NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061684

Metagenome / Metatranscriptome Family F061684

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061684
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 73 residues
Representative Sequence MSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRRALQDQIRGQKETILKLEQEKQRLEAYLK
Number of Associated Samples 109
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.60 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 84.73 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.305 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(25.191 % of family members)
Environment Ontology (ENVO) Unclassified
(54.962 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.64%    β-sheet: 0.00%    Coil/Unstructured: 39.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF00691OmpA 6.87
PF13561adh_short_C2 1.53
PF05016ParE_toxin 1.53
PF12704MacB_PCD 1.53
PF12831FAD_oxidored 0.76
PF13091PLDc_2 0.76
PF05193Peptidase_M16_C 0.76
PF14294DUF4372 0.76
PF05170AsmA 0.76
PF13620CarboxypepD_reg 0.76
PF01609DDE_Tnp_1 0.76
PF13360PQQ_2 0.76
PF02954HTH_8 0.76
PF00306ATP-synt_ab_C 0.76
PF00801PKD 0.76
PF00133tRNA-synt_1 0.76
PF00144Beta-lactamase 0.76
PF16499Melibiase_2 0.76
PF00675Peptidase_M16 0.76
PF06580His_kinase 0.76
PF03631Virul_fac_BrkB 0.76
PF13380CoA_binding_2 0.76
PF12904Collagen_bind_2 0.76
PF13649Methyltransf_25 0.76
PF02894GFO_IDH_MocA_C 0.76
PF14018DUF4234 0.76
PF01527HTH_Tnp_1 0.76
PF04397LytTR 0.76
PF03807F420_oxidored 0.76
PF012572Fe-2S_thioredx 0.76
PF064393keto-disac_hyd 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG0055FoF1-type ATP synthase, beta subunitEnergy production and conversion [C] 0.76
COG0056FoF1-type ATP synthase, alpha subunitEnergy production and conversion [C] 0.76
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.76
COG1155Archaeal/vacuolar-type H+-ATPase catalytic subunit A/Vma1Energy production and conversion [C] 0.76
COG1156Archaeal/vacuolar-type H+-ATPase subunit B/Vma2Energy production and conversion [C] 0.76
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.76
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.76
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.76
COG1905NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)Energy production and conversion [C] 0.76
COG2367Beta-lactamase class ADefense mechanisms [V] 0.76
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.76
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.76
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.76
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 0.76
COG3293TransposaseMobilome: prophages, transposons [X] 0.76
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.76
COG5421TransposaseMobilome: prophages, transposons [X] 0.76
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.76
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.31 %
UnclassifiedrootN/A39.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_100302127All Organisms → cellular organisms → Bacteria → Acidobacteria1031Open in IMG/M
3300004092|Ga0062389_103448198Not Available593Open in IMG/M
3300005167|Ga0066672_10183416Not Available1328Open in IMG/M
3300005330|Ga0070690_101151070All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005437|Ga0070710_10523633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae815Open in IMG/M
3300006800|Ga0066660_10818961Not Available758Open in IMG/M
3300006864|Ga0066797_1157411All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300006914|Ga0075436_101312784Not Available547Open in IMG/M
3300009029|Ga0066793_10289822All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300009157|Ga0105092_10016135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3926Open in IMG/M
