NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061485

Metagenome / Metatranscriptome Family F061485

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061485
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 46 residues
Representative Sequence MFLLSMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVVRLD
Number of Associated Samples 85
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 24.43 %
% of genes near scaffold ends (potentially truncated) 52.67 %
% of genes from short scaffolds (< 2000 bps) 99.24 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (87.023 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(70.229 % of family members)
Environment Ontology (ENVO) Unclassified
(83.206 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(74.809 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 27.40%    Coil/Unstructured: 72.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF04937DUF659 2.29


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.02 %
UnclassifiedrootN/A12.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_101068230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum735Open in IMG/M
3300005347|Ga0070668_101171235Not Available696Open in IMG/M
3300005367|Ga0070667_100874916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum836Open in IMG/M
3300005549|Ga0070704_101950855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum545Open in IMG/M
3300005617|Ga0068859_100903739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum968Open in IMG/M
3300005719|Ga0068861_101088495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum767Open in IMG/M
3300005842|Ga0068858_100769628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum938Open in IMG/M
3300005842|Ga0068858_101667022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300009092|Ga0105250_10531961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300009177|Ga0105248_13290319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum514Open in IMG/M
3300009976|Ga0105128_115776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300009980|Ga0105135_109066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum737Open in IMG/M
3300009980|Ga0105135_110444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300009980|Ga0105135_124634All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300009981|Ga0105133_101424All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1173Open in IMG/M
3300009981|Ga0105133_102987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum968Open in IMG/M
3300009990|Ga0105132_140846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300009992|Ga0105120_1004733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1158Open in IMG/M
3300009995|Ga0105139_1077516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300010371|Ga0134125_11694172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum688Open in IMG/M
3300010371|Ga0134125_13127564All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300010373|Ga0134128_11710321Not Available692Open in IMG/M
3300010397|Ga0134124_13132977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300010400|Ga0134122_10584037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1029Open in IMG/M
3300010400|Ga0134122_11841617All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum638Open in IMG/M
3300010400|Ga0134122_12220369Not Available593Open in IMG/M
3300014325|Ga0163163_10970768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum913Open in IMG/M
3300014325|Ga0163163_12961528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300014326|Ga0157380_13529848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300015273|Ga0182102_1017656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300015290|Ga0182105_1010555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1048Open in IMG/M
