQTKFTESDLLEFLRQQKNVSS* |
Ga0137362_111741821 | 3300012205 | Vadose Zone Soil | GEDEVTEGLWTLKTLDDGAQIKLPEPALIEHLRNSLNPHPL* |
Ga0137377_109813591 | 3300012211 | Vadose Zone Soil | LILGDNEVSEGLWTLKTLADGSQLKLPEPALIEHLRKSKAGSS* |
Ga0137377_113182671 | 3300012211 | Vadose Zone Soil | LILGDNEVSEGLWTLKTLADGSQLKLPEPALIEHLRKSKAVSS* |
Ga0137386_100879463 | 3300012351 | Vadose Zone Soil | RYALILGDNEVSEGSWTLKTLVDGIQQKFTEPELLEFLRQRKSGG* |
Ga0137386_101588802 | 3300012351 | Vadose Zone Soil | ALILGDNEVSSGEWTLKTLADGTQQKLSEPQLLDFLRNL* |
Ga0137360_110398841 | 3300012361 | Vadose Zone Soil | ILGDNEVSEGLWTLKTLADGSQAKFTEPDLLEHLRKQKTLSS* |
Ga0137390_109459651 | 3300012363 | Vadose Zone Soil | KYALILGDNEVSEGLWTLKTLADGSQAKFTEPDLLEHLRRQKALSS* |
Ga0137397_111673092 | 3300012685 | Vadose Zone Soil | ILGDNEVTSGEWTLKTLADGTQQKLTEPQLFDFLRKL* |
Ga0137396_102195791 | 3300012918 | Vadose Zone Soil | DNEVSEGLWTLKTLADGSQEKYTESDLLEHLRKQKALSS* |
Ga0137359_110912871 | 3300012923 | Vadose Zone Soil | YALILGDNEVSEGLWTLKTLADGSQQKLTEPDLLEFLRNL* |
Ga0137413_104981521 | 3300012924 | Vadose Zone Soil | DNEVSEGLWTLKTLADGSQQKLTEPQLLDFLRKS* |
Ga0137416_116266131 | 3300012927 | Vadose Zone Soil | YALILGDNEVSEGLWTLKTLADGSQAKYTEPDLLEYLRKQKTL* |
Ga0137404_102789142 | 3300012929 | Vadose Zone Soil | DNEVAEGLWTLKSLADGSQAKFTEPDLLDYLRKQKALSS* |
Ga0181522_101040592 | 3300014657 | Bog | ALILGDNEVSEGFYTLKTLADGTQQKFTEPELLEFLQAS* |
Ga0137403_100191536 | 3300015264 | Vadose Zone Soil | ILGDNEVSSGEWTLKTLADGTQAKFAEAALLEYLKQKKV* |
Ga0137403_100853214 | 3300015264 | Vadose Zone Soil | SEALWTLKTLSTGEQEKFPEPDLIEFLRNQKSQS* |
Ga0132257_1033302161 | 3300015373 | Arabidopsis Rhizosphere | RYALILGDNEVAEGSWTLKTLADGSQRKFTEPELLDFLKDSCD* |
Ga0182036_104207631 | 3300016270 | Soil | ALLLGDNEVAEGSWTLKTLVDGSQQKFTEPELFDFLKHRRA |
Ga0182036_112625731 | 3300016270 | Soil | LNSHYALILGDNEVAEGSWTLKTLADGSQRKFTEPQLVEFLRRGRA |
Ga0182041_115269592 | 3300016294 | Soil | ILGEDEVASGLWTLKTLADGSQQKYAEAELLAFLRKACSSPRLP |
Ga0182033_115550102 | 3300016319 | Soil | LILGEDEVASGLWTLKTLADGSQQKYAEAELLAFLRKACRSTRLP |
Ga0187825_102056301 | 3300017930 | Freshwater Sediment | NEVAEGSWTLKTLADGSQQKFTEPELLEFLRSSRG |
Ga0187825_103710382 | 3300017930 | Freshwater Sediment | FALILGDNEVAEGSWTLKTLADGSQQKFTEPELLEFLKRSL |
Ga0187886_13030831 | 3300018018 | Peatland | ARYALILGEDEVASGQWTLKTLADGTQGKYSEAGLLEFLRKQKS |