3300009548|Ga0116107_1029733All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300009617|Ga0116123_1036035All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300009629|Ga0116119_1079285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4831Open in IMG/M
3300009631|Ga0116115_1011912All Organisms → cellular organisms → Bacteria → Acidobacteria2635Open in IMG/M
3300009634|Ga0116124_1187475All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009640|Ga0116126_1120536Not Available910Open in IMG/M
3300009646|Ga0116132_1127549All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300009700|Ga0116217_10980787Not Available517Open in IMG/M
3300009839|Ga0116223_10380473Not Available833Open in IMG/M
3300009839|Ga0116223_10679665Not Available592Open in IMG/M
3300010379|Ga0136449_103330001Not Available617Open in IMG/M
3300014151|Ga0181539_1030442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2799Open in IMG/M
3300014155|Ga0181524_10373424All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300014165|Ga0181523_10143366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1410Open in IMG/M
3300014169|Ga0181531_10698367Not Available631Open in IMG/M
3300014199|Ga0181535_10559555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4658Open in IMG/M
3300014199|Ga0181535_10637703Not Available609Open in IMG/M
3300014200|Ga0181526_10144302All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300014200|Ga0181526_10936410Not Available545Open in IMG/M
3300014489|Ga0182018_10346980Not Available800Open in IMG/M
3300014490|Ga0182010_10449140Not Available708Open in IMG/M
3300014492|Ga0182013_10389265Not Available751Open in IMG/M
3300014494|Ga0182017_10365883All Organisms → cellular organisms → Bacteria → Acidobacteria896Open in IMG/M
3300014499|Ga0182012_10824430All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300014502|Ga0182021_11960609All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300014502|Ga0182021_13732215Not Available505Open in IMG/M
3300014839|Ga0182027_10062355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter4610Open in IMG/M
3300014839|Ga0182027_11057892All Organisms → cellular organisms → Bacteria → Acidobacteria826Open in IMG/M
3300014839|Ga0182027_11890029Not Available575Open in IMG/M
3300015195|Ga0167658_1000082All Organisms → cellular organisms → Bacteria → Acidobacteria66309Open in IMG/M
3300015197|Ga0167638_1019642All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.Bin5201582Open in IMG/M
3300017931|Ga0187877_1147314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4948Open in IMG/M
3300017931|Ga0187877_1418818Not Available505Open in IMG/M
3300017934|Ga0187803_10203125Not Available781Open in IMG/M
3300017935|Ga0187848_10163261Not Available974Open in IMG/M
3300017938|Ga0187854_10161340All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300017940|Ga0187853_10076600All Organisms → cellular organisms → Bacteria → Acidobacteria1672Open in IMG/M
3300017941|Ga0187850_10009776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium6316Open in IMG/M
3300017941|Ga0187850_10084782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1560Open in IMG/M
3300017946|Ga0187879_10151911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1310Open in IMG/M
3300017946|Ga0187879_10290368All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006909Open in IMG/M
3300017988|Ga0181520_11154606Not Available505Open in IMG/M
3300017998|Ga0187870_1141998Not Available885Open in IMG/M
3300018002|Ga0187868_1207462Not Available678Open in IMG/M
3300018004|Ga0187865_1161335All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300018005|Ga0187878_1023069All Organisms → cellular organisms → Bacteria3203Open in IMG/M
