Metagenome Family F061025

Basic Information
Family ID	F061025
Family Type	Metagenome
Number of Sequences	132
Average Sequence Length	43 residues
Representative Sequence	TYDWIVNAIGPFELTEYLGLALVWGALAVTAPFHAAGRPNPAAG
Number of Associated Samples	105
Number of Associated Scaffolds	132

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.82 %
% of genes near scaffold ends (potentially truncated)	87.88 %
% of genes from short scaffolds (< 2000 bps)	90.15 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.49

Most Common Taxonomy
Group	Bacteria (89.394 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (13.636 % of family members)
Environment Ontology (ENVO)	Unclassified (27.273 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (42.424 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 132 Family Scaffolds
PF02872	5_nucleotid_C	5.30
PF12146	Hydrolase_4	4.55
PF13380	CoA_binding_2	4.55
PF02668	TauD	3.03
PF12543	DUF3738	2.27
PF00582	Usp	1.52
PF03551	PadR	1.52
PF00069	Pkinase	1.52
PF07355	GRDB	1.52
PF00198	2-oxoacid_dh	1.52
PF01925	TauE	0.76
PF06441	EHN	0.76
PF00092	VWA	0.76
PF05368	NmrA	0.76
PF01734	Patatin	0.76
PF01979	Amidohydro_1	0.76
PF00903	Glyoxalase	0.76
PF02922	CBM_48	0.76
PF02633	Creatininase	0.76
PF07992	Pyr_redox_2	0.76
PF13620	CarboxypepD_reg	0.76
PF01609	DDE_Tnp_1	0.76
PF02371	Transposase_20	0.76
PF13177	DNA_pol3_delta2	0.76
PF00144	Beta-lactamase	0.76
PF12852	Cupin_6	0.76
PF13673	Acetyltransf_10	0.76
PF07589	PEP-CTERM	0.76
PF07676	PD40	0.76
PF13424	TPR_12	0.76
PF13451	zf-trcl	0.76
PF07883	Cupin_2	0.76
PF12697	Abhydrolase_6	0.76
PF07690	MFS_1	0.76
PF01432	Peptidase_M3	0.76
PF01988	VIT1	0.76
PF13557	Phenol_MetA_deg	0.76
PF01425	Amidase	0.76
PF03786	UxuA	0.76
PF00561	Abhydrolase_1	0.76

COG ID	Name	Functional Category	% Frequency in 132 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	6.06
COG0737	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family	Defense mechanisms [V]	5.30
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	3.03
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	1.52
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	1.52
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	1.52
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	1.52
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.76
COG0339	Zn-dependent oligopeptidase, M3 family	Posttranslational modification, protein turnover, chaperones [O]	0.76
COG0596	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold	Coenzyme transport and metabolism [H]	0.76
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.76
COG1164	Oligoendopeptidase F	Amino acid transport and metabolism [E]	0.76
COG1312	D-mannonate dehydratase	Carbohydrate transport and metabolism [G]	0.76
COG1402	Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)	Coenzyme transport and metabolism [H]	0.76
COG1633	Rubrerythrin, includes spore coat protein YhjR	Inorganic ion transport and metabolism [P]	0.76
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.76
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.76
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.76
COG1814	Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family	Inorganic ion transport and metabolism [P]	0.76
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.76
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.76
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.76
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.76
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.76
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.76
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.76
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.76
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.76
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.39 %
Unclassified	root	N/A	10.61 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.39 %
Unclassified	root	N/A	10.61 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	89.39 %
Unclassified	root	N/A	10.61 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	36.36 %
Unclassified	root	N/A	10.61 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	9.09 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	4.55 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3.79 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.76 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	28.03 %
Unclassified	root	N/A	10.61 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.79 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.03 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2.27 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.27 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.52 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.52 %
candidate division Zixibacteria	phylum	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria	0.76 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	28.03 %
