NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061147

Metagenome / Metatranscriptome Family F061147

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061147
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 43 residues
Representative Sequence MNSPTRATTTPSNSLPAQLEQIGLHALAAEVDDFLARATKQRWSP
Number of Associated Samples 114
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.24 %
% of genes near scaffold ends (potentially truncated) 99.24 %
% of genes from short scaffolds (< 2000 bps) 93.94 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.242 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(9.848 % of family members)
Environment Ontology (ENVO) Unclassified
(18.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.667 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.51%    β-sheet: 0.00%    Coil/Unstructured: 68.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00665rve 14.39
PF13408Zn_ribbon_recom 0.76
PF13414TPR_11 0.76
PF01695IstB_IS21 0.76
PF13565HTH_32 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 14.39
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 14.39
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 14.39
COG4584TransposaseMobilome: prophages, transposons [X] 14.39
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.24 %
UnclassifiedrootN/A0.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002568|C688J35102_117904452All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300003541|JGI20214J51650_10294787All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300004479|Ga0062595_101006706All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300004780|Ga0062378_10088468All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300005175|Ga0066673_10613472All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005180|Ga0066685_10718541All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005335|Ga0070666_10919400All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005355|Ga0070671_101202962All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005434|Ga0070709_11155792All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005446|Ga0066686_10539110All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300005529|Ga0070741_11263735All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005548|Ga0070665_100938159All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005568|Ga0066703_10777143All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005764|Ga0066903_102205375All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300005764|Ga0066903_108150439All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005764|Ga0066903_109160010All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005878|Ga0075297_1024029All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005883|Ga0075299_1001076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Myxococcus1423Open in IMG/M
3300006057|Ga0075026_100137967All Organisms → cellular organisms → Bacteria → Proteobacteria1243Open in IMG/M
3300006162|Ga0075030_100233457All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300006174|Ga0075014_100762295All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006572|Ga0074051_11236966All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300006794|Ga0066658_10524608All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300006797|Ga0066659_10564639All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300012961|Ga0164302_11426735All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300014499|Ga0182012_10636899All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300016357|Ga0182032_11639179All