3300018005|Ga0187878_1201320All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300018013|Ga0187873_1041595All Organisms → cellular organisms → Bacteria2059Open in IMG/M
3300018015|Ga0187866_1060647All Organisms → cellular organisms → Bacteria → Acidobacteria1677Open in IMG/M
3300018016|Ga0187880_1008569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6942Open in IMG/M
3300018017|Ga0187872_10432217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300018018|Ga0187886_1121812All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300018020|Ga0187861_10026315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3360Open in IMG/M
3300018020|Ga0187861_10194492Not Available910Open in IMG/M
3300018021|Ga0187882_1034295All Organisms → cellular organisms → Bacteria2572Open in IMG/M
3300018021|Ga0187882_1122684Not Available1083Open in IMG/M
3300018025|Ga0187885_10359022Not Available655Open in IMG/M
3300018030|Ga0187869_10051088Not Available2182Open in IMG/M
3300018033|Ga0187867_10063390Not Available2195Open in IMG/M
3300018033|Ga0187867_10133399All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300018034|Ga0187863_10282012All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300018038|Ga0187855_10145341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1416Open in IMG/M
3300018038|Ga0187855_10163861All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300018040|Ga0187862_10123115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1774Open in IMG/M
3300018043|Ga0187887_10009211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6786Open in IMG/M
3300018046|Ga0187851_10179393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1268Open in IMG/M
3300019787|Ga0182031_1121694Not Available1253Open in IMG/M
3300021178|Ga0210408_10911778Not Available684Open in IMG/M
3300021420|Ga0210394_10018138All Organisms → cellular organisms → Bacteria6598Open in IMG/M
3300021432|Ga0210384_10369483All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300021559|Ga0210409_10480807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1104Open in IMG/M
3300021559|Ga0210409_11409278Not Available573Open in IMG/M
3300022724|Ga0242665_10109956Not Available829Open in IMG/M
3300022830|Ga0224515_1004220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium2316Open in IMG/M
3300023068|Ga0224554_1046150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium1158Open in IMG/M
3300023075|Ga0224520_1151262Not Available506Open in IMG/M
3300023091|Ga0224559_1276674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium561Open in IMG/M
3300024240|Ga0224522_1162403All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300025324|Ga0209640_10984973Not Available650Open in IMG/M
3300025409|Ga0208321_1023247All Organisms → cellular organisms → Bacteria → Acidobacteria1102Open in IMG/M
3300025419|Ga0208036_1015037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1690Open in IMG/M
3300025419|Ga0208036_1034026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4941Open in IMG/M
3300025448|Ga0208037_1009993All Organisms → cellular organisms → Bacteria → Acidobacteria2658Open in IMG/M
3300025448|Ga0208037_1048817All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300025460|Ga0208562_1008565All Organisms → cellular organisms → Bacteria2659Open in IMG/M
3300025460|Ga0208562_1073841All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300025576|Ga0208820_1077230Not Available859Open in IMG/M
3300026375|Ga0256803_1046484Not Available528Open in IMG/M
3300027604|Ga0208324_1108246Not Available773Open in IMG/M
3300027812|Ga0209656_10390822Not Available625Open in IMG/M
3300027842|Ga0209580_10111265All Organisms → cellular organisms → Bacteria → Acidobacteria1330Open in IMG/M