Unclassified	root	N/A	10.61 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2.27 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.52 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	1.52 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.52 %
Ignavibacteriae	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae	0.76 %
Candidatus Angelobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter	0.76 %
unclassified candidate division Zixibacteria	no rank	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria	0.76 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.76 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.76 %
Anaerolineae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae	0.76 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	28.03 %
Unclassified	root	N/A	10.61 %
Azospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae	2.27 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.52 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	1.52 %
unclassified Anaerolineae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae	0.76 %
unclassified Candidatus Angelobacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter	0.76 %
candidate division Zixibacteria bacterium RBG_16_53_22	species	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22	0.76 %
Ignavibacteria	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria	0.76 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.76 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.76 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.76 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.76 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	28.03 %
Unclassified	root	N/A	10.61 %
Azospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum	2.27 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.52 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.76 %
Candidatus Sulfopaludibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter	0.76 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.76 %
Ignavibacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales	0.76 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.76 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.76 %
Sorangiineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae	0.76 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.76 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.76 %
candidate division Zixibacteria bacterium RBG_16_53_22	species	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22	0.76 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	28.03 %
Unclassified	root	N/A	10.61 %
unclassified Azospirillum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum	2.27 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.52 %
Ignavibacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae	0.76 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.76 %
unclassified Candidatus Sulfopaludibacter	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter	0.76 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.76 %
Polyangiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae	0.76 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.76 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.76 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.76 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.76 %
candidate division Zixibacteria bacterium RBG_16_53_22	species	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22	0.76 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	28.03 %
Unclassified	root	N/A	10.61 %
Azospirillum sp. B4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4	2.27 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.52 %
unclassified Ignavibacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → unclassified Ignavibacteriaceae	0.76 %
Candidatus Sulfopaludibacter sp. SbA3	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	0.76 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.76 %
unclassified Polyangiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae	0.76 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.76 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.76 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.76 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.76 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.76 %
candidate division Zixibacteria bacterium RBG_16_53_22	species	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22	0.76 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	28.03 %
Unclassified	root	N/A	10.61 %
Azospirillum sp. B4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4	2.27 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1.52 %
Polyangiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	0.76 %
Ignavibacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → unclassified Ignavibacteriaceae → Ignavibacteriaceae bacterium	0.76 %
Candidatus Sulfopaludibacter sp. SbA3	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	0.76 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.76 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.76 %