3300015290|Ga0182105_1077050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015293|Ga0182103_1040960All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300015293|Ga0182103_1053107All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300015297|Ga0182104_1052286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015297|Ga0182104_1117595Not Available507Open in IMG/M
3300015301|Ga0182184_1003771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1431Open in IMG/M
3300015301|Ga0182184_1088203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300015306|Ga0182180_1016757Not Available943Open in IMG/M
3300015310|Ga0182162_1123603All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015311|Ga0182182_1001005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2331Open in IMG/M
3300015311|Ga0182182_1019210All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum933Open in IMG/M
3300015311|Ga0182182_1025543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum856Open in IMG/M
3300015313|Ga0182164_1030445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum864Open in IMG/M
3300015313|Ga0182164_1054150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300015313|Ga0182164_1127587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015315|Ga0182120_1054982All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum715Open in IMG/M
3300015315|Ga0182120_1085319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300015316|Ga0182121_1070899Not Available673Open in IMG/M
3300015316|Ga0182121_1109417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300015317|Ga0182136_1110505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300015318|Ga0182181_1058351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum637Open in IMG/M
3300015319|Ga0182130_1069070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300015320|Ga0182165_1102196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300015324|Ga0182134_1089631Not Available612Open in IMG/M
3300015325|Ga0182148_1048097All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum753Open in IMG/M
3300015325|Ga0182148_1117324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300015328|Ga0182153_1019744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1024Open in IMG/M
3300015329|Ga0182135_1036465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum857Open in IMG/M
3300015330|Ga0182152_1019927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1042Open in IMG/M
3300015330|Ga0182152_1120174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300015331|Ga0182131_1111879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300015332|Ga0182117_1047809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum837Open in IMG/M
3300015332|Ga0182117_1111320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300015333|Ga0182147_1137433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300015334|Ga0182132_1057277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300015334|Ga0182132_1085412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum667Open in IMG/M
3300015334|Ga0182132_1089669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum655Open in IMG/M
3300015334|Ga0182132_1148196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015334|Ga0182132_1168910Not Available503Open in IMG/M
3300015336|Ga0182150_1054694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum772Open in IMG/M
3300015337|Ga0182151_1042585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum840Open in IMG/M
3300015337|Ga0182151_1083689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum661Open in IMG/M
3300015337|Ga0182151_1144120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300015339|Ga0182149_1049961Not Available822Open in IMG/M
