NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061274

Metagenome Family F061274

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061274
Family Type Metagenome
Number of Sequences 132
Average Sequence Length 74 residues
Representative Sequence MSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGW
Number of Associated Samples 109
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 95.45 %
% of genes near scaffold ends (potentially truncated) 99.24 %
% of genes from short scaffolds (< 2000 bps) 96.21 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (85.606 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(28.030 % of family members)
Environment Ontology (ENVO) Unclassified
(86.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.636 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.67%    β-sheet: 24.00%    Coil/Unstructured: 61.33%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF13443HTH_26 2.27
PF01381HTH_3 0.76



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A85.61 %
All OrganismsrootAll Organisms14.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001450|JGI24006J15134_10129801Not Available856Open in IMG/M
3300005239|Ga0073579_1110615Not Available619Open in IMG/M
3300005931|Ga0075119_1044015Not Available1150Open in IMG/M
3300006027|Ga0075462_10136135Not Available754Open in IMG/M
3300006029|Ga0075466_1114951Not Available718Open in IMG/M
3300006164|Ga0075441_10249764Not Available653Open in IMG/M
3300006193|Ga0075445_10259217Not Available594Open in IMG/M
3300006193|Ga0075445_10280612Not Available566Open in IMG/M
3300006352|Ga0075448_10220440Not Available578Open in IMG/M
3300006737|Ga0098037_1109077Not Available953Open in IMG/M
3300006749|Ga0098042_1028181All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1611Open in IMG/M
3300006802|Ga0070749_10039568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2902Open in IMG/M
3300006802|Ga0070749_10154643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1332Open in IMG/M
3300006802|Ga0070749_10653186Not Available564Open in IMG/M
3300006810|Ga0070754_10115513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1312Open in IMG/M
3300006810|Ga0070754_10148292Not Available1123Open in IMG/M
3300006810|Ga0070754_10252251Not Available805Open in IMG/M
3300006867|Ga0075476_10070343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1381Open in IMG/M
3300006916|Ga0070750_10222778Not Available827Open in IMG/M
3300006919|Ga0070746_10206339Not Available934Open in IMG/M
3300006924|Ga0098051_1186556Not Available544Open in IMG/M
3300006925|Ga0098050_1196674Not Available500Open in IMG/M
3300006947|Ga0075444_10156504Not Available951Open in IMG/M
3300007276|Ga0070747_1218401Not Available668Open in IMG/M
3300007276|Ga0070747_1326577Not Available525Open in IMG/M
3300007345|Ga0070752_1212753Not Available765Open in IMG/M
3300007542|Ga0099846_1092147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1121Open in IMG/M
3300007963|Ga0110931_1062172Not Available1127Open in IMG/M
3300009193|Ga0115551_1297104Not Available706Open in IMG/M
3300009420|Ga0114994_10672021Not Available677Open in IMG/M
3300009420|Ga0114994_10770322Not Available626Open in IMG/M
3300009445|Ga0115553_1233379Not Available724Open in IMG/M
3300009508|Ga0115567_10970196Not Available502Open in IMG/M
3300009604|Ga0114901_1198124Not Available583Open in IMG/M
3300009705|Ga0115000_10598814Not Available687Open in IMG/M
3300009706|Ga0115002_10498359Not Available886Open in IMG/M
3300009785|Ga0115001_10141240Not Available1571Open in IMG/M
3300009786|Ga0114999_10403596Not Available1075Open in IMG/M
3300009786|Ga0114999_10602260Not Available834Open in IMG/M
3300009786|Ga0114999_10929155Not Available634Open in IMG/M