3300028747|Ga0302219_10212894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. 17-2-E-8746Open in IMG/M
3300028783|Ga0302279_10317571Not Available678Open in IMG/M
3300029636|Ga0222749_10709074Not Available551Open in IMG/M
3300029918|Ga0302143_1074032Not Available791Open in IMG/M
3300029943|Ga0311340_10793338Not Available800Open in IMG/M
3300029944|Ga0311352_10336058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1250Open in IMG/M
3300029986|Ga0302188_10317022Not Available643Open in IMG/M
3300030002|Ga0311350_11244991Not Available663Open in IMG/M
3300030503|Ga0311370_11712390All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300030520|Ga0311372_11401671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans872Open in IMG/M
3300030617|Ga0311356_11755579All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300030978|Ga0265757_109974Not Available536Open in IMG/M
3300031232|Ga0302323_102853622Not Available552Open in IMG/M
3300031234|Ga0302325_13413576All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031236|Ga0302324_100418018All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1992Open in IMG/M
3300031236|Ga0302324_102503526Not Available630Open in IMG/M
3300031236|Ga0302324_102612798All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300031525|Ga0302326_11989232Not Available751Open in IMG/M
3300031708|Ga0310686_108079727All Organisms → cellular organisms → Bacteria2732Open in IMG/M
3300031754|Ga0307475_10397989All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300031754|Ga0307475_10570533All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031902|Ga0302322_102728990Not Available609Open in IMG/M
3300033402|Ga0326728_11040334Not Available562Open in IMG/M
3300033405|Ga0326727_10688363All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300033513|Ga0316628_100741008All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300033513|Ga0316628_104062144Not Available522Open in IMG/M
3300033825|Ga0334843_043744All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300033983|Ga0371488_0578632All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300034070|Ga0334822_057835Not Available836Open in IMG/M
3300034124|Ga0370483_0216674All Organisms → cellular organisms → Bacteria653Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland25.19%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland11.45%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.40%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.34%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen5.34%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.34%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.29%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.29%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.29%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.29%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.53%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.53%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.76%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.76%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.76%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022830Peat soil microbial communities from Stordalen Mire, Sweden - IR.F.S.T-25EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300024240Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025409Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300026375Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS6EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030978Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033825Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10030212713300004091Bog Forest SoilMRNARSFPFRSFVWSMFLVAVAAAGIYLAYEMVVKPQRALQDQIREQQ
