NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F061661

Metagenome Family F061661

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061661
Family Type Metagenome
Number of Sequences 131
Average Sequence Length 37 residues
Representative Sequence MRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGV
Number of Associated Samples 76
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 95.42 %
% of genes near scaffold ends (potentially truncated) 6.11 %
% of genes from short scaffolds (< 2000 bps) 70.23 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (74.809 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(38.168 % of family members)
Environment Ontology (ENVO) Unclassified
(53.435 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(57.252 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.46%    β-sheet: 0.00%    Coil/Unstructured: 61.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF01381HTH_3 24.62
PF10926DUF2800 5.38
PF00959Phage_lysozyme 3.08
PF13481AAA_25 2.31
PF05930Phage_AlpA 1.54
PF13392HNH_3 1.54
PF03237Terminase_6N 1.54
PF08291Peptidase_M15_3 0.77
PF01011PQQ 0.77
PF02592Vut_1 0.77
PF01527HTH_Tnp_1 0.77
PF01022HTH_5 0.77
PF11134Phage_stabilise 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG3311DNA-binding transcriptional regulator AlpATranscription [K] 1.54
COG1738Queuosine precursor transporter YhhQ, DUF165 familyTranslation, ribosomal structure and biogenesis [J] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.73 %
UnclassifiedrootN/A15.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000882|FwDRAFT_10102055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300005581|Ga0049081_10347258Not Available504Open in IMG/M
3300006803|Ga0075467_10555994Not Available588Open in IMG/M
3300006805|Ga0075464_10052325All Organisms → Viruses → Predicted Viral2255Open in IMG/M
3300006805|Ga0075464_10127036All Organisms → Viruses → Predicted Viral1485Open in IMG/M
3300006805|Ga0075464_10184373Not Available1236Open in IMG/M
3300006805|Ga0075464_10313624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage945Open in IMG/M
3300006805|Ga0075464_10324086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300006805|Ga0075464_10635239All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage658Open in IMG/M
3300006805|Ga0075464_10753471Not Available604Open in IMG/M
3300006805|Ga0075464_10754409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300006805|Ga0075464_10891024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300006920|Ga0070748_1043614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1800Open in IMG/M
3300006920|Ga0070748_1114071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1023Open in IMG/M
3300007548|Ga0102877_1131621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300007559|Ga0102828_1138452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300007708|Ga0102859_1148563Not Available687Open in IMG/M
3300007974|Ga0105747_1267639All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300008055|Ga0108970_10441583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300009026|Ga0102829_1152984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300009068|Ga0114973_10002196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14318Open in IMG/M
3300009068|Ga0114973_10009269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6444Open in IMG/M
3300009068|Ga0114973_10097521All Organisms → Viruses → Predicted Viral1674Open in IMG/M
3300009151|Ga0114962_10037507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3276Open in IMG/M
3300009151|Ga0114962_10053222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2657Open in IMG/M
3300009151|Ga0114962_10167073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1309Open in IMG/M
3300009151|Ga0114962_10592578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300009152|Ga0114980_10420243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300009154|Ga0114963_10478049Not Available665Open in IMG/M
3300009158|Ga0114977_10003987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9435Open in IMG/M
3300009158|Ga0114977_10062358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2294Open in IMG/M