Mycobacterium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	0.76 %
Candidatus Angelobacter sp. Gp1-AA117	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	0.76 %
Anaerolineae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	0.76 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.76 %
candidate division Zixibacteria bacterium RBG_16_53_22	species	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22	0.76 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.76 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.76 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004157\|Ga0062590_100208950	All Organisms → cellular organisms → Bacteria	1421	Open in IMG/M
3300004480\|Ga0062592_102555001	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300004643\|Ga0062591_101017837	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	790	Open in IMG/M
3300005166\|Ga0066674_10049207	All Organisms → cellular organisms → Bacteria	1899	Open in IMG/M
3300005328\|Ga0070676_10906357	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300005332\|Ga0066388_106320408	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300005337\|Ga0070682_101169661	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300005340\|Ga0070689_100442906	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1104	Open in IMG/M
3300005340\|Ga0070689_101278412	Not Available	660	Open in IMG/M
3300005343\|Ga0070687_101508979	All Organisms → cellular organisms → Bacteria → Acidobacteria	505	Open in IMG/M
3300005367\|Ga0070667_100734302	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300005439\|Ga0070711_101300207	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	631	Open in IMG/M
3300005577\|Ga0068857_101143324	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	753	Open in IMG/M
3300005577\|Ga0068857_101590888	Not Available	638	Open in IMG/M
3300005713\|Ga0066905_101654743	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	587	Open in IMG/M
3300005764\|Ga0066903_100674060	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117	1815	Open in IMG/M
3300005764\|Ga0066903_102484794	Not Available	1003	Open in IMG/M
3300005764\|Ga0066903_104052712	All Organisms → cellular organisms → Bacteria → Proteobacteria	785	Open in IMG/M
3300005764\|Ga0066903_106544933	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	607	Open in IMG/M
3300005764\|Ga0066903_107511483	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	562	Open in IMG/M
3300006034\|Ga0066656_10434290	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	853	Open in IMG/M
3300006046\|Ga0066652_100091394	All Organisms → cellular organisms → Bacteria	2431	Open in IMG/M
3300006046\|Ga0066652_101991448	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	518	Open in IMG/M
3300006049\|Ga0075417_10508449	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300006196\|Ga0075422_10340115	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	652	Open in IMG/M
3300006358\|Ga0068871_102171260	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300006804\|Ga0079221_11074281	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	613	Open in IMG/M
3300006844\|Ga0075428_100713615	All Organisms → cellular organisms → Bacteria	1068	Open in IMG/M
3300006846\|Ga0075430_100433963	All Organisms → cellular organisms → Bacteria	1084	Open in IMG/M
3300006847\|Ga0075431_101792847	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	570	Open in IMG/M
3300006871\|Ga0075434_100851681	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300006871\|Ga0075434_102352024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4	535	Open in IMG/M
3300006881\|Ga0068865_100716548	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3	856	Open in IMG/M
3300006903\|Ga0075426_10417088	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	992	Open in IMG/M
3300006904\|Ga0075424_100412419	All Organisms → cellular organisms → Bacteria	1441	Open in IMG/M
3300006904\|Ga0075424_102244207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4	574	Open in IMG/M
3300006969\|Ga0075419_10109503	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1781	Open in IMG/M
3300007004\|Ga0079218_10075543	All Organisms → cellular organisms → Bacteria → Acidobacteria	2214	Open in IMG/M
3300007004\|Ga0079218_13993263	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	501	Open in IMG/M
3300009094\|Ga0111539_12542755	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300009100\|Ga0075418_10241209	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1925	Open in IMG/M
3300009100\|Ga0075418_12745462	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	538	Open in IMG/M
3300009101\|Ga0105247_10021077	All Organisms → cellular organisms → Bacteria	3921	Open in IMG/M
3300009156\|Ga0111538_10719944	All Organisms → cellular organisms → Bacteria	1264	Open in IMG/M
3300009156\|Ga0111538_10997475	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1060	Open in IMG/M