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300016371|Ga0182034_12049850All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300016404|Ga0182037_10452787All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300017659|Ga0134083_10144998All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300017946|Ga0187879_10503276All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300017970|Ga0187783_11378934All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300018034|Ga0187863_10903525All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018040|Ga0187862_10323233All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300018044|Ga0187890_10037805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2911Open in IMG/M
3300018057|Ga0187858_10068578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2483Open in IMG/M
3300018057|Ga0187858_10402495All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300018062|Ga0187784_10345514All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300018062|Ga0187784_11455297All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018431|Ga0066655_10284350All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300018468|Ga0066662_10551148All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300018468|Ga0066662_11957019All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300019270|Ga0181512_1453890All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300019361|Ga0173482_10295294All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300020083|Ga0194111_10413868All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300020583|Ga0210401_11555372All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300021090|Ga0210377_10519439All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300021297|Ga0210369_1089757All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300021374|Ga0213881_10229124All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300021420|Ga0210394_10301428All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300021478|Ga0210402_10770967All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300021560|Ga0126371_12318283All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300021860|Ga0213851_1545501All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300022213|Ga0224500_10395612All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300024295|Ga0224556_1187684All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300025161|Ga0209381_1095400All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300025898|Ga0207692_11216047All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300025916|Ga0207663_10958554All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300025920|Ga0207649_10803670All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300025937|Ga0207669_11462372All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300025941|Ga0207711_12137653All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025944|Ga0207661_10558789All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300026035|Ga0207703_11358719All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300026078|Ga0207702_11149193All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300026095|Ga0207676_11341473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium711Open in IMG/M
3300026278|Ga0209018_1095276Not Available576Open in IMG/M
3300026301|Ga0209238_1026863All Organisms → cellular organisms → Bacteria → Acidobacteria2157Open in IMG/M