3300015339|Ga0182149_1158144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300015340|Ga0182133_1048279All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum875Open in IMG/M
3300015340|Ga0182133_1136929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300015348|Ga0182115_1205427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300015348|Ga0182115_1277432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015348|Ga0182115_1283939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300015349|Ga0182185_1159423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum674Open in IMG/M
3300015349|Ga0182185_1226204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300015349|Ga0182185_1265863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300015352|Ga0182169_1149878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum761Open in IMG/M
3300015352|Ga0182169_1171666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum709Open in IMG/M
3300015352|Ga0182169_1172332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum707Open in IMG/M
3300015352|Ga0182169_1269800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015353|Ga0182179_1078871Not Available955Open in IMG/M
3300015353|Ga0182179_1186347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300015353|Ga0182179_1199617Not Available636Open in IMG/M
3300015354|Ga0182167_1199903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300015354|Ga0182167_1219772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum691Open in IMG/M
3300017414|Ga0182195_1047155Not Available904Open in IMG/M
3300017414|Ga0182195_1085839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum732Open in IMG/M
3300017421|Ga0182213_1129367All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum706Open in IMG/M
3300017422|Ga0182201_1141633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300017432|Ga0182196_1139074All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300017435|Ga0182194_1040143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum826Open in IMG/M
3300017439|Ga0182200_1114347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300017440|Ga0182214_1082189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum672Open in IMG/M
3300017440|Ga0182214_1156938Not Available508Open in IMG/M
3300017445|Ga0182198_1048395Not Available857Open in IMG/M
3300017446|Ga0182217_1133178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300017447|Ga0182215_1082331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum706Open in IMG/M
3300017693|Ga0182216_1195833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300017693|Ga0182216_1213245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300017694|Ga0182211_1042704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1032Open in IMG/M
3300017694|Ga0182211_1089874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum716Open in IMG/M
3300020023|Ga0182178_1009047Not Available691Open in IMG/M
3300025903|Ga0207680_10971050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300025931|Ga0207644_11582071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300028054|Ga0268306_1021212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300028056|Ga0268330_1027854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum671Open in IMG/M
3300028144|Ga0268345_1006902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum768Open in IMG/M
3300028144|Ga0268345_1012773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300028147|Ga0268303_101493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum905Open in IMG/M