3300009156\|Ga0111538_11022072	All Organisms → cellular organisms → Bacteria	1046	Open in IMG/M
3300009551\|Ga0105238_10720953	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1010	Open in IMG/M
3300009553\|Ga0105249_11383231	All Organisms → cellular organisms → Bacteria	776	Open in IMG/M
3300009553\|Ga0105249_12580411	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	580	Open in IMG/M
3300009553\|Ga0105249_12843372	Not Available	555	Open in IMG/M
3300009609\|Ga0105347_1120108	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300009803\|Ga0105065_1040708	Not Available	630	Open in IMG/M
3300010047\|Ga0126382_10074982	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	2090	Open in IMG/M
3300010361\|Ga0126378_10488419	Not Available	1346	Open in IMG/M
3300010361\|Ga0126378_11046790	All Organisms → cellular organisms → Bacteria	919	Open in IMG/M
3300010362\|Ga0126377_11040075	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → unclassified Ignavibacteriaceae → Ignavibacteriaceae bacterium	886	Open in IMG/M
3300010362\|Ga0126377_11442031	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	762	Open in IMG/M
3300010366\|Ga0126379_10593455	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1192	Open in IMG/M
3300010366\|Ga0126379_12797692	Not Available	584	Open in IMG/M
3300010397\|Ga0134124_10282886	All Organisms → cellular organisms → Bacteria	1539	Open in IMG/M
3300010397\|Ga0134124_10372759	All Organisms → cellular organisms → Bacteria	1351	Open in IMG/M
3300010398\|Ga0126383_10952815	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	946	Open in IMG/M
3300010400\|Ga0134122_10745754	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300010413\|Ga0136851_11426208	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	667	Open in IMG/M
3300011422\|Ga0137425_1141694	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	597	Open in IMG/M
3300011425\|Ga0137441_1067972	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	829	Open in IMG/M
3300012209\|Ga0137379_10312610	Not Available	1482	Open in IMG/M
3300012469\|Ga0150984_118192118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	563	Open in IMG/M
3300012901\|Ga0157288_10146265	All Organisms → cellular organisms → Bacteria	700	Open in IMG/M
3300012908\|Ga0157286_10448474	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300012912\|Ga0157306_10059765	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	988	Open in IMG/M
3300012931\|Ga0153915_10003368	All Organisms → cellular organisms → Bacteria	14673	Open in IMG/M
3300012971\|Ga0126369_13632104	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	505	Open in IMG/M
3300013296\|Ga0157374_12263254	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	571	Open in IMG/M
3300013297\|Ga0157378_12309316	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	589	Open in IMG/M
3300014308\|Ga0075354_1072222	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300014308\|Ga0075354_1153741	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	526	Open in IMG/M
3300015262\|Ga0182007_10307297	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300015371\|Ga0132258_10611266	All Organisms → cellular organisms → Bacteria	2737	Open in IMG/M
3300015373\|Ga0132257_102028408	Not Available	742	Open in IMG/M
3300015373\|Ga0132257_102029365	All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium RBG_16_53_22	742	Open in IMG/M
3300015373\|Ga0132257_103835703	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	547	Open in IMG/M
3300015374\|Ga0132255_102247734	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium	832	Open in IMG/M
3300016422\|Ga0182039_11410767	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300017994\|Ga0187822_10041962	Not Available	1260	Open in IMG/M
3300018056\|Ga0184623_10281818	All Organisms → cellular organisms → Bacteria → Proteobacteria	754	Open in IMG/M
3300018083\|Ga0184628_10061707	All Organisms → cellular organisms → Bacteria	1899	Open in IMG/M
3300018089\|Ga0187774_10706441	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300021082\|Ga0210380_10022169	All Organisms → cellular organisms → Bacteria	2696	Open in IMG/M
3300021560\|Ga0126371_13381159	Not Available	539	Open in IMG/M
3300023062\|Ga0247791_1090015	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300024187\|Ga0247672_1054645	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300025535\|Ga0207423_1001889	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2967	Open in IMG/M
3300025911\|Ga0207654_10445030	All Organisms → cellular organisms → Bacteria → Acidobacteria	908	Open in IMG/M
3300025912\|Ga0207707_11333426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	575	Open in IMG/M
3300025925\|Ga0207650_11316204	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300025925\|Ga0207650_11553271	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	562	Open in IMG/M
3300025933\|Ga0207706_10301772	All Organisms → cellular organisms → Bacteria	1395	Open in IMG/M