3300026309|Ga0209055_1137912All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300026317|Ga0209154_1200459All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300026927|Ga0207744_1007939All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300027034|Ga0209730_1016950All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300027039|Ga0207855_1028888All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300027812|Ga0209656_10272157All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300027910|Ga0209583_10297049All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300028379|Ga0268266_10857200All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300028743|Ga0302262_10209732All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300028806|Ga0302221_10403566All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300028863|Ga0302218_10208674All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300028870|Ga0302254_10349976All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300028906|Ga0308309_10552266All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300029913|Ga0311362_10222959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2108Open in IMG/M
3300029922|Ga0311363_11047796All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300029939|Ga0311328_10467768All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300029939|Ga0311328_10807217All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300029953|Ga0311343_10978835All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300029954|Ga0311331_10085213All Organisms → cellular organisms → Bacteria → Proteobacteria4127Open in IMG/M
3300029954|Ga0311331_11016303All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300029954|Ga0311331_11065210All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300029999|Ga0311339_10467087All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300030002|Ga0311350_11718472All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300030011|Ga0302270_10469607All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300030503|Ga0311370_11014277All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300030507|Ga0302192_10042957All Organisms → cellular organisms → Bacteria → Acidobacteria2371Open in IMG/M
3300030617|Ga0311356_11782462All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300030688|Ga0311345_11296813All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031234|Ga0302325_10737136All Organisms → cellular organisms → Bacteria1408Open in IMG/M
3300031236|Ga0302324_101477399All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300031344|Ga0265316_10559155All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300031524|Ga0302320_11965562All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300031525|Ga0302326_10468118All Organisms → cellular organisms → Bacteria1924Open in IMG/M
3300031525|Ga0302326_12346098All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300031715|Ga0307476_11329927All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031753|Ga0307477_10644822All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300031805|Ga0318497_10822677All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300031894|Ga0318522_10335228All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031897|Ga0318520_10735544All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031897|Ga0318520_10839343All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031897|Ga0318520_11049679All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300031910|Ga0306923_12052800All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031945|Ga0310913_11156134All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300031996|Ga0308176_11239944All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300032001|Ga0306922_10944192All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300032025|Ga0318507_10312559All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300032044|Ga0318558_10644933All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300032053|Ga0315284_11017924All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300032060|Ga0318505_10587943All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300032160|Ga0311301_10697082All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300032770|Ga0335085_10201297All Organisms → cellular organisms → Bacteria2438Open in IMG/M