3300028147|Ga0268303_106142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300028464|Ga0268302_104117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300028473|Ga0268319_1023492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300032465|Ga0214493_1095708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum706Open in IMG/M
3300032548|Ga0214483_1088519Not Available502Open in IMG/M
3300032625|Ga0214501_1211759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300032625|Ga0214501_1253611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300032689|Ga0214497_1071734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum767Open in IMG/M
3300032699|Ga0214494_1064928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum699Open in IMG/M
3300032844|Ga0314743_1132619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300032875|Ga0314737_1014319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1276Open in IMG/M
3300032913|Ga0314739_1098651Not Available534Open in IMG/M
3300033530|Ga0314760_1076131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum832Open in IMG/M
3300033532|Ga0314767_1035467All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1183Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere70.23%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated6.87%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere6.11%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.05%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028144Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028147Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032844Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032913Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10106823023300005331Switchgrass RhizosphereLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQQD*
Ga0070668_10117123513300005347Switchgrass RhizosphereVIDMFLLSMYADRQWQAEMLYGNTVKIFIPDGDATIVVRRK
Ga0070667_10087491613300005367Switchgrass RhizosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQQD*
Ga0070704_10195085523300005549Corn, Switchgrass And Miscanthus RhizosphereMIYDFIYVIDMFLLSMYADRQWQVEMLYGNTVKIFIPDGDATIVVRRKEEVV*
Ga0068859_10090373913300005617Switchgrass RhizosphereMYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVRLD*
Ga0068861_10108849513300005719Switchgrass RhizosphereMFLLSMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVVRLD*
Ga0068858_10076962813300005842Switchgrass RhizosphereMYADRQWQAEMLCGNTVKIFIPDGDVTIVVRRKEEVVRLD*NNIWL
Ga0068858_10166702223300005842Switchgrass RhizosphereMYADRQWQAEMLYGNTVKIFIPDGDVTIVVRRKEEVVRLD*
Ga0105250_1053196133300009092Switchgrass RhizosphereMGEIEMLYGNMVKIFIPDGDATIVVYRKEELVQQD*
Ga0105248_1329031913300009177Switchgrass RhizosphereMYADRQWQAEMLYGNTVKIFIPDGDVTIVVRRKEEVVRLD*NNI
Ga0105128_11577613300009976Switchgrass AssociatedMFLLSIYADRQWQAEIEMLYGNMVKIFIPDGDATIVVRRKE
Ga0105135_10906613300009980Switchgrass AssociatedMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKVEVV
Ga0105135_11044413300009980Switchgrass AssociatedMFLLSIYAGRKCLGEIEMLYENMVKIFIPDGDATIVVRRKEEVVQQD*
Ga0105135_12463413300009980Switchgrass AssociatedMYADRQWQGEMLYGNTVKIFIPDGDATIVVPRKEEVVRL
Ga0105133_10142413300009981Switchgrass AssociatedMIEMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQQD*
Ga0105133_10298723300009981Switchgrass AssociatedLIYVDFIYVIDMFLLSIYADRQCQTEIKMLYRNMVKIFIPDGDATIVMRRKQEVVRLD*
Ga0105132_14084613300009990Switchgrass AssociatedMFLLSIYADRQWQGEMLYGNTVKIFIPDDDVTIVVRRKEELVRLD*
Ga0105120_100473313300009992Switchgrass AssociatedMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDAIIVVRRKEEVVQQD*
Ga0105139_107751613300009995Switchgrass AssociatedMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVV*
Ga0134125_1169417213300010371Terrestrial SoilVIDMFLLSMYADRQWQAEMLYGNTVKIFIPDGDATIVVRRKEEVVRLD*
Ga0134125_1312756423300010371Terrestrial SoilLIYVDFIYVIAMFLLSIYADRQCQAEIKMLYGNIVKIFIPDDDVTIVVRRKEEVVRLD*