Ga0062389_10344819813300004092Bog Forest SoilMSSGRHLPIQLVLWSVVLVAAAAVSIYLGYELVILPRRVLQDQIREQKETIVKLEQDKQRLEAYLKILKHVDRRARVEVLRQGRDQQGNLQSTIRFTETDAGGKPITVSRDLTLPSQEVY
Ga0066672_1018341613300005167SoilMRNGRHFPIQLFVWSVALVVAAAVSIYLAYELVIAPRQALQDQIRAQKDTIVRLEQEKQRLEAYLKILKHTDRRARVEVLRQAKDPQGNLQTTIRFTETDATGKPINIS
Ga0070690_10115107023300005330Switchgrass RhizosphereMGSERHFSAFSFVQSILVVGVAAAGIYLSYEFVVKPRRELQDQIRDQKETIGKLEKEKQRLEAYLKILKHIERRA
Ga0070710_1052363313300005437Corn, Switchgrass And Miscanthus RhizosphereMSNSRPLSIRLLVWSAVLLAIVTASVYLSYELVVKPRRALQDQIREQKETIAKLEQDKQRLEAYLKILKHIDR
Ga0066660_1081896113300006800SoilMRNGRHFPIQLFVWSVALVVAAAVSIYLAYELVIAPRQALQDQIRAQKDTIVRLEQEKQRLEAYLKILKHTDRRARVEVLRQAKDPQGNLQTTIRFTETD
Ga0066797_115741113300006864SoilMSSGRHFPIRSFVGSVVLVAFAAASVYLSYELVVKPRLALQDQIREQKGTILKLEQEKQRLEAYLKILKHIDRRARVEVL
Ga0075436_10131278423300006914Populus RhizosphereMSNGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRRALQDQIREQKGTILKLEQE
Ga0066793_1028982213300009029Prmafrost SoilMSSGRHFPIRSFVGSVVLVAFAAASVYLSYELVVKPRLALQDQIREQKGTILKLEQEKQRLEAYLKILKHIDRRARVEVLRQAKDQQG
Ga0105092_1001613513300009157Freshwater SedimentMHERRSFPFSLFFWSIVLVAVGAGSIYLAYQFVVKPQRALQNQILEQKETI
Ga0116107_102973343300009548PeatlandMSNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILKRIDRRARI
Ga0116123_103603513300009617PeatlandMSNGRPFPIRSFVWSVLLVAVAAAGIYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILKHID
Ga0116119_107928523300009629PeatlandMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRALQDQIRGQQETILKLEQEKQRLEAYLKILKRIDRRARVEVLRQA
Ga0116115_101191233300009631PeatlandMSNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILKR
Ga0116124_118747513300009634PeatlandMSNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKI
Ga0116126_112053633300009640PeatlandMRNDRPFPIRSFVWSVMLVAVAAAGIYLAYELVVKPQRALQDQISQQKETILKLEQDKQ
Ga0116132_112754933300009646PeatlandVAARIANRGADMSGGRHFPIRSFVASVVLVAVAADSVYLSYELVVKPRRALQDQIREQGVTIL
Ga0116217_1098078713300009700Peatlands SoilMSNGRHFPIQLFVWSVGLVAVAAVSVYLAYELVIVPRRALQDQLREQKETIVKLEQENQRLEAYLKILKHIDRRARVEVLRQTRDQQG
Ga0116223_1038047333300009839Peatlands SoilMSSGRHFPIRSFVWSVVLVAVATASVYLSYELVVKPRRALQDQIRGQKETILKLEQEKQR
Ga0116223_1067966523300009839Peatlands SoilMMEVLVQDPMSNSRPFPIWSFVKSVVLVAVGAAAVHLAYELVVKPRQALTEQIREQKETIVK
Ga0136449_10333000113300010379Peatlands SoilMSNGRHFPIQSFLWSVVLVAVAAVSVYLGYEMVIVPRRALQDQIREQKETIVKLEQEKQRLEAYLKILKHVDRRAHVEVLRQARDQQGNLQTTIRFTETDSSGKPVSVSRELTLPGQEVY
Ga0181539_103044213300014151BogMSSGGHFPIRSFIGSVVLVAVAAASVYLSYELVVKPRRELQDQIRGQKETILKLEQEKQRLEAYLKIL
Ga0181524_1037342423300014155BogMINYRPFPIRSFVWSVALVTVAAAGIYLAYELVVKPQRALQDQISQQKETILRLDQENQ
Ga0181523_1014336623300014165BogMSNGRHFPIQLFVWTVGLVAVAAVSVYLAYELVIVPRRALQDQLREQKETIVKLEQENQRLEAYLKILKHIERRARVEVLRQTRDQQGNLQTATPFTET
Ga0181531_1069836723300014169BogMSNGRHFPVQLMIWTVTLVAVVTVGVYLAYELVVLPRQALQNQIREQKDTIVKLEQDKQRLEAYLKILKHIDRRARVEVLRQANDLEGNLQTTIRFTETDDTGKPVSVSRELTLPGQEVYFDTLVIKF
Ga0181535_1055955513300014199BogMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRALQDQIRGQQETILKLEQEKQRLEAYLKI
Ga0181535_1063770313300014199BogMSGGRHFPIRSFVASVVLVAVAAASVYLSYELVVKPRRALQDQIRAQQGTILKLQQEKQRLEAYLKILKRIDRRARVEVL
Ga0181526_1014430213300014200BogMSNGRHFPIQLFVWTVGLVAAAAVSVYLAYELVIVPRRALQDQLREQKETIVKLEQENQRLEAYLKILKHIERRAQRLHVLVVAGKG*
Ga0181526_1093641013300014200BogMSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQRLEAYLKILKRIDRR
Ga0182018_1034698013300014489PalsaMSDGRHLPIQSLLWSVVLVAVATGSVYLAYELVIVPRRALQDQIRDQKATIVKIEQEKQRLEAYLTILKHTDRRARVEVLRQAKNPQGNLQTTIRFTETDSTGKPISVSRELTLPGQEVY
Ga0182010_1044914023300014490FenMAEARPAERLADVEVPPMSGDRHFPIRSFVASIVLVAFAAASVYLSYELVVKPRLALQDQIREQKGTILKLEQDKQRLEAYLKILKRIDRRARVEVLRQ