3300009158|Ga0114977_10100250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1757Open in IMG/M
3300009160|Ga0114981_10048443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2389Open in IMG/M
3300009160|Ga0114981_10160057All Organisms → Viruses → Predicted Viral1240Open in IMG/M
3300009163|Ga0114970_10007887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7564Open in IMG/M
3300009163|Ga0114970_10030637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3579Open in IMG/M
3300009163|Ga0114970_10043835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2917Open in IMG/M
3300009163|Ga0114970_10095879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1842Open in IMG/M
3300009163|Ga0114970_10517996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300009164|Ga0114975_10000376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage33496Open in IMG/M
3300009164|Ga0114975_10279051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300009180|Ga0114979_10148283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1436Open in IMG/M
3300009180|Ga0114979_10155536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1398Open in IMG/M
3300009180|Ga0114979_10219573Not Available1146Open in IMG/M
3300009183|Ga0114974_10117625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1693Open in IMG/M
3300009684|Ga0114958_10436174All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300010157|Ga0114964_10053046All Organisms → Viruses → Predicted Viral2117Open in IMG/M
3300010160|Ga0114967_10149903All Organisms → Viruses → Predicted Viral1297Open in IMG/M
3300010334|Ga0136644_10115492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1658Open in IMG/M
3300010885|Ga0133913_13206477All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300011009|Ga0129318_10193292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300011115|Ga0151514_10082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage40067Open in IMG/M
3300011115|Ga0151514_10082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage40067Open in IMG/M
3300011115|Ga0151514_10392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19309Open in IMG/M
3300011335|Ga0153698_1669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13497Open in IMG/M
3300011335|Ga0153698_1710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12952Open in IMG/M
3300013006|Ga0164294_10872116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300013014|Ga0164295_10922901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage677Open in IMG/M
3300013372|Ga0177922_10957334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage644Open in IMG/M
3300017722|Ga0181347_1070999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1027Open in IMG/M
3300017736|Ga0181365_1050185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1043Open in IMG/M
3300017777|Ga0181357_1195322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage725Open in IMG/M
3300017784|Ga0181348_1253492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300017785|Ga0181355_1101535Not Available1189Open in IMG/M
3300017785|Ga0181355_1251038Not Available678Open in IMG/M
3300018416|Ga0181553_10082968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2020Open in IMG/M
3300019783|Ga0181361_111450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage691Open in IMG/M
3300019784|Ga0181359_1000233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11591Open in IMG/M
3300019784|Ga0181359_1109250All Organisms → Viruses → Predicted Viral1004Open in IMG/M
3300020141|Ga0211732_1184884Not Available621Open in IMG/M
3300020205|Ga0211731_10922221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage776Open in IMG/M
3300021956|Ga0213922_1002492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6274Open in IMG/M
3300021962|Ga0222713_10028995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4495Open in IMG/M
3300021962|Ga0222713_10145562Not Available1641Open in IMG/M
3300021963|Ga0222712_10001025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage35812Open in IMG/M
3300021963|Ga0222712_10034617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3944Open in IMG/M
3300021963|Ga0222712_10130113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1723Open in IMG/M