Ga0134128_1171032113300010373Terrestrial SoilMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVVRLD*
Ga0134124_1313297713300010397Terrestrial SoilVIDIFLLSIYADRQWQAEIEMLYGNMVKIFIPDGDATIVVRRKEEVVRLD*
Ga0134122_1058403713300010400Terrestrial SoilVIDMSLLSICADRQCQVEIKMLYGNMMKIFIPDGDASIVIRRKQEVVRLD*
Ga0134122_1184161713300010400Terrestrial SoilMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQLD*
Ga0134122_1222036913300010400Terrestrial SoilVIDMFLLSMYADRQWQAEMLYGNTVKIFIPDGDATIVVRRKDEVVRLD*
Ga0163163_1097076813300014325Switchgrass RhizosphereMYADRQWQAEMLYENTVKIFIPDGDVTIVVRRKEEVVRLD*NNIWLGAGQRWS
Ga0163163_1296152813300014325Switchgrass RhizosphereVIDIFLLSIYADRQWQAEIEMLYGYMVKIFIPDDDATIIVHRKEEVVRLD*
Ga0157380_1352984813300014326Switchgrass RhizosphereMFLLSMYSDRQ*ETEMLYGNTAKIFIPDGNVTIVVRRKEEVVRLD*NNIWL
Ga0182102_101765623300015273Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKILIPDGDATIVVRRKEEVVQQD*
Ga0182105_101055513300015290Switchgrass PhyllosphereVIDMSLLSIYADRQCQVEIKILYGNMVKIFIPDGGASIVIRRKQEVVRLD*
Ga0182105_107705013300015290Switchgrass PhyllosphereMYADRQWQVEMLYGNTVKIFIPDGDATIVVRRKEEV
Ga0182103_104096013300015293Switchgrass PhyllosphereVIDMFLLSIYADRQWQAKMLYGNTVKIFIRDGDATIVVRRKEEVVRLD*
Ga0182103_105310713300015293Switchgrass PhyllosphereFDLGVYLIYIDFIYVIDMFLLSIYADRQCQAEIKILYGNLVKIFIPDGDATIVIRRKEEVVRLD*
Ga0182104_105228623300015297Switchgrass PhyllosphereMYADRQWQGEMLYGNTVKIFIPDGDATIVLCRKEEVV
Ga0182104_111759513300015297Switchgrass PhyllosphereVIDMFLLSMYVDRQRQIEMLYGNTVKIFIPDGDATIVVRRKDEVVRLD*
Ga0182184_100377123300015301Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKIFIPDGDVTIVVRRKEEVVR
Ga0182184_108820323300015301Switchgrass PhyllosphereLIYVDFIYVIDMFLLSIYADRQCQAEIKMLYVNMVKIFIPDGDATIVVRRKEEVVRLD*
Ga0182180_101675713300015306Switchgrass PhyllosphereMYADRQWQGEILYGNTVKIFIPDGDATIVVRRKDEVVRLD*
Ga0182162_112360313300015310Switchgrass PhyllosphereADRQWQAKMLYGNTVKIFILDGDATIVIRRKEEVVRLD*
Ga0182182_100100533300015311Switchgrass PhyllosphereVIDMSLLSIYADRQCQVEIKMLYGNMVKNFIPDGGASIVIRRKQEVVRLD*
Ga0182182_101921013300015311Switchgrass PhyllosphereLIYVDFIYVIDMFLLSIYAGRQCQAEIKMLYGNMVKIFIPDGEATIVMRKKEEVVRLD*
Ga0182182_102554313300015311Switchgrass PhyllosphereMYADRQWQAEMLCGNTVKIFIPDGDVTIVVRRKEEVVRLD*NNIWLG
Ga0182164_103044513300015313Switchgrass PhyllosphereVIDMSLLSICADRQCQVEIKMLYGNMVKIFIPDGDASILIRRKQ
Ga0182164_105415013300015313Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDVTIVVRRKEEVVQQD*
Ga0182164_112758713300015313Switchgrass PhyllosphereMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVV
Ga0182120_105498213300015315Switchgrass PhyllosphereMYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVRL
Ga0182120_108531913300015315Switchgrass PhyllosphereQWQAEMLYGNTVKIFIPDGDADIIVRRKEEVVRLD*
Ga0182121_107089913300015316Switchgrass PhyllosphereVIDMFLLSIYADRQWQAEIEMLYGNMVKIFIPDGDTTIVVRKKEEVVRLD*
Ga0182121_110941713300015316Switchgrass PhyllosphereMFLLSIYVDRQWQAEIEMLYGNMVKIFILDGDATIVVRRKEEVVRLD*NN
Ga0182136_111050513300015317Switchgrass PhyllosphereIYVIDMFLLSIYADRQCQAEIKILYGNMVKIFIPDGDATIVIRRKEEVVRLD*
Ga0182181_105835123300015318Switchgrass PhyllosphereMFLLSMYADRQWQAEMLYGNTVKICIPDDDAIIVVRRKEEVV*
Ga0182130_106907013300015319Switchgrass PhyllosphereMYADRQWQAEIEMLYGNTVKIFILDGDATIVVRRKEEVV*
Ga0182165_110219623300015320Switchgrass PhyllosphereLIYVDFIYVIDMFLLSIYVDRQCQLEIKMLYGNMVKIFIPDGDATIVTRTMEEVVRLD*
Ga0182134_108963113300015324Switchgrass PhyllosphereMFLLSIYADRQWQAEIEMLYGNMVKIFIPDGDATIV
Ga0182148_104809713300015325Switchgrass PhyllosphereVIDMFLLSIYVDRQCQAEIKMLYGNMVKIFIPDGDATIIVRRKEEVVRLD*
Ga0182148_111732413300015325Switchgrass PhyllosphereMFLLSIYADRQWQAEIEMLYGNMVKIFIPDGDATIVIRRKDVVVRLD
Ga0182153_101974413300015328Switchgrass PhyllosphereMFLLSMYADRQ*QAEMLYGNTVKIFILDGDATIVVRRKEEVVRLD*NNIW