3300032770|Ga0335085_11472660All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300032770|Ga0335085_11557826All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300032783|Ga0335079_11108183All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300032783|Ga0335079_11434548All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300032783|Ga0335079_11978507All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300032892|Ga0335081_10114590All Organisms → cellular organisms → Bacteria3961Open in IMG/M
3300032892|Ga0335081_11322789All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300032892|Ga0335081_12729035All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032897|Ga0335071_11764034All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032954|Ga0335083_10324742All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300032954|Ga0335083_11394769All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300033402|Ga0326728_10330104All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300033483|Ga0316629_11447263All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300034199|Ga0370514_124219All Organisms → cellular organisms → Bacteria662Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.09%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog8.33%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.03%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.03%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.03%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.52%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.52%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.76%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.76%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.76%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.76%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.76%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.76%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.76%
Anoxygenic And Chlorotrophic Microbial MatEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat0.76%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.76%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.76%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.76%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.76%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005883Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021297Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.669 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025161Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026278Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant BLVA 2012 (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026927Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes)EnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027039Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J35102_11790445223300002568SoilMSSPIRATTTPNNSLPAQLEQIGLHALAAGVDDFLARATKQRWSPRQILEHLA
JGI20214J51650_1029478723300003541WetlandMSSPATMTTTSLMNSLAAQLQQIGLRALPAGLDDFLARATKSR