3300021963|Ga0222712_10211010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1264Open in IMG/M
3300021963|Ga0222712_10760756Not Available538Open in IMG/M
3300022407|Ga0181351_1005219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4933Open in IMG/M
3300023184|Ga0214919_10831156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage500Open in IMG/M
3300025595|Ga0208248_1000995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8008Open in IMG/M
3300025645|Ga0208643_1076375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage964Open in IMG/M
3300025732|Ga0208784_1065809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1102Open in IMG/M
3300025896|Ga0208916_10009419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3809Open in IMG/M
3300025896|Ga0208916_10020529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2611Open in IMG/M
3300025896|Ga0208916_10039856All Organisms → Viruses → Predicted Viral1908Open in IMG/M
3300025896|Ga0208916_10071877All Organisms → Viruses → Predicted Viral1440Open in IMG/M
3300025896|Ga0208916_10341827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300027708|Ga0209188_1144934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage902Open in IMG/M
3300027733|Ga0209297_1001292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14576Open in IMG/M
3300027733|Ga0209297_1100651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1238Open in IMG/M
3300027734|Ga0209087_1008546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5345Open in IMG/M
3300027736|Ga0209190_1000296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage36299Open in IMG/M
3300027736|Ga0209190_1000999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage20184Open in IMG/M
3300027736|Ga0209190_1005413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8172Open in IMG/M
3300027736|Ga0209190_1010620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5499Open in IMG/M
3300027736|Ga0209190_1047026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2207Open in IMG/M
3300027736|Ga0209190_1054786Not Available1994Open in IMG/M
3300027736|Ga0209190_1085366All Organisms → Viruses → Predicted Viral1490Open in IMG/M
3300027749|Ga0209084_1077565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1513Open in IMG/M
3300027749|Ga0209084_1314384Not Available585Open in IMG/M
3300027759|Ga0209296_1000389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage37962Open in IMG/M
3300027759|Ga0209296_1001614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17015Open in IMG/M
3300027759|Ga0209296_1354948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
3300027763|Ga0209088_10016818All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3840Open in IMG/M
3300027763|Ga0209088_10288751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300027764|Ga0209134_10260695All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300027973|Ga0209298_10062258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1702Open in IMG/M
3300028178|Ga0265593_1024721All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1868Open in IMG/M
3300028394|Ga0304730_1146801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage953Open in IMG/M
3300031707|Ga0315291_10463903All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300031707|Ga0315291_10822802All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage805Open in IMG/M
3300031746|Ga0315293_10778880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300031772|Ga0315288_10556477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1117Open in IMG/M
3300031834|Ga0315290_11351366Not Available585Open in IMG/M
3300031834|Ga0315290_11634354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300031999|Ga0315274_10515864All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1346Open in IMG/M
3300031999|Ga0315274_10922161Not Available906Open in IMG/M
3300032046|Ga0315289_10065389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4444Open in IMG/M
3300032053|Ga0315284_11200643Not Available833Open in IMG/M
3300032053|Ga0315284_11368471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300032092|Ga0315905_10743123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage863Open in IMG/M