Ga0182135_103646513300015329Switchgrass PhyllosphereVIDMFLLSIYADRQWQVEMLYGNTVKIFILDGDATIVVRRKEEVVRLD*
Ga0182152_101992713300015330Switchgrass PhyllosphereMFLLSIYAGGKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQQD*
Ga0182152_112017413300015330Switchgrass PhyllosphereVIDMFLLSIYADRQWQVEKEMLYGNMVKIFIPDGDATIVVRKKEEVVRLD*
Ga0182131_111187913300015331Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKNCIPDGDAIIVVRRKEEVVR
Ga0182117_104780913300015332Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMMKIFIPDGDATIVVRRK
Ga0182117_111132013300015332Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKICIPDGDAIIVVRRKEEVVRLD*
Ga0182147_113743313300015333Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKIFIPDGDATIVVRRKEEVV
Ga0182132_105727713300015334Switchgrass PhyllosphereFDLGVYLIYVDFIYVIDMFLLSIYADRQYLAEIKMLYGNMMKIFIPDGDATIVIRRKEEVVRLD*
Ga0182132_108541213300015334Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYENMVKTFIPDGDATIVVRRKEEVVQQD*
Ga0182132_108966913300015334Switchgrass PhyllosphereLSHLGRFDLGVYLIYVDFIYVIDMFLLSIYADRKCQAEIKMLCGNMVKIFIPDGDVTIVMRRKEVMVRLD*
Ga0182132_114819613300015334Switchgrass PhyllosphereMFLLSIYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVV
Ga0182132_116891013300015334Switchgrass PhyllosphereMIDMSLLSICADRQCQVEIKILYGNMVKIFISDDGASIVIRRKQEVVRLD*
Ga0182150_105469413300015336Switchgrass PhyllosphereVIDMSLLSIYADRQCQVEIKMLYGNMVKIFIPDGGASIVIRRKQEVVRLD*
Ga0182151_104258523300015337Switchgrass PhyllosphereMYADRQWQGEILYGNTVKIFIPDGDATIVVRRKEEVV
Ga0182151_108368913300015337Switchgrass PhyllosphereVIDMSLLSIYADGQCQVEIKMLYGNIVKNFIPDGGASIVIRRKQEVVRLD*
Ga0182151_114412013300015337Switchgrass PhyllosphereVDRQWQVEIEMLYGNMVKIFIPDGDATIVVRRKEEVVRLD*
Ga0182149_104996113300015339Switchgrass PhyllosphereMFLLSMYADRQWQAEMLYGNTVKICIPDGDAIIVVRR
Ga0182149_115814413300015339Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKIFIPDGDVTIVVRRKEEVVRL
Ga0182133_104827923300015340Switchgrass PhyllosphereMYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVRLD*N
Ga0182133_113692923300015340Switchgrass PhyllosphereYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVRLD*
Ga0182115_120542713300015348Switchgrass PhyllosphereIYADRQCQAEIKMLYGNMVKIFIPDGDATIIVRRKEEVVRLD*
Ga0182115_127743213300015348Switchgrass PhyllosphereMFLLSIYVDRQWQAEIEMLYGNMVKIFIPDGDATIVVRRKEEVVRLD*
Ga0182115_128393913300015348Switchgrass PhyllosphereLIEMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVGRRKEEVVQQD*
Ga0182185_115942323300015349Switchgrass PhyllosphereMYAGRQWQAEIEMLYGNTVKIFIPDGDATIVVRRKEEVV*
Ga0182185_122620423300015349Switchgrass PhyllosphereMYADRQWQAEIEMLYGNTVKIFIPDGDATIIVLRKEEVVRLD*
Ga0182185_126586313300015349Switchgrass PhyllosphereDFIYVIDMFLLSIYADRQWQAEIKMLYGNMVKIFIPNGDATIVIRRKEEVV*
Ga0182169_114987813300015352Switchgrass PhyllosphereMFLLSMYADRQWQAEIEMLYGNTVKIFILDGDATIVVRRKEEVVRLD*
Ga0182169_117166613300015352Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDVDATIVVRRKEEVVQQD*
Ga0182169_117233233300015352Switchgrass PhyllosphereRFDLGVYLIYVDFIYVIDMFLLSIYAGRQCQAEIKMLYGNMVKVFIPDGDGTIVVRRKEEVVRLD*
Ga0182169_126980023300015352Switchgrass PhyllosphereLIYVDFIYVIDMFLLSIYADRQCQAEIKMLYGNIVKIFIPDGDATIIVRRKEEVVRLD*
Ga0182179_107887113300015353Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATI
Ga0182179_118634713300015353Switchgrass PhyllosphereMYAGRQWQAEIEMLYGNTVKIFIPDGDATIVVRRKEEVM*
Ga0182179_119961723300015353Switchgrass PhyllosphereVIDIFLLSIYADRQCQVEIKMLYGNIVKIFIPDGGASIV
Ga0182167_119990313300015354Switchgrass PhyllosphereMFLLSIYADRKCQAEIKMLYGNMAKIFIPDGDATIVIRRKEEVVRLD*
Ga0182167_121977223300015354Switchgrass PhyllosphereWIYVRFLLSIYADRQCQAEIMMLYGNMVKIFIPDDDVTIVIRKKEDVVRLD*
Ga0182195_104715513300017414Switchgrass PhyllosphereVIDMFLLSMYADRQRHVEMLYGNTVKIFIPDGDATIVVRRKEEVVRLD