Ga0062595_10100670623300004479SoilMNSPIRATTTQINSLPAQLEQIGLHTLAAGVDDFLARATKQRWSPRQILE
Ga0062378_1008846823300004780Wetland SedimentMSSPIRATTTPSNSLPAQLEQIGLHAVAAEVDDFLARATKQRWS
Ga0066673_1061347223300005175SoilMNSPTRATTTTPSNSLPAQLEQIGLHTLATEVNDFLARATKQRW
Ga0066685_1071854113300005180SoilMNSPTRATTTTPSNSLPAQLEQIGLHALGTEVNDFLARAIKQRWSPRQVLEHL
Ga0070666_1091940023300005335Switchgrass RhizosphereMSSPALKTTTPTPNNSLPAQLQQIGLRALPAQLDDFLARAAKARWSPH
Ga0070671_10120296213300005355Switchgrass RhizosphereMNSPTRATTTPSNSLPVQLEQVGLHAVASGVDDFLARATKQRWSP
Ga0070709_1115579213300005434Corn, Switchgrass And Miscanthus RhizosphereMNSPATMTMTTIPMNNLPAQLQQLGLRALPVELDDFLARATKARWSPRV
Ga0066686_1053911013300005446SoilMNSPATMTMTPMISLAAQLQQIGLCALPAELDDFLARATKARWSPRV
Ga0070741_1126373523300005529Surface SoilMNSPTRTTTNPSNSLPAQLEQIGLHALASEVDDFLARA
Ga0070665_10093815923300005548Switchgrass RhizosphereMSSPIPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATK
Ga0066703_1077714313300005568SoilMNSRTRTTTTPSNSLAAQLEQIGLHALAGEVDDFLARATKQRW
Ga0066903_10220537523300005764Tropical Forest SoilMMSSPIPKTTTPISLSAQLEHIGLCALPQQLDDFLARATKARWSPHQI
Ga0066903_10815043923300005764Tropical Forest SoilMNSPTSTTTTPRSSLPAQLEQIGLHALATEVDDFLARATKQRWS
Ga0066903_10916001013300005764Tropical Forest SoilMNSPTPMTMTPRNDLPAQLEQIGLRALPAELDDFLARA
Ga0075297_102402923300005878Rice Paddy SoilMSSPTPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATKQRWSPR
Ga0075299_100107613300005883Rice Paddy SoilMSSPTPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATKQRWSPRQMLERL
Ga0075026_10013796723300006057WatershedsMNSPTRVTTTPSNNLPAQLEQIGLHALATEVDDFLARATKQRWSPRQTLE
Ga0075030_10023345713300006162WatershedsMNSPAIKTTTIPRNSLPAQLQQIGLRAVPAQLDDFLAR
Ga0075014_10076229513300006174WatershedsMTSPNPPSSSLSLLLQQIGLRALPAQLDDFLARAAKA
Ga0074051_1123696613300006572SoilMNSPTRATTTPSNSLPAQLEQIGLHTLAAEVNDFLARATKQRWSPRQIL
Ga0066658_1052460813300006794SoilMNSPIRATTTTTPSNSLPAQLEQIGLHALAAEIDDFLARATKQRWSPRQIL
Ga0066659_1056463923300006797SoilMNSRTRTTTTPSNSLAAQLEQIGLHALAGEVDDFLARATKQRWSPRQILEHLVQ
Ga0164302_1142673523300012961SoilMSSPTRATTTPSNSLPAQLEQIGLHALAAGMDDFLTRATRQRWSPRQILEHLAQ
Ga0182012_1063689923300014499BogMNTTAPLVKTPSSSLSAQLRLIGLRAVPADLDDFLTRATKSRWSPQQLIEHLV
Ga0182032_1163917913300016357SoilMSSPAPKTTTIPSNSLLAQLEQIGLRALPAQLDDFLARAAKS
Ga0182034_1204985013300016371SoilMNLPITATTIPTNSLPAQLQQIGLRSLPANLDDFLAHATKAR
Ga0182037_1045278723300016404SoilMSSPIRATMTPSNNLPAQLEQIGLHAVAAEVDDFLARATKQRWSPRQMLEH
Ga0134083_1014499823300017659Grasslands SoilMNSPTRTTTTPSNSLPAQLEQIGLHTVAAGVDDFL
Ga0187879_1050327623300017946PeatlandMSSPATTIHPMNNLTAQLKQIGLRAVAADLDDFLARAT
Ga0187783_1137893423300017970Tropical PeatlandMNSPVPNAKNPNNLAALLQQIGLRSLPSELDDFLARAVKARWSP
Ga0187863_1090352513300018034PeatlandMNSPTRATTTPSSSLPAQLEQIGLHALATEMDDFLARATKQRW
Ga0187862_1032323313300018040PeatlandMNSPTRVTTTPSNSLPAQLEQIGLHALATEVDDFLAR
Ga0187890_1003780513300018044PeatlandMSSPTLPTTTPNNNLPAQLQQLGLRALPAQLDDFLARAS
Ga0187858_1006857843300018057PeatlandMNSPAPTTTIPSNSLPAQLQQIGLRALPAELDDFLARATKARWSP
Ga0187858_1040249523300018057PeatlandMSSPIRATTTPSNSLPAQLEQIGLHAVAAEVDDFLARA
Ga0187784_1034551413300018062Tropical PeatlandMNSPTPKTTTPNSNSLLTQLAQIGLRALPGELDDF
Ga0187784_1145529713300018062Tropical PeatlandMNSRTRTMTTPSSSLPAQLEQIGLHALAGELDDFLARA
Ga0066655_1028435013300018431Grasslands SoilMSSPTRATTTPSNSLPAQLEQIGLHALGATMDDFLARATKQR
Ga0066662_1055114813300018468Grasslands SoilMNSPAPKTTTPNSSLSAQLQQIGLRALPAHLDDFVAHA
Ga0066662_1195701923300018468Grasslands SoilMNSPSKTTTRNDLTAQLQQIGLRPLPQNLDDFLAR
Ga0181512_145389023300019270PeatlandMNSPTRVTTTTPSNSLPAQLEQIGLHALASEVDDFLTRATKLRWSP
Ga0173482_1029529423300019361SoilMNSPTRATTTPSNSLPAQLEQIGLHALAAEVNDFLARATKQRWSPRQ