3300010150|Ga0098056_1273354Not Available558Open in IMG/M
3300010368|Ga0129324_10103185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1228Open in IMG/M
3300010883|Ga0133547_11943898Not Available1080Open in IMG/M
3300011252|Ga0151674_1049353Not Available517Open in IMG/M
3300012953|Ga0163179_11478366Not Available610Open in IMG/M
3300017708|Ga0181369_1064819Not Available797Open in IMG/M
3300017708|Ga0181369_1106112Not Available581Open in IMG/M
3300017709|Ga0181387_1025475Not Available1155Open in IMG/M
3300017709|Ga0181387_1078993Not Available665Open in IMG/M
3300017713|Ga0181391_1066249Not Available836Open in IMG/M
3300017714|Ga0181412_1002027Not Available7448Open in IMG/M
3300017714|Ga0181412_1111613Not Available636Open in IMG/M
3300017714|Ga0181412_1155550Not Available513Open in IMG/M
3300017717|Ga0181404_1095109Not Available731Open in IMG/M
3300017719|Ga0181390_1057161Not Available1129Open in IMG/M
3300017719|Ga0181390_1062902Not Available1060Open in IMG/M
3300017725|Ga0181398_1021624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1600Open in IMG/M
3300017729|Ga0181396_1111367Not Available562Open in IMG/M
3300017731|Ga0181416_1054470Not Available945Open in IMG/M
3300017732|Ga0181415_1094006Not Available676Open in IMG/M
3300017733|Ga0181426_1114568Not Available542Open in IMG/M
3300017737|Ga0187218_1047212Not Available1078Open in IMG/M
3300017740|Ga0181418_1077352Not Available813Open in IMG/M
3300017741|Ga0181421_1193959Not Available520Open in IMG/M
3300017742|Ga0181399_1134465Not Available600Open in IMG/M
3300017748|Ga0181393_1116876Not Available678Open in IMG/M
3300017751|Ga0187219_1121189Not Available775Open in IMG/M
3300017752|Ga0181400_1087500Not Available925Open in IMG/M
3300017753|Ga0181407_1145107Not Available587Open in IMG/M
3300017755|Ga0181411_1106086Not Available827Open in IMG/M
3300017762|Ga0181422_1077783Not Available1048Open in IMG/M
3300017763|Ga0181410_1161019Not Available627Open in IMG/M
3300017763|Ga0181410_1182266Not Available581Open in IMG/M
3300017763|Ga0181410_1221671Not Available513Open in IMG/M
3300017765|Ga0181413_1087166Not Available953Open in IMG/M
3300017767|Ga0181406_1114685Not Available813Open in IMG/M
3300017768|Ga0187220_1157922Not Available685Open in IMG/M
3300017770|Ga0187217_1051057All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1440Open in IMG/M
3300017770|Ga0187217_1068585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1223Open in IMG/M
3300017771|Ga0181425_1184849Not Available657Open in IMG/M
3300017772|Ga0181430_1111298Not Available810Open in IMG/M
3300017781|Ga0181423_1005720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.5463Open in IMG/M
3300017782|Ga0181380_1055616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1410Open in IMG/M
3300017782|Ga0181380_1291857Not Available535Open in IMG/M
3300018421|Ga0181592_11058513Not Available520Open in IMG/M
3300020053|Ga0181595_10409981Not Available523Open in IMG/M
3300020438|Ga0211576_10260838Not Available908Open in IMG/M
3300020438|Ga0211576_10278826Not Available873Open in IMG/M
3300021425|Ga0213866_10399730Not Available671Open in IMG/M
3300021964|Ga0222719_10675875Not Available587Open in IMG/M
3300022057|Ga0212025_1069191Not Available609Open in IMG/M
3300022069|Ga0212026_1050195Not Available629Open in IMG/M
3300022853|Ga0222652_1011829Not Available1671Open in IMG/M
3300022921|Ga0255765_1082413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1733Open in IMG/M
3300022937|Ga0255770_10410222Not Available586Open in IMG/M
3300023243|Ga0222630_1064952Not Available698Open in IMG/M
(restricted) 3300024255|Ga0233438_10354644Not Available546Open in IMG/M
3300025052|Ga0207906_1052530Not Available544Open in IMG/M
3300025071|Ga0207896_1019490Not Available1180Open in IMG/M