3300032173|Ga0315268_10259342All Organisms → Viruses → Predicted Viral1675Open in IMG/M
3300032173|Ga0315268_10912785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage882Open in IMG/M
3300032173|Ga0315268_12002710Not Available593Open in IMG/M
3300032177|Ga0315276_12178557Not Available562Open in IMG/M
3300032275|Ga0315270_10431434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300032397|Ga0315287_11443691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300032516|Ga0315273_11469338Not Available840Open in IMG/M
3300033233|Ga0334722_10868893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage637Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake38.17%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment14.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake8.40%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.58%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.29%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.53%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.76%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.76%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.76%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.76%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.76%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.76%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.76%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.76%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300011115Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016MayEnvironmentalOpen in IMG/M
3300011335Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - GumanEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019783Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300025595Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FwDRAFT_1010205523300000882Freshwater And MarineMRYREHYTIQPTARKWADIALAIAIGVGLAFFFFMGV*
Ga0049081_1034725813300005581Freshwater LenticMRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLGA*
Ga0075467_1055599423300006803AqueousMRYREHYTIQPTARKWADIALAVAIGVGLAFFFLMGV*
Ga0075464_1005232513300006805AqueousMRYREHYTIQPVTRKWADIALALTIGVGLAFFFFMGV*
Ga0075464_1012703673300006805AqueousMRYREHYIIQPVTRKWADIALAVAIGLGLATLFFFGV*
Ga0075464_1018437333300006805AqueousMRYREHYTIQPVTRKWADIALAVAIGVGLAFFFLMGA*
Ga0075464_1031362433300006805AqueousMRYREHYTIQPVTRKWADITLAVAIGVGLAFFFLMGV*
Ga0075464_1032408653300006805AqueousFRRSIMRYREHYTIQPTARKWADIALAIAIGVGLAFFFFMGV*
Ga0075464_1063523923300006805AqueousMRYREHYTIQPTTRKWAEIALAVAIGLGLATLFFFGV*
Ga0075464_1075347113300006805AqueousMRYREHYTIQPTARKWADIALALVIGVGLAFFFFMGV*
Ga0075464_1075440933300006805AqueousMRYREHYTIQPITRKWAEIALAVAIGLGLATLFFLGA*
Ga0075464_1089102433300006805AqueousMREHYTIQPVTRKWAEIALAVAIGLGLATLFFIGA*
Ga0070748_104361443300006920AqueousMRYREHYTIQPTVRKWLDVALATAIGVGLALLLVYGV*
Ga0070748_111407113300006920AqueousMRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGA*
Ga0102877_113162123300007548EstuarineMRYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGV*
Ga0102828_113845213300007559EstuarineMRYREHYTIQPVTRKWAEIALAVAIGVGLAFFFFMGV*
Ga0102859_114856313300007708EstuarineMRYREHYTIQPAIRKWANIALAVAIGVGLAFFFFMG
Ga0105747_126763923300007974Estuary WaterMREHYTIQPTTRKWADIALAVAIGLGLATLFFLGV*
Ga0108970_1044158323300008055EstuaryMRYREHYTIQPAARKWADIALALAIGVGLAFFLFMGV*
Ga0102829_115298423300009026EstuarineMRYREHYTIQPTTRKWAEIALAVAIGVGLAFFFFMGV*
Ga0114973_10002196103300009068Freshwater LakeMRYREHYTIQPVTRKWADIAMAVAIGLGLATLFFLGV*
Ga0114973_1000926953300009068Freshwater LakeMRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLGA*
Ga0114973_1009752183300009068Freshwater LakeMRYREHYTIQPTARKWADIALAVSIGVGLAFFFLMGV*
Ga0114962_1003750763300009151Freshwater LakeMREHYTIQPVTRKWADIALAVAIGVGLAFFLFMGA*
Ga0114962_1005322233300009151Freshwater LakeMRYREHYTIQPVYRKWADIALAVAIGLGLATLFFFGV*
Ga0114962_1016707343300009151Freshwater LakeMRYREHYTIQPIARKWADIALAVAIGVGLAFFFLMGV*
Ga0114962_1059257813300009151Freshwater LakeMRYREHYTIQPVYRKWADIALAVAIGLGLATLFFLGA*
Ga0114980_1042024333300009152Freshwater LakeMRYREHYTIQPVTRKWADIALAIAIGIVMAFFLFMGA*
Ga0114963_1047804913300009154Freshwater LakeMRYREHYTIQPVTRKWAEIVLAMAIGLGLATFFFFG
Ga0114977_10003987103300009158Freshwater LakeMRYREHYTIQPVTRKWADIALALAIGVGLAFFFFMGV*