Ga0179592_100154051 | 3300020199 | Vadose Zone Soil | YALILGDNEVSEGLWTLKTLADGSQEKYTEADLLEYLRKSL |
Ga0210407_103008812 | 3300020579 | Soil | YALILGDNEVAEGLWTLKTLADGSQTKFTEADLIEHLRKSNQVSS |
Ga0210403_113563801 | 3300020580 | Soil | VSEGLWTLKTLSTGEQEKFPEPELIEFLRQQKNVSS |
Ga0210399_106290742 | 3300020581 | Soil | ILGDNEVSEALWTLKTLSTGEQQKFPEPDLIEFLCQQKNVSS |
Ga0210395_106335102 | 3300020582 | Soil | DNEVAEGLWTLKTLADGSQAKFTEADLLEHLRKKE |
Ga0210401_112687471 | 3300020583 | Soil | LGSRFVLILGDNEVADGQWTLKTLADGSQQKLTEPALLEYLRNQKAGL |
Ga0210406_113620902 | 3300021168 | Soil | RFALILGDNEVTSGEWTLKTLGDGSQQKLTEAALLEYLRR |
Ga0210408_106607141 | 3300021178 | Soil | KYALILGDNEVAEGSWTLKTLADGTQTKLPEPALIEHLRKSAG |
Ga0210398_110168762 | 3300021477 | Soil | ALILGEDEVTEGLWTLKTLDDGAQIKLPEPALIEHLRKSS |
Ga0126371_100200227 | 3300021560 | Tropical Forest Soil | ALILGDNEVASGEWTLKTLADGTQQKLSEPQLLDFLRKL |
Ga0207699_111326441 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EAKYALILGDNEVSEAMWTLKTLSTGEQQKLPEPDLIEFLRKQKNVSS |
Ga0207684_106132841 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LGDNEVSEASWTLKTLVDGTQQKFTEPELLEFLKQRKSGS |
Ga0207646_106124562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YALILGDNEVAEGSWTLKTLADGSQRKFTEPALLDFLKDSRD |
Ga0207646_106142221 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LILGDNEVAEGLWTLKTLADGSQQKLTEPDLLDFLRKL |
Ga0207700_109800212 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KYALILGDNEVSEGLWTLKTLSTGDQQKLPEPALLDFLRQQKNVSS |
Ga0209238_10110823 | 3300026301 | Grasslands Soil | YALILGDNEVAEGTWTLKTLADGTQQKFTEPHLLDFLKKL |
Ga0209240_10560702 | 3300026304 | Grasslands Soil | VSEGLWTLKTLSTGEQTKFTESDLLEFLRQQKNVSS |
Ga0209153_12894991 | 3300026312 | Soil | NEVASGEWTLKTLATGEQQKLSESRLLDFLGKKRSGE |
Ga0209761_11284042 | 3300026313 | Grasslands Soil | LILGDNEVSSGEWTLKTLATGEQQKLTEPRLLEFLKKL |
Ga0209158_10934612 | 3300026333 | Soil | LGDNEVSSGEWTLKTLATGEQQKLTEPRLLEFLKKL |
Ga0257173_10622612 | 3300026360 | Soil | LGDNEVSEGSWTLKTLADGTQQKFTEPELLEFLKA |
Ga0209690_12671962 | 3300026524 | Soil | YALILGEDEVASGQWTLKTLADGSQAKCTESALLEYLRKL |
Ga0209648_104028692 | 3300026551 | Grasslands Soil | AKYALILGDNEVSEGLWTLKTLADGSQAKFTEPDLLEHLRKQKALSS |
Ga0207861_1072641 | 3300026830 | Tropical Forest Soil | ALILGEDEVASGQWTLKTLADGSQQKYSEATLLEFLSKQKQLSS |
Ga0209735_10120851 | 3300027562 | Forest Soil | DNEVSEGLWTLKTLADGSQAKYTEPDLLEYLRKQKAPSS |