Ga0194111_1041386813300020083Freshwater LakeMSSPARTMTMPSHSLPAQLEQIGLRAVPGELDDFLARAAKLRWSP
Ga0210401_1155537213300020583SoilMNSPATMTVTMTPGNSLSAQLRQIGLRAIPADLDDFLARATKNRWSPQQ
Ga0210377_1051943923300021090Groundwater SedimentMSSPTRTTTPINSLAVQLQQIGLRAVPVELDDFLA
Ga0210369_108975723300021297EstuarineMNSRTRTTTTPSHSLAALLEQIGLHALAGEVDDFVARATKQRW
Ga0213881_1022912413300021374Exposed RockMNSPTPLTMSPRNELPAQLEQIGLRALPAELDDFL
Ga0210394_1030142813300021420SoilMNSPTRATTTPSNNLPAQLEQIGLHALATEVDDFLARATKQRWSPRQTLEHLAQT
Ga0210402_1077096723300021478SoilMNSPTRATTTPSNSLPAQLEQIGLHALATEVDDFLARATKQRWSPRQTLEHLAQT
Ga0126371_1231828323300021560Tropical Forest SoilMNLPVTETTIPTNSLAAQLQQIGLRSLPANLDDFVA
Ga0213851_154550113300021860WatershedsMNSPTLRTTTIPSNSLPSQLQQLGLRALPAQLDDF
Ga0224500_1039561223300022213SedimentMNSPAPMTTTMMNPANSLPANLTQIGLRALPGQLDDFLARATKARWS
Ga0224556_118768423300024295SoilMNSPATTTMTTTPSNSLPAQLRQIGLCAIPADLDDFLARATKNR
Ga0209381_109540023300025161Hot Spring SedimentMNSRTRTTTAPSPSLQAQLAQIGLDAVAAELDDFLARATKQRWSPRQ
Ga0207692_1121604723300025898Corn, Switchgrass And Miscanthus RhizosphereMNSPASNTTILSNSLSTQLQQIGLRALPAGLDDFLARATKAR
Ga0207663_1095855413300025916Corn, Switchgrass And Miscanthus RhizosphereMSSPTLKTTTPSNNLPAQLQQIGLHALPAQLDDFL
Ga0207649_1080367013300025920Corn RhizosphereMNSPVPNAKNPNNLAALLQQIGLRSLPSELDDFLARAV
Ga0207669_1146237223300025937Miscanthus RhizosphereMNSPTRATTTPSNSLPAQLEQIGLHTLAAEVNDFLARATKQRWSPR
Ga0207711_1213765313300025941Switchgrass RhizosphereMNSPTRATTTPNNSLPAQLEQIGLHALAAGMDDFLARAIKQRWSP
Ga0207661_1055878923300025944Corn RhizosphereMSSPTRATTTPSNSLPAQLEQIGLHALAAGVDDFLA
Ga0207703_1135871923300026035Switchgrass RhizosphereMNSPASNTMIPSHSLSAQLQQIGLRALPAGLDDFLARATKA
Ga0207702_1114919323300026078Corn RhizosphereMNSPTRATTTPSNSLPVQLEQVGLHAVASGVDDFLARATKQR
Ga0207676_1134147313300026095Switchgrass RhizosphereMNSPAPRTTTQSNSLPAQLQQIGLRALPAELDDFLARAAKS
Ga0209018_109527623300026278Anoxygenic And Chlorotrophic Microbial MatMNSRTHTTTAPSPSLQAQLAQIGLDAVAAELDDFLARATKQRWSP
Ga0209238_102686333300026301Grasslands SoilMNSPSKTTTKNDLTAQLQQIGLRALPENLDDFLARASKAR
Ga0209055_113791213300026309SoilMNSPTRATTTPSNSLPAQLEQIGLHALASEVDDFL
Ga0209154_120045923300026317SoilMNSPSKTTTKNDLTAQLQQIGLRALPENLDDFLAR
Ga0207744_100793913300026927Tropical Forest SoilMSSPTRTTTNPSNSLPAQLEQIGLHALASEVDDFLARATKQRWSPRQI
Ga0209730_101695013300027034Forest SoilMNSASKTTTKNDLPAQLQQIGLRALPENLDDFLAR
Ga0207855_102888813300027039Tropical Forest SoilMSSPIRTTTTPSNSLPAQLEQIGLHAVAGEVDDFL
Ga0209656_1027215723300027812Bog Forest SoilMRSPAVKTTIPSNSLLSQLQQIGLRALPSGLDDFL
Ga0209583_1029704913300027910WatershedsMPLPALKTATTTHSNSLASQLQQIGLRALPTQLDDFLAHAIK
Ga0268266_1085720023300028379Switchgrass RhizosphereMSSPIPTTTTLSNSLPAQLEQIGLHVVAGELDDFLARATKQRW
Ga0302262_1020973223300028743FenMPSPAPATTTNPMSSLAAQLQQIGLRAVPAELDDFLARAIKARWSPRV
Ga0302221_1040356613300028806PalsaMSSPVTTKTPTNNLPQLLQQIGLRALPSNLDDFLARA
Ga0302218_1020867423300028863PalsaMTPSNSLSSQLRQIGLCAIPADLDDFLARAAKNRWSPQQLIEQLV
Ga0302254_1034997613300028870FenMPSPAPATTTNPMSSLAAQLQQIGLRAVPAELDDFLARAIK
Ga0308309_1055226613300028906SoilMNSPTLKTTTLSNSLPTQLQQIGLRSLPAQLDDFLAH
Ga0311362_1022295913300029913BogMTTTPSNSLSSQLRQIGMCAIPADLDDFLARATKNRWSPQQLI
Ga0311363_1104779623300029922FenMTPSNSLSSQLRQIGLCAIPADLDDFLARATKNRWSPQQ
Ga0311328_1046776823300029939BogMNSAARMTMTPGNSLAAQLRQIGLRAIPADLDDFLARATKHRWSPQQL
Ga0311328_1080721723300029939BogMNSPATTTPNNSLSAQLRQIGLRAIPADLDDFLTRATKNRWSPQQLIE
Ga0311343_1097883523300029953BogMRSPATTTHPMNNLVAQLEQIGLRALPANLDDFLARATRAHWSPLM
Ga0311331_1008521313300029954BogMTPSNSLSSQLRQIGLCAIPADLDDFLARATKNRWSP
Ga0311331_1101630313300029954BogMNSPATTTMTTTPSNSLSSQLRQIGMCAIPADLDDFLARAT