3300025086|Ga0208157_1131899Not Available569Open in IMG/M
3300025099|Ga0208669_1046250Not Available1008Open in IMG/M
3300025108|Ga0208793_1145914Not Available629Open in IMG/M
3300025128|Ga0208919_1055028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1355Open in IMG/M
3300025137|Ga0209336_10151407Not Available613Open in IMG/M
3300025138|Ga0209634_1255126Not Available632Open in IMG/M
3300025138|Ga0209634_1286137Not Available575Open in IMG/M
3300025168|Ga0209337_1126906Not Available1141Open in IMG/M
3300025168|Ga0209337_1166061Not Available937Open in IMG/M
3300025425|Ga0208646_1000552Not Available23017Open in IMG/M
3300025601|Ga0208768_1132303Not Available688Open in IMG/M
3300025603|Ga0208414_1054627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1121Open in IMG/M
3300025695|Ga0209653_1136511Not Available739Open in IMG/M
3300025803|Ga0208425_1063037Not Available907Open in IMG/M
3300025810|Ga0208543_1033056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1298Open in IMG/M
3300025840|Ga0208917_1116770Not Available958Open in IMG/M
3300025853|Ga0208645_1045184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2143Open in IMG/M
3300025897|Ga0209425_10177073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1161Open in IMG/M
3300027714|Ga0209815_1242274Not Available546Open in IMG/M
3300027779|Ga0209709_10389216Not Available556Open in IMG/M
3300027839|Ga0209403_10125196Not Available1644Open in IMG/M
3300027839|Ga0209403_10513993Not Available603Open in IMG/M
3300027844|Ga0209501_10484163Not Available713Open in IMG/M
3300027844|Ga0209501_10690959Not Available552Open in IMG/M
3300028197|Ga0257110_1214069Not Available738Open in IMG/M
3300031142|Ga0308022_1083836Not Available963Open in IMG/M
3300031519|Ga0307488_10202609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1343Open in IMG/M
3300031655|Ga0308018_10050756Not Available1510Open in IMG/M
3300031659|Ga0307986_10436988Not Available515Open in IMG/M
3300031766|Ga0315322_10552522Not Available745Open in IMG/M
3300031773|Ga0315332_10928503Not Available521Open in IMG/M
3300032011|Ga0315316_11560834Not Available517Open in IMG/M
3300033742|Ga0314858_028447Not Available1277Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater28.03%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.76%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.91%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.06%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.03%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.27%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.27%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.27%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake2.27%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.52%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.52%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.76%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.76%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.76%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.76%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.76%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.76%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.76%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.76%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.76%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.76%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.76%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.76%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005931Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020053Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022853Saline water microbial communities from Ace Lake, Antarctica - #371EnvironmentalOpen in IMG/M