Ga0182195_108583913300017414Switchgrass PhyllosphereMYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVR
Ga0182213_112936713300017421Switchgrass PhyllosphereMFLLSMYADRQWQADMLYGNTVKIFIPDGDATIVVRRKEEVVRLD
Ga0182201_114163313300017422Switchgrass PhyllosphereVIVIFLLSIYADRQWQAKMLYGNTVKIFISDGDATIVVRRKEEVVRLD
Ga0182196_113907413300017432Switchgrass PhyllosphereMFLLSMYADRQWQAEMLYGNTVKICIPDGDAIIVVRRKEEVVRLDXNNIWL
Ga0182194_104014313300017435Switchgrass PhyllosphereMFLLSMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVVRLDXNNIWLG
Ga0182200_111434713300017439Switchgrass PhyllosphereMYVIDMFLLSIYADRQCQAEIKMLYGNMVKIFIPDGDATIVVRIKEEVVRLD
Ga0182214_108218913300017440Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKICIPDGDAIIVVRRKEEVVRLD
Ga0182214_115693813300017440Switchgrass PhyllosphereLFIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRR
Ga0182198_104839523300017445Switchgrass PhyllosphereMYADRQRQAEMLYGNTVKIFISNGNATIVVRRKKEVVRLDXNNIWLGAGQRWS
Ga0182217_113317823300017446Switchgrass PhyllosphereVIDMSLLSICADRQCQVEIKMLYGNMVKIFIPDGDATIVMRRKEEVV
Ga0182215_108233113300017447Switchgrass PhyllosphereMYADRQWQGEMLYGNTVKIFIPDGDATIVVRRKEEVVRLD
Ga0182216_119583323300017693Switchgrass PhyllosphereSIYADRQWQAEIEMLYGNMVKIFIPDGDANIVVRKKEEVVRLD
Ga0182216_121324523300017693Switchgrass PhyllosphereLGRFDLGVYLIYVDFIYVIDMFLLSIYADRQCQTEIKMLYGNMVKIFNPDGDATIVMRRKEEVV
Ga0182211_104270413300017694Switchgrass PhyllosphereVIDMSLLSICADRQCQVEIKMLYGNMVKIFIPDGGASIVIRRKQEVVRLD
Ga0182211_108987423300017694Switchgrass PhyllosphereMFLLSMYADRQWQAEMLYGNTVKIFIPDGDATIVVRKKEEAVRLY
Ga0182178_100904713300020023Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIV
Ga0207680_1097105013300025903Switchgrass RhizosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVRLD
Ga0207644_1158207113300025931Switchgrass RhizosphereMYADRQWQAEMLCGNTVKIFIPDGDVTIVVRRKEEVVRLDXNNIWLGAGGSGHAR
Ga0268306_102121213300028054PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQQD
Ga0268330_102785413300028056PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVVQQ
Ga0268345_100690213300028144PhyllosphereYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVRLD
Ga0268345_101277313300028144PhyllosphereVIDMSLLSIYADRQCQVEIKILYGNMVKIFIPDGGASIVIRRKQQVVRLD
Ga0268303_10149313300028147PhyllosphereMYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVVRLD
Ga0268303_10614213300028147PhyllosphereVIDMSLLSIYADRQCQVEIKILYGNMVKIFIPDGGASIVIRRKQEVVRLD
Ga0268302_10411713300028464PhyllosphereYVIDMSLLSIYADRQCQVEIKILYGNMVKIFIPDGGASIVIRRKQEVVRLD
Ga0268319_102349213300028473PhyllosphereMFLLSMYADRQWQAEMLYGNTVKICIPDGDAIIVVRRKEEVVRLDXNNIWLGAE
Ga0214493_109570813300032465Switchgrass PhyllosphereMFLLSIYADRQWQAEMLYGNTVKICIPDGDAIIVVRRKEVVVRLD
Ga0214483_108851913300032548Switchgrass PhyllosphereMSGCVRQWQTKMLYENTVKIFIPDGDATIVVCRKEELVRL
Ga0214501_121175913300032625Switchgrass PhyllosphereMFLLSIYAGRKCLGEIEMLYGNMVKIFIPDGDATIVVRRKEEVV
Ga0214501_125361113300032625Switchgrass PhyllosphereMYADRQWQAEMLYGNTGKIFIPDGDATIVVRRKEEVV
Ga0214497_107173413300032689Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKIFIPDGDVTIVVRRKEEVVRLD
Ga0214494_106492813300032699Switchgrass PhyllosphereMYADRQWQAEMLYGNTVKIFIPDDDVTIVVRRKEEVVRLD
Ga0314743_113261913300032844Switchgrass PhyllosphereMYADRQWQVEMLYGNTGKIFIPDGDATIVVCRKEEV
Ga0314737_101431933300032875Switchgrass PhyllosphereVIDMSLLSIYADRQYQVEIKMLYGNMVKIFIPDGDATIVVRRKEEVVQQD
Ga0314739_109865113300032913Switchgrass PhyllosphereVIDMSLLSIYADRQCQVEIKILYGNMVKIFIPDGGASIVIRR
Ga0314760_107613123300033530Switchgrass PhyllosphereFLLSIYAGRKCLGEIEMLYGNMVKIFIPDDDATIVVRRKEEVVRLD
Ga0314767_103546713300033532Switchgrass PhyllosphereILDDIFLLCMYADRQWQAEMLYGNTVKIFIPDGDVTIVVRRKEEVVRLD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.