Ga0114977_1006235833300009158Freshwater LakeMRYSEHYTIQPTIRKWAEIALAVAIGLGLATLFFFGV*
Ga0114977_1010025053300009158Freshwater LakeMRYREHYTIQPVTRKWAEIALALAIGVGLAFFLFMGV*
Ga0114981_1004844333300009160Freshwater LakeMRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA*
Ga0114981_1016005723300009160Freshwater LakeMRYREHYTIQPVIRKWADIALAVAIGLGLATLFFFGV*
Ga0114970_10007887113300009163Freshwater LakeMREHYTIQPTIRKWADIALAVAIGLGLATLFFFGV*
Ga0114970_1003063773300009163Freshwater LakeMRYREHYTIQPTARKWADLALALAIGVGLAFFFFMGV*
Ga0114970_1004383563300009163Freshwater LakeMRYREHYTIQPTTRKWADIALAVAIGVGLAFFFLMGV*
Ga0114970_1009587933300009163Freshwater LakeMRYREHYTIQPAIRKWADIALAVLIGIVMAFFLFMGA*
Ga0114970_1051799623300009163Freshwater LakeMRYREHYTIQPAIRKWADIALAVAIGVGLAFFFFMGV*
Ga0114975_10000376163300009164Freshwater LakeMRYREHYTIQPAIRKWADIALAIAIGVGLAFFFLMGV*
Ga0114975_1027905123300009164Freshwater LakeMRYREHYTIQPVTRKWADLALALAIGVGLAFFFLMGV*
Ga0114979_1014828323300009180Freshwater LakeVRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA*
Ga0114979_1015553633300009180Freshwater LakeMRYREHYTIQPTARKWADIALAIAIGIVMAFFLFMGV*
Ga0114979_1021957333300009180Freshwater LakeMRYREHYTIQPTTRKWADIALAIAIGVGLAFFFLMGA*
Ga0114974_1011762543300009183Freshwater LakeMRYREHYTIQPVTRKWADLALALAIGIGLAFFFFMGV*
Ga0114958_1043617423300009684Freshwater LakeMRYREHYTIQPTAQKWLDVALATAISVGLALLLVYGV*
Ga0114964_1005304653300010157Freshwater LakeMRYREHYTIQPTARKWLDVALAMAIGVGFALLLVYGV*
Ga0114967_1014990323300010160Freshwater LakeMRYREHYTIQPTARKWADIALATAIGIGLALLLVYGV*
Ga0136644_1011549243300010334Freshwater LakeMRYREHYTIQPAIRKWADIALAVAIGLGLATLFFFGV*
Ga0133913_1320647713300010885Freshwater LakeMREHYTIQPTIRKWSEIALAVAIGLGLATLFFLGV*
Ga0129318_1019329223300011009Freshwater To Marine Saline GradientMRYREHYTIQPIARKWADLALALAIGVGLAFFFFMGV*
Ga0151514_10082103300011115FreshwaterMRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFIGV*
Ga0151514_10082593300011115FreshwaterMRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGV*
Ga0151514_1039273300011115FreshwaterMRYREHYTIQPTARKWLDIALATAIGVGLALLLVYKV*
Ga0153698_1669123300011335FreshwaterMRYREHYTIQPIIRKWAEIALAVAIGVGLAILFFMGA*
Ga0153698_171043300011335FreshwaterMREHYTIQPTTRKWADIALAVAIGVGLAFFFFMGV*
Ga0164294_1087211623300013006FreshwaterMRYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGA*
Ga0164295_1092290123300013014FreshwaterMRYREHYTIQPTIRKWADIALAVAIGLGLATLFFFGV*
Ga0177922_1095733413300013372FreshwaterMRYREHYTIQPVTRKWADIGLAVAIGLGLATLFFLGV*
Ga0181347_107099943300017722Freshwater LakeMREHYTIQPVTRKWADIALAVAIGLGLATFFFLGV
Ga0181365_105018543300017736Freshwater LakeMRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLGA
Ga0181357_119532223300017777Freshwater LakeMREHYTIQPVTRKWADIALAVAIGLGLATLFFLGV
Ga0181348_125349223300017784Freshwater LakeMRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLG
Ga0181355_110153533300017785Freshwater LakeMREHYTIQPVTRKWADIALAIAIGVGLAFFFFMGV
Ga0181355_125103823300017785Freshwater LakeMRYREHYTIQPVYRKWADIALAVTIGIGLAFFFFMGA
Ga0181553_1008296843300018416Salt MarshMRYREHYTIQPTSRKWADIALAIAIGVALAFFFFMGV
Ga0181361_11145013300019783Freshwater LakeYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGA
Ga0181359_1000233133300019784Freshwater LakeMRYREHYTIQPTIRKWADIALAVAIGLGLATLFFLGA
Ga0181359_110925043300019784Freshwater LakeMREHYTIQPTARKWADIALAITIGIGLAFFFFMGA
Ga0211732_118488413300020141FreshwaterMRYREHYTIQPVTRKWADIALAVAIGVGLAFFLFMGV
Ga0211731_1092222123300020205FreshwaterMREHYTIQPVIRKWADIALAVAIGVGLAFFFFMGA
Ga0213922_100249253300021956FreshwaterMRYREHYTIQPATRRWAEIALAVAIGLGLAVLFFFGA
Ga0222713_10028995103300021962Estuarine WaterMRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGA
Ga0222713_1014556243300021962Estuarine WaterMRYREHYTIQPVTRKWADIALAVAIGVGLATLFFLGA
Ga0222712_10001025343300021963Estuarine WaterMRYREHYTIQPVTRKWAEIALALAIGVGLAFFLFMGV
Ga0222712_10034617133300021963Estuarine WaterMRYREHYTIQPAARKWADIALALAIGVGLAFFLFMGV
Ga0222712_1013011343300021963Estuarine WaterMRYREHYTIQPVTRKWADLALALVIGVGLAFFFFMGV
Ga0222712_1021101053300021963Estuarine WaterMRYREHYTIQPTTRKWADIALAIAIGVGLAFFFLMGV
Ga0222712_1076075613300021963Estuarine WaterMRYREHYTIQPTIRKWADVALAVAIGFGLAILFFFGV
Ga0181351_100521953300022407Freshwater LakeMRYREHYTIQPVYRKWADIALAVAIGVGLAFFFFMGA