Ga0182013_1038926523300014492BogMSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRRALQDQIRGQKETILKLEQEKQRLEAYL
Ga0182017_1036588333300014494FenMSSGRHFPIRSFAASVVLVAVAAASVYLAYELVVKPRLALQEQIRAQQGTILKLEQENQR
Ga0182012_1082443013300014499BogMSDGRHFPIQPLLWTAVLAAAAAAGVYLAYEMVVLPRRVLQDQIREQKDAIVKLEQEKQRLEVYLAILKHTDRRA
Ga0182021_1196060933300014502FenMSSGRHFPIRSFVASVVLVAVAAASVYLAYELVVKPRLALQNQIREQQGTILKLQQ
Ga0182021_1373221513300014502FenMSSGREFPIRSFVASVVLVAVAAASVYLSYELVVKPRRALQDQIREQKGTILKLEQEKQRLEAYLKILKRIDRRAR
Ga0182027_1006235513300014839FenMSDGRHFPIQSFLWSAVLAAVAAGSIYLAYQLVIVPRRALQDQIREQKDTIVKLEQEKQRLEAYLTILKHIDRRARVEVLRQAKDQQGNLQTTIRFT
Ga0182027_1105789213300014839FenMGNDRPFPIRLFVWSMVLVAVAAAGIYLAYELVVKPQRALQDQISEQKKTILK
Ga0182027_1189002913300014839FenMSSGRHFPIRSFVGSVVLVAVAAASVYLAYELVVKPRQALQDQIRGQKETILKLEQEKQRLEAYLKILKRIDR
Ga0167658_1000082473300015195Glacier Forefield SoilMKWAVVLVAIAAASIYLSYEFAVKPRRALQDQIREQKETIVKLEQEKQKLEAYLKILKRIDRRARVEVLRQANDPQGNLQTTIRFTGN*
Ga0167638_101964223300015197Glacier Forefield SoilMSNGRHFPIQSFVWSVVLVAVAAVSVYLAYEMVIVPRRALQDQIREQKDTIVKLEQEKQR
Ga0187877_114731433300017931PeatlandMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRELQDQIRGQKETILKLEQEKQRLEA
Ga0187877_141881813300017931PeatlandMSNGRHFPIQLFVWSVGLVAVAAVSVYLAYELVIVPRRALQDQLREQKETIVKLEQEKQRLEAYLKILKHIDRRARVEVLR
Ga0187803_1020312513300017934Freshwater SedimentMSNGRPFPFRLFVWSVVLVAVAATGIYLSYELVVKPQRALQDQILAQQETILKLEQDKQRLE
Ga0187848_1016326123300017935PeatlandMPADKDRPFPIRLFLWSVVVVAVSAVGIYLAYELVVKPQRALQDQISEQKETILKL
Ga0187854_1016134013300017938PeatlandMGNDRPFPIRLFVWSVVLVAVAAAGIYLAYELVVKPQRALQDQISEQKETILRLVQEKQRLEA
Ga0187853_1007660023300017940PeatlandMGNDRPYPIRLFIWSVALVTVAAAGIYLAYELVVKPQRALQDQISEQKETILKL
Ga0187850_1000977653300017941PeatlandMGNDRPYPIRLFIWSVALVTVAAAGIYLAYELVVKPQRALQDQISEQKETILR
Ga0187850_1008478233300017941PeatlandVAARIANRGADMSGGRHFPIRSSVASVVLVAVAAASVYLSYELVVKPRRALQDQIREQGVTILKLQQ
Ga0187879_1015191143300017946PeatlandMSSDRHFPIRSFIGSVVLVAVAAASVYLSYELVVKPRRALQDQIRAQQGTILKLQQEKQRLEAYL
Ga0187879_1029036823300017946PeatlandMSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRRALQDQIRGQKETILKLEQEKQRLEAYLKILKRID
Ga0181520_1115460623300017988BogMSDGRHFPIQSFLWSAVLVAVAAGSIYLAYQLVIVPRRALQDQIRDQKDTIVKLEQEKQ
Ga0187870_114199823300017998PeatlandMGNDRPFPVRSFLWSVVLVAVAAAGIYLAYELVVKPQRALQNQISEQKETIVKLEQEKQRLEAYLKILKRIDRRARI
Ga0187868_120746213300018002PeatlandMSSGRDFPIRSLVGSVVLVAVAAASVYLSYELVVKPRRALQDQIRVQQGTILKLEQ
Ga0187865_116133523300018004PeatlandMDKDRPFPIRLFVWSVVLVAVAAAGIYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLE
Ga0187878_102306913300018005PeatlandMGNDRPYPIRLFIWSVALVTVAAAGIYLAYELVVKPQRALQDQISEQKET
Ga0187878_120132023300018005PeatlandMGNNRPFPIRSFVWSVVLVAVAAAGIYLAYELAVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILKR
Ga0187873_104159513300018013PeatlandMSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQRLEAYLKILKRIDRRARVEV
Ga0187866_106064713300018015PeatlandMGNDRPFPVRSFLWSVVLVAVAAAGIYLAYELVVKPQRALQNQISEQKETIVKLEQEKQRLEAYLKILKRIDRR
Ga0187880_100856943300018016PeatlandMSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQRLE
Ga0187872_1043221713300018017PeatlandMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRALQDQIRGQQETILKLEQEKQRLEAYLKILKRIDRRAR
Ga0187886_112181223300018018PeatlandMSNGRPFPLRLFVWSVLLVAVAAAGIYLAYELVVKPQRALQDQISEQKETILKLEQEKQR
Ga0187861_1002631513300018020PeatlandVAARIANRGADMSGGRHFPIRSFVASVVLVAVAAASVYLSYELVVKPRRALQDQIREQGVTILKLQQENQRLEAYLKILKRIDRRARVEVL
Ga0187861_1019449223300018020PeatlandMGNDRPFPVRSFLWSVVLVAVAAAGIYLAYELVVKPQRALQNQISEQKETIVKLEQEKQRLEAYLKILKRI
Ga0187882_103429513300018021PeatlandMSNGRHFPIQLFVWSVGLVAVAAVSVYLAYELVIVPRRALQEQLREQKETIVKLEQKKQRLEAYLKILKHIDR