3300022921Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaGEnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300023243Saline water microbial communities from Ace Lake, Antarctica - #3EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300025052Marine viral communities from the Pacific Ocean - LP-37 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025425Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes)EnvironmentalOpen in IMG/M
3300025601Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 (SPAdes)EnvironmentalOpen in IMG/M
3300025603Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031142Marine microbial communities from water near the shore, Antarctic Ocean - #353EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031655Marine microbial communities from water near the shore, Antarctic Ocean - #282EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24006J15134_1012980133300001450MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPMA
Ga0073579_111061513300005239MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTIYDFSGWQEQTETYF
Ga0075119_104401553300005931Saline LakeMSRKLGDKGFDSYMNYQAFSSDMPVHQINQTQWYLKFEKGLPGFYLKTDDVFQQMPTSTFIVTA
Ga0075462_1013613533300006027AqueousMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPP
Ga0075466_111495113300006029AqueousMARKEGDKAYATYMHYQAFSSDMPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAF
Ga0075441_1024976433300006164MarineMSRKLGDKAYESYLHYQAFSSDMPVHQINDTQYYLKFEKNLPAFFWKVDDVFQQMPPGSFFQTAERSTLFDF
Ga0075445_1025921723300006193MarineMSRKLGDKAYESYLHYQAFSSDMPVHQINDTQYYLKFEKNLPAFFWKVDDVFQQMPPGSFFQT
Ga0075445_1028061213300006193MarineMGRKLGDKAYESYLNYQAFSSDMPVHQINQTNWYLKFEKNLPAFFIKADDVFQQMPPLSFFATVERYSLRPQTALFTFTGWKD
Ga0075448_1022044023300006352MarineMSRKLGDKAYESYLHYQAFSSDMPVHQINKTQYYLKFEKNLPAFFWKVDDVFQQMPPGSFFQTAERSTLFDFSGWKKQIEDYFNLTTEE
Ga0098037_110907713300006737MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAF
Ga0098042_102818113300006749MarineMTRKSGDTNYQTYIGYQAFSSDMPVHRINQSNWYLKFENNIPAFFIAADNVYRQMPPLAFFETAKRTTVFDMTGWKKQLEDYFNLTIE
Ga0070749_1003956873300006802AqueousMARKEGDKAYATYMHYQAFSSDMPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLA
Ga0070749_1015464353300006802AqueousMARKEGDKAYASYMHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTENYFNLTIEEIK
Ga0070749_1065318633300006802AqueousMSRKEGDKAYATYVHYQAFSSDEPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERS
Ga0070754_1011551353300006810AqueousMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTG
Ga0070754_1014829213300006810AqueousMARKEGDKAYASYLHYQAFSSDEPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAF
Ga0070754_1025225113300006810AqueousMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFA
Ga0075476_1007034313300006867AqueousMHYQAFSSDMPVHRINQTNWYLKFEDGLPAFFVRADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTENYFNLT
Ga0070750_1022277833300006916AqueousMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERS
Ga0070746_1020633913300006919AqueousMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTLYDFTGWQ
Ga0098051_118655613300006924MarineMTRKSGDINYETYVGYQAFSSDMPVHRINQSNWYLKFENKIPAFFIGVENVYRQMPPLAFFETAKRTTVFDMTGWKKQLED
Ga0098050_119667413300006925MarineMTRKNGDINFETYVGYQAFSSDMPVHRINKSNWYLKFEKNIPAFFIGVENVYRQMPPLAF
Ga0075444_1015650413300006947MarineMTRKPGDINFENYVGYQAFSSDMPVHRINKSNWYLKFEHNLPAFYIGVENVYRQMPPLAFFETADRSTVHDMTGW
Ga0070747_121840133300007276AqueousMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGWQEQTETYFKL
Ga0070747_132657713300007276AqueousMARKEGDKAYATYMHYQAFSSDMPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIY
Ga0070752_121275333300007345AqueousMARKEGDKAYATYMHYQAFSSDMPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFTTAERST
Ga0099846_109214753300007542AqueousMSRKPRDKNYSSYMHYQAFSSDMPVHRINQTNWYLKFEDGLPAFFVRADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTENYFNL
Ga0110931_106217253300007963MarineMSRKEGDKAYATYVHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFTTAERSTIFDFTGWQ
Ga0115551_129710433300009193Pelagic MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATA
Ga0114994_1067202113300009420MarineMSRKFGDKAYESYLNYQAFSSDMPVHRINQTNWYLKFEKNLPAFFIKADDVFQQMPPLSF
Ga0114994_1077032213300009420MarineMGRKLGDKAYESYLNYQAFSSDMPVHQINQTNWYLKFEKNLPAFFIKADDVFQQMPPLSFFAT
Ga0115553_123337913300009445Pelagic MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGWQEQTETYFK
Ga0115567_1097019623300009508Pelagic MarineMGRKLGDKSYVSYLHYQAFSSDCPVHQINQTNWYLKFEKNIPGFFIKTDDVFQQMPPL
Ga0114901_119812423300009604Deep OceanMTRKSGDINFETYVGYQAFSSDMPVHRINKSNWYLKFENNIPAFFIGVENVFRQMPPLAFFETADRTTVHDMTGWKQQ
Ga0115000_1059881433300009705MarineMSRKLGDKAYESYMHYQAFSSDMPVHRINQTQWYLKFERNLPAFFWKADDVFQQMPPLSFFATVERYSLRPQ
Ga0115002_1049835943300009706MarineVSRKLGDKAYESYLNYQAFSSDMPVHQINQTQWYLKFEKNLPAFFIKADDVFQQMPPLSFFATAERYSLRLQPSLYDF
Ga0115001_1014124063300009785MarineMSRKLGDKAYESYLNYQAFSSDMPVHQINQTQWYLKFEKDLPGFFHKTDDVFQQMPPLSFFATAERSTLFDFTGWQE
Ga0114999_1040359653300009786MarineMSRKFGDKAYESYMHYQAFSSDMPVHRINQTQWYIKFEKNLPAFFSKADDVFQQMPPLSFFATAERYSLRP
Ga0114999_1060226033300009786MarineMSRKLGDKAYESYLNYQAFSSDMPIHRINQTNWYLKFEKNLPAFFIKADDVFQQMPPLSFFATAERSTLFNFTGWREQIEDYFNLTIEEIKC
Ga0114999_1092915533300009786MarineMSRKFGDKAYESYMHYQAFSSDMPVHRINETQWYIKFEKNLPAFFSKADDVFQQMPPLSFFATAERYSLRP
Ga0098056_127335433300010150MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTT
Ga0129324_1010318553300010368Freshwater To Marine Saline GradientMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFSGWQEQTETYL
Ga0133547_1194389813300010883MarineMSRKLGDKAYESYMHYQAFSSDMPVHRINQTQWYLKFERNLPAFFWKADDVFQQMPPLSFFATVERYSLRQQIALFDFTGWEEQIQDYFNLTI
Ga0151674_104935313300011252MarineMSRKLGDKAYESYLHYQAFSSDMPVHRINQTHWYLKFEKDLPAFFMKADDVFQQMPP
Ga0163179_1147836623300012953SeawaterMTRKDGDINYKTYVGYQAFSSDMPVHRINQSNWYLKFENNIPAFFIGVDNVFRQMPPLAYFETADRTTV
Ga0181369_106481913300017708MarineMSRKEGDKAYATYVHYQALSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTI
Ga0181369_110611223300017708MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFATAPRSTMYDFTGWLEQTEKYFNL
Ga0181387_102547543300017709SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFSGWQEQTE
Ga0181387_107899323300017709SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFSG
Ga0181391_106624933300017713SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFTTAERSTLYDFTGWKEQTENYFNLTQEEILCQ
Ga0181412_1002027153300017714SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGWQE
Ga0181412_111161313300017714SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFAT
Ga0181412_115555023300017714SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWQEQTEKYFNLTIEE
Ga0181404_109510913300017717SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWQEQTEKYFNLTIEE
Ga0181390_105716143300017719SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAE
Ga0181390_106290213300017719SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTIYDFSGWQEQTETYFKLTIEE
Ga0181398_102162463300017725SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFSGW
Ga0181396_111136723300017729SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTIYDFTGWQEQTEK
Ga0181416_105447013300017731SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTIYDF
Ga0181415_109400633300017732SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFATAPRST
Ga0181426_111456823300017733SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAF
Ga0187218_104721243300017737SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWQEQTETYFKLTIEEI
Ga0181418_107735213300017740SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFATAPRSTMYV
Ga0181421_119395923300017741SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTLYDFTGWKEQ
Ga0181399_113446533300017742SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGW
Ga0181393_111687613300017748SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAF
Ga0187219_112118933300017751SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAE
Ga0181400_108750043300017752SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFATAPRSTMYDFTGWLEQTEKYFN
Ga0181407_114510713300017753SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFATAPRSTMYDFTGWLEQTEKYFNLTQEEIL
Ga0181411_110608613300017755SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWQEQTETY
Ga0181422_107778343300017762SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFSGWKEQTENYFNLTQEEIL
Ga0181410_116101933300017763SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPQSFFATAPRSTMYDFTGWLEQTE
Ga0181410_118226623300017763SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIY
Ga0181410_122167123300017763SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFINADDIYRQMPPLSFFATAPRS
Ga0181413_108716613300017765SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGWQEQTETYFKLTIEE
Ga0181406_111468513300017767SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDF
Ga0187220_115792213300017768SeawaterMTRKVGDKAYATYVGYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTIYDFTG
Ga0187217_105105713300017770SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTIYDFSGWQEQTETYFK
Ga0187217_106858553300017770SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWQEQTE
Ga0181425_118484933300017771SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTLFDFTGW
Ga0181430_111129833300017772SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGWQEQTETYFKLTIE
Ga0181423_100572013300017781SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTGWQEQT
Ga0181380_105561653300017782SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDF
Ga0181380_129185723300017782SeawaterMSRKEGDKAYATYVHYQAFSSDEPTHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTLF
Ga0181592_1105851323300018421Salt MarshMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAF
Ga0181595_1040998113300020053Salt MarshMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTLYDFTGWQEQTEKYF
Ga0211576_1026083833300020438MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTIYDFSGW
Ga0211576_1027882633300020438MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFTG
Ga0213866_1039973033300021425SeawaterMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTLYAFTG
Ga0222719_1067587523300021964Estuarine WaterMHYQAFSSDEPTHRINQTNWYLKFEDGLPAFFIQADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTEKYFNLTIE
Ga0212025_106919123300022057AqueousMSRKPRDKNYSSYMHYQAFSSDMPVHRINQTNWYLKFEDGLPAFFVRADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTENYFK
Ga0212026_105019523300022069AqueousMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWKEQTEKYFNLTIEEIK
Ga0222652_101182913300022853Saline WaterMSRKLGDKGFDSYMNYQAFSSDMPVHQINQTQWYLKFEKGLPGFYLKTDDVFQQMPTSTFIV
Ga0255765_108241313300022921Salt MarshMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTLYDFT
Ga0255770_1041022223300022937Salt MarshMHYQAFSSDMPVHRINQTNWYLKFEDGLPAFFVRADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTENYFNLTIEEIKCLTDK
Ga0222630_106495213300023243Saline WaterMSRKLGDKGYDSYMNYQAFSSDMPVQQINQTQWYLKFEKGLPGFYLKTDDVFQQMPTSTFIVTATRSTIYDFSGWQQQMENY
(restricted) Ga0233438_1035464413300024255SeawaterMGRKLGDKSYVSYLHYQAFSSDCPVHQINQTNWYLKFEKNIPGFFIKTDDVFQQMPPLSFFATAERSTLY
Ga0207906_105253033300025052MarineMSRRKGDKAYQSYLNYQAFSSDMPTHRINQTNWYLKFEKNLPAFFIKAEDVFRQMPPLSF