Ga0214919_1083115613300023184FreshwaterMRYREHYTIQPTARKWADIALAIAIGGGLAFFLFMGV
Ga0208248_100099563300025595FreshwaterMRYREHYTIQPVTRKWAEIVLAMAIGLGLATLFFFGA
Ga0208643_107637513300025645AqueousMRYREHYTIQPTVRKWLDVALATAIGVGLALLLVYGV
Ga0208784_106580923300025732AqueousMRYREHYTIQPTTLKWADLALALAIGVGLAFFLFMGV
Ga0208916_1000941963300025896AqueousMRYREHYTIQPVTRKWADLALALAIGVGLAFFFFMGV
Ga0208916_1002052933300025896AqueousMRYREHYTIQPVTRKWADIALAVAIGVGLAFFFFMGA
Ga0208916_1003985613300025896AqueousMRYREHYIIQPVTRKWADIALAVAIGLGLATLFFFGV
Ga0208916_1007187713300025896AqueousMRYREHYTIQPVTRKWADIALALTIGVGLAFFFFMGV
Ga0208916_1034182743300025896AqueousMRYREHYTIQPTARKWADIALAIAIGVGLAFFFFMGV
Ga0209188_114493433300027708Freshwater LakeMRYREHYTIQPVYRKWADIALAVAIGLGLATLFFFGV
Ga0209297_1001292173300027733Freshwater LakeMRYREHYTIQPVTRKWADIALALAIGVGLAFFFFMGV
Ga0209297_110065143300027733Freshwater LakeMRYSEHYTIQPTIRKWAEIALAVAIGLGLATLFFFGV
Ga0209087_1008546133300027734Freshwater LakeMRYREHYTIQPAIRKWADIALAIAIGVGLAFFFLMGV
Ga0209190_1000296243300027736Freshwater LakeMRYREHYTIQPVTRKWADIAMAVAIGLGLATLFFLGV
Ga0209190_1000999153300027736Freshwater LakeMRYREHYTIQPTARKWADIALAVSIGVGLAFFFLMGV
Ga0209190_1005413113300027736Freshwater LakeMRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLGA
Ga0209190_101062063300027736Freshwater LakeMRYREHYTIQPAIRKWADIALAVLIGIVMAFFLFMGA
Ga0209190_104702623300027736Freshwater LakeMREHYTIQPTIRKWADIALAVAIGLGLATLFFFGV
Ga0209190_105478653300027736Freshwater LakeMRYREHYTIQPTVRKWLDVALATAIGVGLALLLFYGV
Ga0209190_108536643300027736Freshwater LakeMRYREHYTIQPTARKWADLALALAIGVGLAFFFFMGV
Ga0209084_107756523300027749Freshwater LakeMREHYTIQPVTRKWADIALAVAIGVGLAFFLFMGA
Ga0209084_131438423300027749Freshwater LakeMRYREHYTIQPIARKWADIALAVAIGVGLAFFFLMGV
Ga0209296_100038973300027759Freshwater LakeMRYREHYTIQPTAQKWLDVALATAIGVSFALLLVYGV
Ga0209296_100161473300027759Freshwater LakeMRYREHYTIQPVTRKWADLALALAIGIGLAFFFFMGV
Ga0209296_135494823300027759Freshwater LakeVRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA
Ga0209088_1001681883300027763Freshwater LakeMRYREHYTIQPAIRKWADIALAIAIGIVMAFFLFMGA
Ga0209088_1028875133300027763Freshwater LakeMRYREHYTIQPTARKWADIALAIAIGIVMAFFLFMGV
Ga0209134_1026069523300027764Freshwater LakeMRYREHYTIQPVTRKWADIALAVAIGLGLATLFFLGV
Ga0209298_1006225853300027973Freshwater LakeMRYREHYTIQPVTRKWADIALAIAIGIVMAFFLFMGA
Ga0265593_102472153300028178Saline WaterMRYREHYTIQPVIRKWADIALAVVIGVGLAFFFFMGV
Ga0304730_114680113300028394Freshwater LakeMRYREHYTIQPTARKWADIALATAIGIGLALLLVYGV
Ga0315291_1046390353300031707SedimentMRYREHYTIQPTARKWADIVLAVAIGVGLAFFFFMGV
Ga0315291_1082280213300031707SedimentVRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGV
Ga0315293_1077888023300031746SedimentMRYREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGV
Ga0315288_1055647743300031772SedimentMRYREHYTIQPVYRKWAEIALAVAIGLGLATLFFFGV
Ga0315290_1135136623300031834SedimentMRYREHYTIQPAIRKWADIALAVAIGVGLAFFFFMGV
Ga0315290_1163435423300031834SedimentMRYREHYTIQPVIRKWADIALAIAIGVGLAFFFFMGA
Ga0315274_1051586433300031999SedimentVRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGA
Ga0315274_1092216143300031999SedimentMRYREHYTIQPTARKWADIALAVAIGVGLAFFFFMGV
Ga0315289_1006538913300032046SedimentMRYREHYTIQPVIRKWADIALAVAIGVGLAFFFFMGA
Ga0315284_1120064313300032053SedimentMRYREHYTIQKTIRKWADIALAVAIGVGLAVLFFIGV
Ga0315284_1136847123300032053SedimentMRYREHYTIQPIARKWADIALAVAIGVGLAFFFFMGV
Ga0315905_1074312333300032092FreshwaterMRYREHYTIQPVTRKWADIGLAVAIGLGLATLFFLGV
Ga0315268_1025934223300032173SedimentMRYREHYTIQPAIRKWADLALAVAIGVGLAFLFFMGA
Ga0315268_1091278533300032173SedimentMRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLG
Ga0315268_1200271023300032173SedimentMREHYTIQPVYRKWADIALAIAIGVGLAFFFFMGV
Ga0315276_1217855733300032177SedimentYGPIFRRSIMRYREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGV
Ga0315270_1043143433300032275SedimentMRYREHYTIQPVTRKWAEIALAVAIGLGLATLFFLGV
Ga0315287_1144369133300032397SedimentMRDREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGA
Ga0315273_1146933823300032516SedimentMRYREHYTIQKTIRKWADIALAVAIGVGLAFFFFMGA
Ga0334722_1086889323300033233SedimentMRYREHYTIQKTIRKWADIVLAVAIGVGLAFFFFMGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.