Ga0187882_112268413300018021PeatlandMREGRPFPIRLFVWSVALVAVAAAGVYLAYEMVVKPRRELQDQIREQKGTILKLEQDKQRLEAYLKI
Ga0187885_1035902213300018025PeatlandMSSGRHFPIRSFVGSVVLVAVAAASVYLSYELVVKPRRALQDQIRGQKETILKLEQEKQRLEAYLK
Ga0187869_1005108813300018030PeatlandMGNDRPYPIRLFIWSVALVTVAAAGIYLAYELVVKPQRALQDQISEQKETILK
Ga0187867_1006339033300018033PeatlandLSNSDLHCGGVYSIAETRPSGILVHIETPVSSGRHFPIRSFVTSVVLAAVAAASVYLSYELVVKPRRALQDQIREQKGTILKLEQEKQRLEAYLKILKRIDRRARVEVLRQAKDQQGN
Ga0187867_1013339933300018033PeatlandMSSGRHFPIRSFVGSVVLVAIAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQRLEAYLKIL
Ga0187863_1028201213300018034PeatlandMSSGRHFAIRSFVGSVVLVAVAAASVYLAYELVVKPRQALQDQIRGQQETILKLEQEKQRLEAYLKILKR
Ga0187855_1014534113300018038PeatlandMSSGRHFAIRSFVGSVVLVAVAAASVYLAYELVVKPRQALQDQIRGQQETILKLEQEKQRLEAYLKILKRIDRRAR
Ga0187855_1016386113300018038PeatlandMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRALQDQIRGQQETILKLEQEK
Ga0187862_1012311513300018040PeatlandMSSDRHFPIRSFIGSVVLVAVAAASVYLSYELVLKPRRALQDQIRGQKETILKLEQEKQRLEAYLKILKRID
Ga0187887_1000921113300018043PeatlandMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRALKDQICGQQETILKLEQEK
Ga0187851_1017939333300018046PeatlandMSSGRHFAIRSFVGSVVLVAVAAASVYLAYELVVKPRQALQDQIRGQQETILKLEQEKQRLEAYLKILKRIDRRA
Ga0182031_112169433300019787BogMSSGRHFPIRSFVGSVVLVAIAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQR
Ga0210408_1091177823300021178SoilMSDARHFPIQSFLWSAVLVAVAAGSVYLAYELVIVARRALQDQIREQKDTIVRLEQEKQRLEAYLTILKHIDRRARVEVLRQDRDQQ
Ga0210394_1001813813300021420SoilMSNGRHFPIQSFVWSVVLVAAAAGSVYLAYELVIVPRRALQDQIRDQKETIGKLELEKQRLAAYLKILEHIDRRARVEVLRQTKDPQGNQQTTIQFTETDADGKPISISRELT
Ga0210384_1036948333300021432SoilMSDARHFPIQSFLWSAVLVAVAAGSVYLAYELVIVPRRALQDQIREQKDTIVKLEQEKERLEAYLTILKHIDRRARVEV
Ga0210409_1048080713300021559SoilMSDGRHFPIRSFLWSVVLVAVAAGSVYLAYELVIVPRRALQDQIREQKDTIFKLEQEKQRLEAY
Ga0210409_1140927823300021559SoilMSDGRHFPIGSLLWSAVLVAVAAGSVYLSYELVILPRRALQDQIREQKDTIVRLEQEKQRLEAYLTILKHIDRRARVEVLRQDRDQQGN
Ga0242665_1010995623300022724SoilMSNGRSFPIQSFIWSVALVAVGSASVYLGYELIVQPRREMQDQIRKQTETIGKLEQDKLRLEAYLKILKHIDRRARVEVLKQAKDPKGVL
Ga0224515_100422033300022830SoilMRNDRPFPIRLFVWSVMLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQDKQRLEAY
Ga0224554_104615023300023068SoilMRNDRPFPIRLFVWSVMLVAVAAAGVYLAYELVVKPQRALQDQISEQKE
Ga0224520_115126213300023075SoilMRNDRPFPIRLFVWSVMLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQDKQR
Ga0224559_127667423300023091SoilMSSGRHFPIRSFVGSVVLVAVATASVYLSYELVVKPRRALQDQIRGQQETILKLEQEKQ
Ga0224522_116240323300024240SoilMSGGRHFPVRSFAVSVVLVAVAAATIYLSYELIVKPRLALQNQIREQEATILKLHQENE
Ga0209640_1098497323300025324SoilMRNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQIRDQKETILKLEQEKQRLEAYLKILKHIDRRARVEVLRQ
Ga0208321_102324723300025409PeatlandMSNGRPFPLRLFVWSVLLVAVAAAGIYLAYELVVKPQRALQDQISEQKETILKL
Ga0208036_101503713300025419PeatlandMSNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILK
Ga0208036_103402613300025419PeatlandMSSGRHFPIRSFLGSVALVAVAAASVYLSYELVVKPRRALQDQIRGQQETILKLEQEKQRLEAYLKILKRIDRRARVEVLRQAKDQQGSLQTTIR
Ga0208037_100999313300025448PeatlandMSNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILKH
Ga0208037_104881733300025448PeatlandVAARIANRGADMSGGRHFPIRSSVASVVLVAVAAASVYLSYELVVKPRRALQDQIREQGVTILKLQ
Ga0208562_100856513300025460PeatlandMSNGRPFPIRLFVWSVVLVAVAAAGVYLAYELVVKPQRALQDQISEQKETILKLEQEKQRLEAYLKILKHIDRRAR
Ga0208562_107384123300025460PeatlandMGNDRPYPIRLFIWSVALVTVAAAGIYLAYELVVKPQRALQDQISEQKETILRLDQ
Ga0208820_107723033300025576PeatlandMRNDRPFPIRSLVWSVMLVAVAAAGIYLAYELVVKPQRALQDQISQQKETILKL
Ga0256803_104648413300026375SedimentMNNRGSFPIRAFIWSLVLVAVASASVYLAYELVVKPRQALQDQIREQRGIILKLEQEKQRLETFLKIL
Ga0208324_110824613300027604Peatlands SoilMSDGRHFPIQSFLWSAVLVAVAAGSVYLAYELVIVPRRALQDQIREQKDTIVKLEQEKQRLEAYLTILKHIDRRARVEVLRQAKDQQGNL