3300025933\|Ga0207706_10332461	All Organisms → cellular organisms → Bacteria	1322	Open in IMG/M
3300025936\|Ga0207670_10147309	All Organisms → cellular organisms → Bacteria → Acidobacteria	1743	Open in IMG/M
3300025937\|Ga0207669_11684831	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300025941\|Ga0207711_10272817	All Organisms → cellular organisms → Bacteria	1556	Open in IMG/M
3300025942\|Ga0207689_10599927	All Organisms → cellular organisms → Bacteria → Acidobacteria	926	Open in IMG/M
3300025945\|Ga0207679_10143207	All Organisms → cellular organisms → Bacteria	1935	Open in IMG/M
3300026016\|Ga0208779_1012537	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	744	Open in IMG/M
3300026116\|Ga0207674_11704389	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300027909\|Ga0209382_12178234	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	525	Open in IMG/M
3300028592\|Ga0247822_10108615	All Organisms → cellular organisms → Bacteria	2006	Open in IMG/M
3300031544\|Ga0318534_10525609	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	675	Open in IMG/M
3300031545\|Ga0318541_10183998	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1154	Open in IMG/M
3300031545\|Ga0318541_10451673	All Organisms → cellular organisms → Bacteria → Proteobacteria	719	Open in IMG/M
3300031547\|Ga0310887_10033579	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2171	Open in IMG/M
3300031548\|Ga0307408_102358517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → unclassified Azospirillum → Azospirillum sp. B4	516	Open in IMG/M
3300031573\|Ga0310915_10868156	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300031716\|Ga0310813_11529382	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	622	Open in IMG/M
3300031748\|Ga0318492_10382583	All Organisms → cellular organisms → Bacteria → Proteobacteria	739	Open in IMG/M
3300031852\|Ga0307410_11280509	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300031858\|Ga0310892_10881407	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	625	Open in IMG/M
3300031890\|Ga0306925_11732188	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300031897\|Ga0318520_11010818	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	525	Open in IMG/M
3300031912\|Ga0306921_10787942	All Organisms → cellular organisms → Bacteria → Proteobacteria	1086	Open in IMG/M
3300031912\|Ga0306921_11374516	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	778	Open in IMG/M
3300031995\|Ga0307409_100377556	Not Available	1346	Open in IMG/M
3300032013\|Ga0310906_10934943	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	620	Open in IMG/M
3300032017\|Ga0310899_10024296	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2000	Open in IMG/M
3300032075\|Ga0310890_10496997	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300032075\|Ga0310890_10963218	All Organisms → cellular organisms → Bacteria → Acidobacteria	684	Open in IMG/M
3300032179\|Ga0310889_10781071	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300033412\|Ga0310810_10186916	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	2359	Open in IMG/M
3300033513\|Ga0316628_101211484	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1005	Open in IMG/M
3300034115\|Ga0364945_0109358	Not Available	813	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	61.36%
Host-Associated	Host-Associated	38.64%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.03%
Plants	Host-Associated → Plants	38.64%
Aquatic	Environmental → Aquatic	8.33%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.30%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.58%
Sediment	Environmental → Aquatic → Sediment	4.55%
Freshwater	Environmental → Aquatic → Freshwater	2.27%
Marine	Environmental → Aquatic → Marine	1.52%
Floodplain	Environmental → Terrestrial → Floodplain	0.76%
Roots	Host-Associated → Plants → Roots	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.48%
Loam	Environmental → Terrestrial → Soil → Loam	10.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.82%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.55%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.79%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.79%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.52%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.52%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.76%