Ga0207896_101949043300025071MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTLFDFTGWREQTETYFKSTIE
Ga0208157_113189913300025086MarineMSRKEGDKAYATYVHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFSGWQEQTETYFKSTIEEIKC
Ga0208669_104625013300025099MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIA
Ga0208793_114591413300025108MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERST
Ga0208919_105502853300025128MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGWQ
Ga0209336_1015140713300025137MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMP
Ga0209634_125512613300025138MarineMSRKLGDKAYESYLNYQAFSSDMPVHQINQTQWYLKFEKNLPAFFHKADDVFQQMPPLSF
Ga0209634_128613733300025138MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERST
Ga0209337_112690613300025168MarineMSRKLGDKAYESYLNYQAFSSDMPVHRINQTNWYLKFEKNLPAFFIKADDVFQQMPPLSFFATAERYSQRLQT
Ga0209337_116606133300025168MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTLFDFTGWK
Ga0208646_100055213300025425Saline LakeMSRKLGDKGYDSYMNYQAFSSDMPVQQINQTQWYLKFEKGLPGFYLKTDDVFQQMPTSTFIVTATRSTIYDFSGWQQQMENYFNLTKEE
Ga0208768_113230333300025601Saline LakeMSRKLGDKGYDSYMNYQAFSSDMPVQQINQTQWYLKFEKGLPGFYLKTDDVFQQMPTSTFIVTATRSTIYDFSGWQQQMENYFNL
Ga0208414_105462753300025603Saline LakeMGRKLGDKAYESYLHYQAFSSDCPVHQINQTNWYLKFEKNLPAFFIKTDDVFQQMPPLSFFATAERSTLFDFTGWQEQI
Ga0209653_113651123300025695MarineMGRKLGDKSYVSYLHYQAFSSDCPVHQINQTNWYLKFEKNIPGFFIKTDDVFQQMPPLSFFATAERSTLYDFTG
Ga0208425_106303733300025803AqueousMHYQAFSSDMPVHRINQTNWYLKFEDGLPAFFVRADDVFRQMPPMAFFTTAERSTIFDFTGWKEQTEN
Ga0208543_103305663300025810AqueousMHYQAFSSDMPVHRINQTNWYLKFEDGLPAFFVRADDVFRQMPPMAFFTTAERS
Ga0208917_111677043300025840AqueousMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTLYDFTGWQEQT
Ga0208645_104518473300025853AqueousMARKEGDKAYASYLHYQAFSSDMPVHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFATAERSTLYDFTGWQEQTENYF
Ga0209425_1017707313300025897Pelagic MarineMSRKEGDKAYATYVHYQAFSSDMPIHRINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFTGW
Ga0209815_124227413300027714MarineMSRKLGDKAYESYLHYQAFSSDMPVHQINKTQYYLKFEKNLPAFFWKVDDVFQQMPPGSFFQTAERSTLFD
Ga0209709_1038921613300027779MarineMSRKFGDKAYESYLHYQAFSSDMPVQQINQTQWYLKFEKNLPAFFHKSDDVFQQMPPLSFFATAERSTLFDFTGWQEQIENYFNLTIE
Ga0209403_1012519613300027839MarineMSRKFGDKAYESYMHYQAFSSDMPVHRINQTQWYIKFEKNLPAFFSKADDVFQQMPPLSFFAT
Ga0209403_1051399313300027839MarineMSRKFGDKAYESYMHYQAFSSDMPVHRINETQWYIKFEKNLPAFFSKADDVFQQMPPLSFFAT
Ga0209501_1048416313300027844MarineMSRKFGDKAYESYMHYQAFSSDMPVHRINQTQWYIKFEKNLPAFFSKADDVFQQMPPLSFFATAERYSLRLQPTLFDFTGWKEQIETYFN
Ga0209501_1069095923300027844MarineMSRRKGDKGYVMYVGYQAFSSDMPTFRINNTNWYLKFENNIPGFFINAENVFRQMSPACFFTTAKGS
Ga0257110_121406913300028197MarineMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDFSGWKEQTEN
Ga0308022_108383613300031142MarineMSRKLGDKAYESYLHYQAFSSDMPVHQINKTQYYLKFEKNLPAFFWKVDDVFQQMPPGSFFQTAERS
Ga0307488_1020260913300031519Sackhole BrineMGRKLGDKAYESYLHYQAFSSDCPVHQINQTNWYLKFEKNLPAFFIKTDDVFQQMPPLSFFATAERSTLFDFTGWQ
Ga0308018_1005075663300031655MarineMSRKLGDKAYESYLHYQAFSSDMPVHQINKTQYYLKFEKNLPAFFWKVDDVFQQMPPGSFFQTAERSTLFDFSGWKKQIE
Ga0307986_1043698813300031659MarineMSRKFGDKAYESYLNYQAFSSDMPTHRINQTNWYLKFEKNLPAFFIKADDVFQQMPPLSFFATAERSTLFDFTGWQDQIETYFNLTTQEI
Ga0315322_1055252233300031766SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFFATAERSTIYDF
Ga0315332_1092850313300031773SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPLAFIATAERSTIYDFSGWQEQTETY
Ga0315316_1156083423300032011SeawaterMSRKEGDKAYATYVHYQAFSSDMPIHQINQTNWYLKFEDNLPAFFIKADDVFRQMPPMAFFTTAERSTLYD
Ga0314858_028447_1026_12773300033742Sea-Ice BrineMSRKLGDKAYESYLNYQAFSSDMPVHQINQTQWYLKFEKNLPAFFHKTDDVFQQMPPLSFFATAERSTLFDFTGWQEQIETYFK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.