Ga0209656_1039082223300027812Bog Forest SoilMSKGRHFPIQPFVWSVALVAVAAVSVYLAYELVIVPRHALQEQIREQQEHIAKLELEKQRLEAYL
Ga0209580_1011126533300027842Surface SoilMSDGRRFPIRLIVWSVGLVAVASVSVYLAHELVIVPRRVLQNQIREQKETISKLEQEKQRLEAYLKIL
Ga0302219_1021289413300028747PalsaMSSGRQFSIRSFVGSVVLVAVAAASVYLSYELVVEPRRALQNQIREQQGTILKLEQEK
Ga0302279_1031757113300028783BogMSSGRHFPIRSFVGSVVLVAIAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQ
Ga0222749_1070907413300029636SoilMSDARHFPIQSFLWSAVLVAVAAGSVYLAYELVIVPRRALQDQIREQKDTIVKLEQEKERLEAYLTILKHIDRRARVEVLRQAKDQQGNLQTTIRFTETDSTG
Ga0302143_107403223300029918BogMSSGRHFPIRSFVGSVVLVAIAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQRLEAYLKILKRIDRRARVEVLRQ
Ga0311340_1079333823300029943PalsaMSNGRHFPIQSFVWSILLVAMAAGSGYLAYELVIAPRRAMQEQIRAQQEAIGKLEAYLKILEHIDRRARVEV
Ga0311352_1033605833300029944PalsaMSSGRQFSIRSFVGSVVLVAVAAASVYLSYELVVEPRRALQNQIREQQGTILKLEQEKQR
Ga0302188_1031702213300029986BogMSSGRHFPIRSFVGSVVLVAIAAASVYLSYELVVKPRQALQDQIRGQKETILKLEQEKQRLEAYL
Ga0311350_1124499113300030002FenMREGRPFPIRLFVWSVALVAFAAAGVYLAYEMVVKPRRELQDQIREQKGTILKLEQDKQRLEAYLKILKHIDRRARVEVLQQAKDQQ
Ga0311370_1171239023300030503PalsaMSSGRQFSIRSFVGSVVLVAVAAASVYLSYELVVEPRRALQNQIREQQGTILKLEQEKQRLEAYLKILKHIDRRARVEVLRQVK
Ga0311372_1140167113300030520PalsaMSSGRQFSIRSFVGSVVLVAVAAASVYLSYELVVEPRRALQNQIREQQGTILKLEQEKQRLEAYLKILKHIDR
Ga0311356_1175557913300030617PalsaMSSGRQFSIRSFVGSVVLVAVAAASVYLSYELVVEPRRALQNQIREQQGTILKLEQEKQRLEAYLKILKHIDRRARV
Ga0265757_10997413300030978SoilMSSGRPFPIRLFVWSWLLVAAGAAGIYLSYEMVVKPKQALQEQIRRQNETILKLE
Ga0302323_10285362213300031232FenMNRTLRAFLWSIVLVAVAAGTMYLAFELVLAPRQALQTKIREQQENIDRLEKDKQRLNAYLQILKRIDRRARVEVLRQDKDPQGKLQTTIRFTETDSAGKPIRMAR
Ga0302325_1341357623300031234PalsaMSSGRQFPIGSFVGSVVLVAVAAGSVYLSYELVVEPRRALQNQIHEQQGTILKLDQEKQRLEAYLKILKHIDRRARVEVLRQAKDDQGNLQT
Ga0302324_10041801813300031236PalsaMSDGRHFPIGSFVWSIVLVAVAAGSVYLAYEVVVVPRRAMQDQIREQKETIGKLEQDKQRLEAYLKILKHIDRR
Ga0302324_10250352613300031236PalsaMSNGRHSPIQSFVWSILLVAMAAGSGYLAYELVIAPRRAMQEQIRAQQEAIGKLEAYLKILEHIDRRARVEVLRQ
Ga0302324_10261279813300031236PalsaMSSGRQFPIGSFVGSVVLVAVAAGSVYLSYELVVEPRRALQNQIHEQQGTILKLDQEK
Ga0302326_1198923213300031525PalsaMSNGRHFPIQSFVWSILLVAMAAGSGYLAYELVIAPRRAMQEQIRAQQEAIGKLEAYLKILVHIDRRAREEVLRQTTDQRGNLQTTIRF
Ga0310686_10807972743300031708SoilMSNGRHFPIQSFLWSVVLVGVAAVSVYLAYELVIVPRRALQDQIRDQKETIVKLEQDKQRLEAYLKILKRVDRRARVEVLHQAKNPQGNLDTTIRFTETDD
Ga0307475_1039798923300031754Hardwood Forest SoilMSSSRRIPIELILWSALLVAVATVGVYLSYELVIAPRRALQDQIREQKQTIAKLEQEKQRLEAYLKILKHIDRRARVEVLRQ
Ga0307475_1057053323300031754Hardwood Forest SoilMSNGRGFPIQSFIWSVALVAVGSASVYLGYELIVQPRREMQDQIRQQKETIGKLEQDKLRLEAYLKIL
Ga0302322_10272899013300031902FenMREGRPFPIRLFVWSVALVAFAAAGVYLAYEMVVKPRRELQDQIREQKGTILKLEQDKQRLEAYLK
Ga0326728_1104033413300033402Peat SoilMRNDRSFSFRSSVWSVVLVAVAAAGIYLAYELVVKPQRALQEQISEQKETILKL
Ga0326727_1068836333300033405Peat SoilMSNGRHFPIRSFATSVVLVAVAAASVYLSYELVVKPRQALQEQIREQKGTILKLQQDNQR
Ga0316628_10074100823300033513SoilMLEDLDQADSAMKNNSPLLSRLVVWSVVLVAVATASVYLMYELIVKPRQALQNQIREQQAIILKLEQDKQRLE
Ga0316628_10406214413300033513SoilMSNGRHFPIQSFVWSVVLVAVAAASVYLGYELVIVPRRALQDQIREQKETIGKLEQEKQRLEAYLKILKHIDRRARVEVLRQAKDQQGNLQTTIRFTETDS
Ga0334843_043744_1_3063300033825SoilMSNGRHFPIQLFVWSLGLVAVAAGSVYLAYELVIVPRRALQDQLREQKETIVKLEQENQRLEAYLKILKHIDRRGRVEVLRQAKDAKGNLQTTIRFTETDAA
Ga0371488_0578632_3_2303300033983Peat SoilVAARIANRGADMSGGRHFPIRSLVASVLLVAVAAASVYLSYELVVKPRQALQDQIRQQQATILKLQQDNQRLEAYL
Ga0334822_057835_3_1673300034070SoilMSNGRDFPIRVLVWAVVLAAVAATSVYLSYELVVRPRRALQDQIAGKKETILKLE
Ga0370483_0216674_3_2393300034124Untreated Peat SoilMSNGRQFPVRTFVWTVVLAAVASGSIYLAYELVVVPRRALQDQIREQKETIGRLEQEKQRLQAYLKILEHVDRKARVEV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.