Ga0311331_1106521013300029954BogMNSPVTVTTTPSNSLSAQLRQIGLRAIPADLDDFLARATKNRWS
Ga0311339_1046708723300029999PalsaMNSSAPKTTTPSHSLSAQLQQIGLRALPAQLDDFI
Ga0311350_1171847223300030002FenMPLPALKTMTTTTHSNSLASQLEQIGLRALPAQLDDFLAHA
Ga0302270_1046960723300030011BogMSSPATTNHPRNSLAAQMEQIGLRALAANLDDFLARATRSHWSPLML
Ga0311370_1101427723300030503PalsaMSSPVTTKTPTNNLPQLLQQIGLRALPSNLDDFLARAIRGRWSPHT
Ga0302192_1004295733300030507BogMMNSPATTTPSNSLSAQLRQIGLQAIPADLDDFLARATKNR
Ga0311356_1178246213300030617PalsaMNSLASKTTTRNNLAAQLQQIGLCAVPQNLDDFLARGTKARWSL
Ga0311345_1129681313300030688BogMNSPITMPMTTTPSNSLSAQLRQIGLRALPADLDDFVARATK
Ga0302325_1073713613300031234PalsaMNSPAANAKNPNNLAVLLQQIGLRSLPSELDDFLARAVKARWS
Ga0302324_10147739923300031236PalsaMNSPVTVTTTPSNSLSAQLRQIGLRAIPADLDDVLARATKNRWS
Ga0265316_1055915523300031344RhizosphereMNSPTRATTTPSNSLPAQLEQIGLHALAAEVDDFLARATKQRWSP
Ga0302320_1196556213300031524BogMNSPATTMTTPGNNLSAQLRQIGLRAIPADLDDFLTRATKN
Ga0302326_1046811833300031525PalsaMNSPAMTTPSNSLSGQLRQIGLRAIPADLDDFLARATKS
Ga0302326_1234609813300031525PalsaMINTPAPQTTTTPTNNLPDQLRQIGLRALPAQLDD
Ga0307476_1132992713300031715Hardwood Forest SoilMNSPAPKTTTPNHSLAAQLQQIGMRALPAQLDDFIARATKARWSPH
Ga0307477_1064482223300031753Hardwood Forest SoilMSSPARKTTTPTNSLPAQLQQIGLCALPMQLDDFL
Ga0318497_1082267713300031805SoilMSSPIRATMTPSNSLPAQLEQIGLHAVAAEVDDFLARATKQR
Ga0318522_1033522823300031894SoilMNLPVTTTTIPTNSLAAQLQQIGLRSLPANLDDFLARA
Ga0318520_1073554423300031897SoilMTSPVTMMTPMSSLATQLRQIGLRALPANLDDFLARAIKA
Ga0318520_1083934323300031897SoilMSSPIRATMTPSNNLPAQLEQIGLHAVAAEVDDFLARATKQRWSPRQML
Ga0318520_1104967923300031897SoilMSSHATANVPVNNLAAQLAQIGLRSLPDQLDDFLARAVKAR
Ga0306923_1205280023300031910SoilMNSRTRTTTTPSNSLPAQLEQIGLHALAGELDDFLARATKQRWSSRQVL
Ga0310913_1115613413300031945SoilMSSPTAKTTTPNSNSLLTQLQQIGLRALPAELDDFLARAAKARWSPL
Ga0308176_1123994413300031996SoilMNLPTRAMTTPSNSLPAQLEQIGLHAMASEVDDFLARAAKQ
Ga0306922_1094419223300032001SoilMNSPSKTTTKNDLTAQLQQIGLWALPQNLDDFLARASKARW
Ga0318507_1031255923300032025SoilMTSPVTTMSPMNSLVTQLRQIGLRALPANLDDFLARAIKTRWSPHQL
Ga0318558_1064493313300032044SoilMNSPVPAKSPTNNLSQLLQQIGLRALPANLDDFLARAMKGHWSP
Ga0315284_1101792413300032053SedimentMNSPATKNTTTPKNNLPVQLQQLGLRALPAQLDDFLARAIK
Ga0318505_1058794313300032060SoilMSSPIRATMTPSNSLPAQLEQIGLHAVAAEVDDFLARATKQRWSPRQM
Ga0311301_1069708213300032160Peatlands SoilMNSPTRVTTTPSNSLPAQLEQIGLHALATEVDDFLARATK
Ga0335085_1020129743300032770SoilMNSPTRATTTPSHSLPAQLEQIGLHALAADVDDFLSRATKQRWSPRQILEHLAQTEA
Ga0335085_1147266013300032770SoilMNSPAPTMTMPSHSLPAQLEQIGLRAVPTELDDFLARATKLRWSPRQ
Ga0335085_1155782613300032770SoilMTSPIVKTTQTTITNPSPSLIDQLQQIGLRSLPAQLDDFLARAAK
Ga0335079_1110818323300032783SoilMNSPAPTMTTPSNSLPAQLEQIGLHALAGELDDFLAR
Ga0335079_1143454813300032783SoilMSSPARTMTMSSHSLPAQLEQIGLRAVPAELDDFLARATKQ
Ga0335079_1197850723300032783SoilMNSPVTATTITNNLPAQLQQIGLRSLPANLDDFLARATKARWP
Ga0335081_1011459013300032892SoilMSSPTLKTTAMTTPNPSLTAQLAQIGLRSLPSQLDDFLARAAKARWSALQI
Ga0335081_1132278923300032892SoilMSSPTPTTTTPSNSLPAQLQQIGLHVVAGELDDFLAR
Ga0335081_1272903523300032892SoilMNSPTPTTTTLSNSLPVQLEQIGLHALAGELDDFLAR
Ga0335071_1176403423300032897SoilMNSPTPTMTTPSNSLPAQLEQIGLHALAGELDDFLSRAIKQHWSPRQVLEHL
Ga0335083_1032474213300032954SoilMNSPTPTTTTLSNSLPVQLEQIGLHALAGELDDFLARAAKQRWSP
Ga0335083_1139476923300032954SoilMNSPTRSMTPNNSLPTELEQIGLHAVAAELDDFLSRATKQRWSPRQILEHLAQTEAAERA
Ga0326728_1033010413300033402Peat SoilMSSPTTMTTTSPMNSLATQLQQIGLRAVPAGLDDFLARATKSRW
Ga0316629_1144726313300033483SoilMNSRTRTTTTPSNSLPAQLEQIGLHALAGELNDFLA
Ga0370514_124219_2_1393300034199Untreated Peat SoilMNSPAPEKPTIPTSNLPDQLRQIGLRALPAQLDDFLARATKARWSP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.