Sand	Environmental → Terrestrial → Soil → Sand	0.76%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.76%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.48%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.39%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.82%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.06%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.30%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.30%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.30%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.55%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.03%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.52%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.76%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.76%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.76%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.76%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.76%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.76%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	13.64%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.30%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.03%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.03%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.27%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.27%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.27%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.27%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.27%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.27%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.27%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.52%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.52%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.52%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.76%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.76%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.76%
Mangrove Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment	0.76%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.76%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.76%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.76%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.76%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.76%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.76%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009803	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010413	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9	Environmental	Open in IMG/M
3300011422	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2	Environmental	Open in IMG/M
3300011425	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300023062	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4	Environmental	Open in IMG/M
3300024187	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13	Environmental	Open in IMG/M
3300025535	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)	Environmental	Open in IMG/M
3300025615	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026016	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.49
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.49
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F061025

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062590_1002089501	3300004157	Soil	KVVNAIGPFELTEYLGLALVWFALAITVPVRAAQRSLRTAL*
Ga0062592_1025550011	3300004480	Soil	MALVSAMRYDWIVNAIGPFELTEYLGLALVVGALAATAPFLAAARPLRPTA*
Ga0062591_1010178371	3300004643	Soil	VSAMTYDWTVNAIGPFELTEYLGLAIVYGSLAVTAPFLAARRPVRFAG*
Ga0066674_100492071	3300005166	Soil	SAMTYDWTVNAIGPFELSEYLGLAMICGALAVTAPFLAADCRSYAGS*
Ga0070676_109063571	3300005328	Miscanthus Rhizosphere	VNAIGPFELTEYLGLAIVWGALALTAPFVLMGRRVRTTA*
Ga0066388_1063204081	3300005332	Tropical Forest Soil	TVNAIGPFELTEYLGLVMVWVALAITAPFRAAARPVPATG*
Ga0070682_1011696612	3300005337	Corn Rhizosphere	YDRTVNAIGPFELTEYLGLALVIVALAITVPARVAPRSIQTTA*
Ga0070689_1004429061	3300005340	Switchgrass Rhizosphere	DWIVNAIGPFELTEYLGLALVYSALAITAPFLAGERPLRLTDTKALC*
Ga0070689_1012784121	3300005340	Switchgrass Rhizosphere	IAFVSAMTYDRTVNAIGPFELSEYLGLAVIYGALAVTAPSLAGRLHGSHRLSN*
Ga0070687_1015089792	3300005343	Switchgrass Rhizosphere	MALVSAMRYDWIVNAIGPFELTEYLGLALVLGALAVTAPFVTAARPVRRTA*
Ga0070667_1007343022	3300005367	Switchgrass Rhizosphere	VNAIGPFELTEYLGLALVYSALAITAPFLAGERPLRLTDTKALC*
Ga0070711_1013002072	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	TYDKTVNAIGPFELTEYLGLALVWAALAVTAPFRAAPQPVPATS*
Ga0068857_1011433242	3300005577	Corn Rhizosphere	LVSAIRYDWIVNAIGPFELTEYLGLALIWAALAIAVPLRAAERPVPSIA*
Ga0068857_1015908883	3300005577	Corn Rhizosphere	MTYDRTVNAIGPFELTEYLGLALVWFALVITVPVRAATRPIRTAA*
Ga0066905_1016547432	3300005713	Tropical Forest Soil	KLVNAIGPFELTEYLGLALVWLAFAITVPLRAAPRSVPTAA*
Ga0066903_1006740602	3300005764	Tropical Forest Soil	YDWIVNAIGPFELSEYFGLVMIYGALAITAPFLAAGRSNQLTV*
Ga0066903_1024847942	3300005764	Tropical Forest Soil	VNAIGPFELTEYVGLVLVWGALAVTAPFRAAARAVPGMG*
Ga0066903_1040527123	3300005764	Tropical Forest Soil	AIGPFELTEYLGLVMAWGSLAVTAPFRAGERPVRVASRQL*
Ga0066903_1065449331	3300005764	Tropical Forest Soil	SAIRYDWIVNAIGPFEVTEYLGLVLIWGALAITAPFGGGGQPVRSTA*
Ga0066903_1075114831	3300005764	Tropical Forest Soil	NAIGPFELTEYLGLAMIWGGLAITAPFGAAGQPVRSTA*
Ga0066656_104342902	3300006034	Soil	DRTVNAIGLFELSEYLGLAMIYGALAITTPFHAAPRPVQVTGGEVPT*
Ga0066652_1000913945	3300006046	Soil	LVSAMTYDWTVNAIGPFELSEYLGLAMICGALAVTAPFLAADCRGGL*
Ga0066652_1019914481	3300006046	Soil	AMRYDWIVNAIGPFEITEYLGLVAVWGALAVTAPFLAAERALR*
Ga0075417_105084492	3300006049	Populus Rhizosphere	VSAMTYDWIVNAIGPFELTEYLGLAIVWGALAVTAPFVLMGRTVRTTG*