Ga0209733_10271461 | 3300027591 | Forest Soil | ALILGDNEVSEALWTIKTLSTGEQQKLPEPELLQFLRDQKPESQ |
Ga0209117_11444131 | 3300027645 | Forest Soil | VAEGLWTLKTLADGSQGKFSESDLLEFLRKGHAAR |
Ga0209074_105201282 | 3300027787 | Agricultural Soil | LILGDNEVSSGEWTLKTLADGSQQKLTEPQLLEFLRKRRTVSS |
Ga0209656_100245693 | 3300027812 | Bog Forest Soil | YALILGDNEVSEGMFTLKTLADGTQQKFTEPELLEFLKL |
Ga0209039_102913321 | 3300027825 | Bog Forest Soil | DSRYALILGDNEVSEGMFTLKTLADGTQQKFTEPELLEFLKL |
Ga0209590_104134241 | 3300027882 | Vadose Zone Soil | ALILGGSQISERKRTLKTLADGTQQKLTEPQLLDFLRKL |
Ga0209488_101033791 | 3300027903 | Vadose Zone Soil | ILGDNEVSEGLWSLKTLADGSQQKLTEPQLLDFLRKS |
Ga0209698_111329262 | 3300027911 | Watersheds | GAKYALILGDNEVSEGLWTLKTLADGSQAKFTEPDLLEHLRKQKALSS |
Ga0311338_100505291 | 3300030007 | Palsa | SKLDSRYALILGDNEVSEGFYTLKTLADGTQQKFTEPELLEFLKAS |
Ga0318572_108100841 | 3300031681 | Soil | SRYALLLGDNEVAEGSWTLKTLVDGSQQKFTEPELFDFLKHRRA |
Ga0307469_122502662 | 3300031720 | Hardwood Forest Soil | NEVSEGLWTLKTLADGSQAKYTEPDLLEHLRKQKML |
Ga0306918_106974652 | 3300031744 | Soil | ILGEDEVASGLWTLKTLADGSQQRYAEAELLAFLRKACSSPRLP |
Ga0307475_100094601 | 3300031754 | Hardwood Forest Soil | LGDNEVSSGEWTLKTLADGTQQKLTEPQLLDFLRNL |
Ga0318521_100049081 | 3300031770 | Soil | LGDNEVSSGEWTVKRLADGTQQKLTEPQLLDFLRKL |
Ga0318521_110353122 | 3300031770 | Soil | ALILGEDEVASGLWTLKTLADGSQQKYAEAELLAFLRKACSSPRLP |
Ga0318529_101635532 | 3300031792 | Soil | SKLNSRYALILGDNEVADGLWTVKTLADGSQQKLTEPELRDFLGRARG |
Ga0318497_105032521 | 3300031805 | Soil | LILGDNEVADGLWTVKTLADGSQQKLTEPELRDFLGRARG |
Ga0310912_114222612 | 3300031941 | Soil | ALILGEDEVASGLWTLKTLADGSQQRYAEAELLAFLRKACSSPRLP |
Ga0318569_106066712 | 3300032010 | Soil | LGDNEVADGLFTVKTLADGSQQKLTEPALRDFLGRARG |
Ga0318559_104930772 | 3300032039 | Soil | LLLGDNEVAEGSWTLKTLVDGSQQKFTEPELFDFLKHRRA |
Ga0318545_100083094 | 3300032042 | Soil | LILGDNEVSSGEWTVKTLADGTQQKLTEPQLLDFLRKL |
Ga0318533_103981531 | 3300032059 | Soil | YALILGEDEVASGLWTLKTLADGSQQKYAEAELLAFLRKACSSPRLP |
Ga0318533_109071721 | 3300032059 | Soil | YALILGEDEVASGLWTLKTLADGSQQKYAEAELLAFLRKACRSTRLP |
Ga0307470_100450973 | 3300032174 | Hardwood Forest Soil | SRYALILGDNEVSEGLWTLKTLAGGSQQKFTEPELLEYLRKQKALSS |
Ga0307471_1008940112 | 3300032180 | Hardwood Forest Soil | YALILGDNEVSEALWTLKTLADGTQQKLTEPDLLQFLRDQKPVSS |
Ga0335084_114230302 | 3300033004 | Soil | FALILGDNEVSSGEWTLKTLADGSQQKLTEPQLLDFLRRSKTL |
⦗Top⦘ |