Ga0075422_103401151	3300006196	Populus Rhizosphere	IGPFELTEYLGLALVWLALAIAVPLRAAPRTIRTAA*
Ga0068871_1021712601	3300006358	Miscanthus Rhizosphere	PFEMTEYLGLALVWGALAITAPFRSEGRPVPVASAPRTMS*
Ga0079221_110742812	3300006804	Agricultural Soil	YDRTVNAIGPFELTEYLGLALVWGALAITARFRAAGRPVPTIS*
Ga0075428_1007136153	3300006844	Populus Rhizosphere	SAMRYDWSMNAIGPFELTEYIGLATVWAALAVTAPFLAAGRPVGRSAEV*
Ga0075430_1004339632	3300006846	Populus Rhizosphere	MAYDWTVGAIGPFELSEYLGLAIIWGALAVTAPFRAVERPLRAAG*
Ga0075431_1017928471	3300006847	Populus Rhizosphere	YDWIVNAIGPFELSEYLGLVLVYIALALTTPFIAVRERVRSAA*
Ga0075434_1008516811	3300006871	Populus Rhizosphere	AMRMDWIVNAIGPFEITEYVGVGLLCISFAMTAPFFEARPAGR*
Ga0075434_1023520241	3300006871	Populus Rhizosphere	YDKLVNAIGPFELTEYLGLALVWGAFVITAPFRSAARPIPATS*
Ga0068865_1007165481	3300006881	Miscanthus Rhizosphere	IVNAIGPFELTEYLGLALVLGALAVTAPFVAATRPVRRTA*
Ga0075426_104170882	3300006903	Populus Rhizosphere	WIVNAIGPFELTEYLGLGLIYVALALTAPFAATRRPVPSTA*
Ga0075424_1004124193	3300006904	Populus Rhizosphere	SAMTYDWVVNAIGPFELTEYLGLAIVWGALAVTAPFVLMRRTVRTTG*
Ga0075424_1022442071	3300006904	Populus Rhizosphere	VNAIGPFELTEYLGLALVWAAFGITAPVRIATRRLAAAG*
Ga0075419_101095031	3300006969	Populus Rhizosphere	RTVNAIGPFELTEYLGLALVWLALAIAVPLRAAPRTIRTAA*
Ga0079218_100755431	3300007004	Agricultural Soil	GAIGPFELTEYVGLAMIWGALAVTAPFRAAARSVRATGTTSHAG*
Ga0079218_139932632	3300007004	Agricultural Soil	AMTYDWIVSAIGPFELTEYLGLAIVWGALAVTVPFRPAGRPVRSTG*
Ga0111539_125427552	3300009094	Populus Rhizosphere	VNAIGPFELTEYVGLAIVWGALAVTAPFVPMGRTVRTPG*
Ga0075418_102412092	3300009100	Populus Rhizosphere	MTYDRTVNAIGPFELSEYLGLALVYVALAITVPLRAAPRSIQTAA*
Ga0075418_127454621	3300009100	Populus Rhizosphere	AIGPFELTEYLGLALIWGALAVTAPFRAAARPVSATG*
Ga0105247_100210771	3300009101	Switchgrass Rhizosphere	TYDKTVNAIGPFELTEYLGLVMVWGALAVTAPFRAAGPPVPATV*
Ga0111538_107199442	3300009156	Populus Rhizosphere	DRTVNAIGPFELTEYLGLALVWLALAIAVPLRAAPRTIRTAA*
Ga0111538_109974752	3300009156	Populus Rhizosphere	YDKVVNAIGPFELTEYLGLALVWFALAITVPVRAAQRSLRTAL*
Ga0111538_110220722	3300009156	Populus Rhizosphere	MAYDWTVGAIGPFELSEYLGLAIIWGALAVTAPLRAVERPLRAAG*
Ga0105238_107209531	3300009551	Corn Rhizosphere	AIGPFELTEYLGLAMVWGALAATAPFRAAGPPVRATV*
Ga0105249_113832311	3300009553	Switchgrass Rhizosphere	NAIGPFELTEYLGLALVWGALAATAPFRTARRPVPAAG*
Ga0105249_125804111	3300009553	Switchgrass Rhizosphere	AFVSERTYDWTVGAVGPFELTEYLGLVLIWGALAVTAQFGAVGRSVRPSG*
Ga0105249_128433721	3300009553	Switchgrass Rhizosphere	VTEYVGLVAVWGALAVTAPFLARERPLQRTGAHAPV*
Ga0105347_11201082	3300009609	Soil	ASAMRYDWIVNAIGPFELSEYLGLVIVYIALAVTAPFLRAERPVRSAA*
Ga0105065_10407081	3300009803	Groundwater Sand	MTYDKTVNAIGPFELSEYLGLALVWGALAVTAPFRAAERPVRSAG*
Ga0126382_100749821	3300010047	Tropical Forest Soil	VNAIGPFELTEYVGLAITYAALVVTAPFLTPGRPVRSPI*
Ga0126378_104884191	3300010361	Tropical Forest Soil	AIGPFELTEYLGLAAVWGALALTAPFLAKGQLVRS*
Ga0126378_110467901	3300010361	Tropical Forest Soil	MVNAIGPFELTEYVGLAAVWGALTVTAPFLATEKHVR*
Ga0126377_110400752	3300010362	Tropical Forest Soil	YDRVVNAIGPFEMTEYLGLAIVWGACAVTAPFRAAAPPAPDALRASQVR*
Ga0126377_114420313	3300010362	Tropical Forest Soil	VKAIGPFELTEYLGLLLVCGALAITAPFLAARRPLQRAG*
Ga0126379_105934551	3300010366	Tropical Forest Soil	PFELTEYLGLALVFGALAITGPFRTAEPVERAMV*
Ga0126379_127976921	3300010366	Tropical Forest Soil	WIVKAIGPFELTEYLGLALVYGALAITTPFVAGGRLKRAAS*
Ga0134124_102828861	3300010397	Terrestrial Soil	IGPFELTEYLGLALVWGALAVTAPFRAAARPVPVPRITGG*
Ga0134124_103727592	3300010397	Terrestrial Soil	YDKMVNAIGPFELTEYLGLALVWLALAVTAPFRAAVQTVPGVG*
Ga0126383_109528151	3300010398	Tropical Forest Soil	SAMRYDWIVNAIGPFELTEYIGLVMVYAALAVTAPFIAANQPIQSTV*
Ga0134122_107457542	3300010400	Terrestrial Soil	SAITYDKTVHAIEPFELTEYLGLAMVWGALAATAPFRAAGPPVRATV*
Ga0136851_114262081	3300010413	Mangrove Sediment	WTMSAIGPFELTEYLGLAGIYLALVVTTPFLAARRTG*
Ga0137425_11416941	3300011422	Soil	MTYDWTVGAIGPFELTEYLGLALTWGALALTAPFRAK
Ga0137441_10679723	3300011425	Soil	IGPFELTEYLGLALIWGALAVTAPFRAMERPVRATG*
Ga0137379_103126101	3300012209	Vadose Zone Soil	IGPFELSEYLGLALVWGALAVTAPFLAAGRPDPAAG*
Ga0150984_1181921182	3300012469	Avena Fatua Rhizosphere	TAIGPFELTEYLGLALVWGALAITAPFRAAPRPMPATS*
Ga0157288_101462651	3300012901	Soil	IGPFELTEYLGLALVWGALAVTAPFRAAGRQVAAAG*
Ga0157286_104484741	3300012908	Soil	IGPFELTEYLGLAMVWGALAATAPFRAAAPPLRATV*
Ga0157306_100597651	3300012912	Soil	YDWIVNAIGPFEVSEYLGLALTYGALAATAPFLSAERRVRLVAP*
Ga0153915_100033687	3300012931	Freshwater Wetlands	MKRLTEYLGLVLVWGALAVTAPFLGPERPLQATA*
Ga0126369_136321042	3300012971	Tropical Forest Soil	SAMRYDWMVNAIGPFELTEYLGLAAVWGALAITAPFLASGRPLRREL*
Ga0157374_122632541	3300013296	Miscanthus Rhizosphere	TMVSAMRYDWIVNAIGPFELTEYLGLALVYGALAIKVPFLADGRPLLRTG*
Ga0157378_123093162	3300013297	Miscanthus Rhizosphere	RYDWNVNAIGPFELTEYLGLAAVWAALVVTTPFAAGRPVGRMG*
Ga0075354_10722221	3300014308	Natural And Restored Wetlands	TITLVAAMTYDWTANAIGPFELSEYLGLAVTYGALAVTAPFLTAGRPVRA*
Ga0075354_11537411	3300014308	Natural And Restored Wetlands	YDRTVNAIGPFELSEYLGLVLVWGALAVTAPFLAAGRPRRPTT*
Ga0182007_103072971	3300015262	Rhizosphere	DKTVHAIGPFELTEYLGLLMVWAAFAITAPIRRIAGAVPATA*
Ga0132258_106112661	3300015371	Arabidopsis Rhizosphere	TYDWIVNAIGPFELTEYLGLALVWGALAVTAPFHAAGRPNPAAG*
Ga0132257_1020284081	3300015373	Arabidopsis Rhizosphere	MTYDRTVNAIGPFELSEYLGLAVIYAALVVTAPFLAAGRKGGRVG*
Ga0132257_1020293652	3300015373	Arabidopsis Rhizosphere	VAAMTYDWNVNAIGPFELTEYLGLAMIWGALAITAPFRAAGRPVQSMA*
Ga0132257_1038357031	3300015373	Arabidopsis Rhizosphere	VSAMTYDSTVGAIGPFELTEYLGLALIWGALALTAPFRAAGRPVPSPRL*
Ga0132255_1022477341	3300015374	Arabidopsis Rhizosphere	AMRYDWIVNAIGPFELTEYLGLAIVCGALALTAPFLAAKQPLQRAG*
Ga0182039_114107671	3300016422	Soil	MAYDWTVNAIGPFELSEYIGLAMIYAALAATAPSGAAGRPVRTAG
Ga0187822_100419622	3300017994	Freshwater Sediment	IGPLEWTEYLGLALVWGALAVMAPLKASERPVQSAG
Ga0184623_102818182	3300018056	Groundwater Sediment	MTYDRAVNAIGPFELSDYLGLVAVCGALAVTAPFRAVGHRASIR
Ga0184628_100617073	3300018083	Groundwater Sediment	MRYDWIVNAIGPFERSEYLGLALICGALAATAPFLLAERRIRSTA
Ga0187774_107064412	3300018089	Tropical Peatland	AIGPFEMTEYLGLVLIYAALALTAPSLAAGLPVSAERGTV
Ga0210380_100221693	3300021082	Groundwater Sediment	MRYDWIVNAIGPFERPEYLGLALVYGALAATAPFLLAERRIRSTA
Ga0126371_133811592	3300021560	Tropical Forest Soil	DRIANAIGPFEWSEYVGIGAIYFALAITAPFVTAGRQIHSTA
Ga0247791_10900151	3300023062	Soil	SAMTYDWIVNAIGPFELTEYVGLALVWGALAVTAPFVPMGRAVRTAG
Ga0247672_10546451	3300024187	Soil	VSAITMDRMVNAIGPFEVTEYLGLAFIWGAFAITAPFRLVPEGVPATES
Ga0207423_10018893	3300025535	Natural And Restored Wetlands	VALVSAMRMDWIVKAIGPFELTEYLGLGLIYLALAITAPFAAPRRPVPSAA
Ga0210086_10647525	3300025615	Natural And Restored Wetlands	IVNAIGPFELSEYLGLAIVYFALAVTAPFLVEGRHQGG
Ga0207654_104450301	3300025911	Corn Rhizosphere	YDWMVNAIGPFELTEYLGLVLVYGALAITAPFLAAGRPLQQTG
Ga0207707_113334261	3300025912	Corn Rhizosphere	IGPFELTEYLGLALVCIALVITVPGRAAPRAMQTAA
Ga0207650_113162041	3300025925	Switchgrass Rhizosphere	YDKVVNAIGPFELTEYLGLALVCIALVITVPGRAAPRAMQTAA
Ga0207650_115532712	3300025925	Switchgrass Rhizosphere	LVSAMRYDWIVNAIGPFELTEYLGLALVLGALAVTAPFVAAARPVRRTA
Ga0207706_103017722	3300025933	Corn Rhizosphere	MTYDRTVNAIGPFELSEYLGLAVIYAALVVTAPFPAAGRRGVRAA
Ga0207706_103324613	3300025933	Corn Rhizosphere	LVSAMTYDWIVNALGPFELTEYLGLAIVWGALAATRPFVLTGRQVRTTG
Ga0207670_101473091	3300025936	Switchgrass Rhizosphere	LVSAMRYDWIVNAIGPFELTEYLGLALVYSALAITAPFLAGERPLRLTDTKALC
Ga0207669_116848312	3300025937	Miscanthus Rhizosphere	NAVGVFEMTEYLGIGLVYLALAVTAPFLAAERQVTRHIN
Ga0207711_102728171	3300025941	Switchgrass Rhizosphere	AMIYDRSVNAIGPFELSEYLGLAMVFVALALTMPFIATRRAIATVS
Ga0207689_105999272	3300025942	Miscanthus Rhizosphere	MRYDWIVNAIGPFELTEYVGLALVYVALAITVPFLADGRPILRTG
Ga0207679_101432071	3300025945	Corn Rhizosphere	GPFELTEYLGLVLVWGALAVTAPFRPAGRPVPAAG
Ga0208779_10125372	3300026016	Natural And Restored Wetlands	VSAMRMDWIVKAIGPFELTEYLGLGLIYLALAITAPFAAPRRPVPSAA
Ga0207674_117043893	3300026116	Corn Rhizosphere	MTYDRTVNAIGPFELTEYLGLALVWFALVITVPVRAATRPIRTAA
Ga0209382_121782342	3300027909	Populus Rhizosphere	TVNAIGPFELTEYLGLALVWTALAITAPFIAARSPVQSTG
Ga0247822_101086151	3300028592	Soil	DWTVGAIGPFELTEYLGLALIWGALALTAPFRAAGRPVPSPG
Ga0318534_105256091	3300031544	Soil	DWAVNAIGPFELTEYLGLAMIWGGLAITAPFGAAGQPVRATA
Ga0318541_101839981	3300031545	Soil	DWTVNAIGPFELTEYLGLGLIWGALAVAAPFRGVDRPVRSMA
Ga0318541_104516732	3300031545	Soil	AMAYDWTVNAIGPFELSEYIGLAMIYAALAATAPSGAAGRPVRTAG
Ga0310887_100335791	3300031547	Soil	ALGSAMRYDWIVNAIGPFELSEYLGLVIVYTALAVTAPFLRAEWQVRSAA
Ga0307408_1023585171	3300031548	Rhizosphere	SAMTYDRMVNAIGLFELSEYLGLALVYGALAITLPFLRASESPPAATDHA
Ga0310915_108681562	3300031573	Soil	YDKTVNAIGPFELSEYVGLVLVWGALALAAPPLTAEKTVRPTS
Ga0310813_115293822	3300031716	Soil	TYDKTVNAIGPFELTEYLGLALVLAALAITAPFSTSARPVPHTS
Ga0318492_103825831	3300031748	Soil	AYDWTVNAIGPFELSEYIGLAMIYAALAATAPSGAAGRPVRTAG
Ga0307410_112805092	3300031852	Rhizosphere	IVNAIGPFELTEYLGLVIVWGALAVTAPFAPSGRTVRTTG
Ga0310892_108814071	3300031858	Soil	VSAIGPFELTEYLGLALIWGALAVTAPFRAAGRPVPSPG
Ga0306925_117321881	3300031890	Soil	AMAYDRTVNAIGPFELSEYLGLAMVYGALAMTAPLAARKRQARTAA
Ga0318520_110108181	3300031897	Soil	YDWIVNAIGPFELSEYLGLVLIWASLAVTAPFLAPRRLLHATG
Ga0306921_107879421	3300031912	Soil	SAMAYDWTVNAIGPFELSEYIGLAMIYAALAATAPSGAAGRPVRTAG
Ga0306921_113745163	3300031912	Soil	GPFELTEYLGLALVFGALAMTAPFRPAGRPVRVAG
Ga0307409_1003775561	3300031995	Rhizosphere	ALVSAMSYDWIVNAIGPFELTEYLGLALVWGALAVTAPFRSAPRAREALTR
Ga0310906_109349432	3300032013	Soil	TYDWTVNAIGPFELTEYLGLAMVWGALAVTAPFRVAARPVAATR
Ga0310899_100242961	3300032017	Soil	VSAMTYDWIVNAIGPFELTEYLGLVIVWGALAATAPFVVGRTIRTTG
Ga0310890_104969973	3300032075	Soil	AIGPFELTEYLGLALVWGALAVTAPFRAAGRQVPAAG
Ga0310890_109632182	3300032075	Soil	MMYDRTVNAIGPFELTEYLGLALVWLALAITVPLRAAPRSIGAAA
Ga0310889_107810712	3300032179	Soil	IGPFELTEYLGLAMVWGALAVTAPFRAMGPPVRATA
Ga0310810_101869161	3300033412	Soil	NTITMVSAMRYDWIVNAIGPFELTEYLGLALVYGALAITTPFFADGRPLRQTG
Ga0316628_1012114842	3300033513	Soil	AMRMDWIVNAIGPFELTEYLGLGLIYLALALTAPFAAARRPVPSTA
Ga0364945_0109358_687_812	3300034115	Sediment	KMVHAIGPFELTEYLGLVLVWGALAVTAPFRAAGRPVPAAG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign