Basic Information | |
---|---|
Family ID | F062068 |
Family Type | Metagenome |
Number of Sequences | 131 |
Average Sequence Length | 39 residues |
Representative Sequence | MATRAVEVAVGVPALAAERAVTWPKRTKARLSNGLEVIL |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 96.95 % |
% of genes from short scaffolds (< 2000 bps) | 90.08 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.947 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.901 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.427 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.145 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 8.96% Coil/Unstructured: 91.04% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF05193 | Peptidase_M16_C | 55.73 |
PF10728 | DUF2520 | 1.53 |
PF13641 | Glyco_tranf_2_3 | 0.76 |
PF00498 | FHA | 0.76 |
PF09290 | AcetDehyd-dimer | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG4569 | Acetaldehyde dehydrogenase (acetylating) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.95 % |
Unclassified | root | N/A | 3.05 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000580|AF_2010_repII_A01DRAFT_1047843 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300000955|JGI1027J12803_108950242 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300001661|JGI12053J15887_10048448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2380 | Open in IMG/M |
3300002910|JGI25615J43890_1094253 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300002911|JGI25390J43892_10001222 | All Organisms → cellular organisms → Bacteria | 5297 | Open in IMG/M |
3300004092|Ga0062389_102291837 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300004635|Ga0062388_100354918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
3300005187|Ga0066675_11055621 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005451|Ga0066681_10503399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
3300005536|Ga0070697_101498316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
3300005539|Ga0068853_101937915 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300005712|Ga0070764_11043041 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300006050|Ga0075028_100307730 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300006086|Ga0075019_10693357 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006162|Ga0075030_100905160 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300006174|Ga0075014_100434723 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300006796|Ga0066665_11138545 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300007255|Ga0099791_10424261 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300009038|Ga0099829_11096066 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300009629|Ga0116119_1040945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
3300009824|Ga0116219_10588346 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300010043|Ga0126380_10419012 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300010159|Ga0099796_10511131 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300010325|Ga0134064_10031705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
3300010325|Ga0134064_10182058 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300010335|Ga0134063_10780299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300010339|Ga0074046_10845723 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010376|Ga0126381_102546357 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300010376|Ga0126381_104594817 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300010401|Ga0134121_10078872 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
3300011269|Ga0137392_10709436 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300011269|Ga0137392_11336389 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012096|Ga0137389_10406378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
3300012096|Ga0137389_10462319 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300012096|Ga0137389_10750260 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300012096|Ga0137389_10985676 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300012189|Ga0137388_10622493 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300012203|Ga0137399_11149029 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012349|Ga0137387_10238753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
3300012361|Ga0137360_10545386 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300012362|Ga0137361_11642085 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300012922|Ga0137394_11622431 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012927|Ga0137416_11895643 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300012929|Ga0137404_10912923 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300012930|Ga0137407_10688963 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300012930|Ga0137407_12312781 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012986|Ga0164304_11211063 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300014199|Ga0181535_10438278 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300016357|Ga0182032_10788427 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300016387|Ga0182040_10153309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
3300016404|Ga0182037_12140402 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300016445|Ga0182038_10403532 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300016445|Ga0182038_10781552 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300017822|Ga0187802_10139801 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300017933|Ga0187801_10230106 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300017936|Ga0187821_10353799 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300017955|Ga0187817_10994524 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300017961|Ga0187778_10335543 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300018007|Ga0187805_10189613 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300018034|Ga0187863_10439602 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300018085|Ga0187772_11369623 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300020170|Ga0179594_10014922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2252 | Open in IMG/M |
3300020579|Ga0210407_10085585 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300020579|Ga0210407_10494704 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300020580|Ga0210403_10047926 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
3300020580|Ga0210403_11003755 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300021088|Ga0210404_10398528 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300021088|Ga0210404_10667844 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300021168|Ga0210406_10918279 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300021180|Ga0210396_10293730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
3300021401|Ga0210393_10724288 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300021403|Ga0210397_11395508 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300021405|Ga0210387_11276329 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300021406|Ga0210386_10032434 | All Organisms → cellular organisms → Bacteria | 4106 | Open in IMG/M |
3300021407|Ga0210383_10692230 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300021433|Ga0210391_10406943 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300021477|Ga0210398_10097276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2390 | Open in IMG/M |
3300021478|Ga0210402_11336233 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300021559|Ga0210409_10779747 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300022840|Ga0224549_1025567 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300024222|Ga0247691_1062281 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300024330|Ga0137417_1170627 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300025409|Ga0208321_1067143 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300025472|Ga0208692_1019042 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
3300025910|Ga0207684_11642625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 519 | Open in IMG/M |
3300025922|Ga0207646_10743470 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300025937|Ga0207669_11810614 | Not Available | 522 | Open in IMG/M |
3300026304|Ga0209240_1189269 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300026333|Ga0209158_1249307 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300026482|Ga0257172_1076569 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300026537|Ga0209157_1307676 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300026547|Ga0209156_10163176 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300027562|Ga0209735_1031756 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300027605|Ga0209329_1111888 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300027629|Ga0209422_1013498 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
3300027725|Ga0209178_1131043 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300027727|Ga0209328_10124303 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300027729|Ga0209248_10236012 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300027812|Ga0209656_10483524 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027842|Ga0209580_10675133 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027884|Ga0209275_10830334 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300027889|Ga0209380_10398323 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300028138|Ga0247684_1022219 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300028380|Ga0268265_10791957 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300028536|Ga0137415_10914631 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300028800|Ga0265338_10366211 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300031057|Ga0170834_102799399 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031680|Ga0318574_10777886 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300031708|Ga0310686_108946688 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300031715|Ga0307476_11081559 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300031720|Ga0307469_10471452 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300031723|Ga0318493_10162733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300031724|Ga0318500_10578145 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031736|Ga0318501_10755960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300031753|Ga0307477_10861977 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300031798|Ga0318523_10261505 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300031820|Ga0307473_11031235 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300031833|Ga0310917_10614237 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300031954|Ga0306926_10548327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
3300031962|Ga0307479_12101383 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300032035|Ga0310911_10836516 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300032059|Ga0318533_10175362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
3300032094|Ga0318540_10393416 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300032180|Ga0307471_100595292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
3300032828|Ga0335080_10596065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
3300032892|Ga0335081_10705814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
3300033290|Ga0318519_10089305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
3300033405|Ga0326727_10442880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.58% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.58% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.05% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.05% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.53% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.53% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.76% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.76% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.76% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.76% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.76% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.76% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A01DRAFT_10478431 | 3300000580 | Forest Soil | MASRPVEVAVGVPALAPERQVTWPKRTRTRLANGLEVILAASHTI |
JGI1027J12803_1089502423 | 3300000955 | Soil | MATKAAEISNLVPALTAERPVTWPKRTRARLANGLQVVLAEA |
JGI12053J15887_100484483 | 3300001661 | Forest Soil | MATRAATEISSSVPPLSAERQVTWPKRTKARLTNGLEVVL |
JGI25615J43890_10942532 | 3300002910 | Grasslands Soil | MATRVVEVANGVPGLAAERAVTWPKRTKARLSNGLEVILAEAH |
JGI25390J43892_100012225 | 3300002911 | Grasslands Soil | MATRAVEVAVGVPALAPERPVTWPKRTRARLSNGLEVILAEA |
Ga0062389_1022918371 | 3300004092 | Bog Forest Soil | MATKAPEMSSLIPALSAERVVTWPKRTRAKLANGLEVVLAE |
Ga0062388_1003549181 | 3300004635 | Bog Forest Soil | MATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVVLVESHTI |
Ga0066675_110556212 | 3300005187 | Soil | MASRPVEVAVGVPALAPEREVTWPKRTKAKLANGLEVILA |
Ga0066681_105033992 | 3300005451 | Soil | MSSRAVEVAKGVPPLAPEREVIWPKPTREKLANGLQVILAESHSIPKFHGQL |
Ga0070697_1014983161 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAVEVKNDVPALAPERQVTWPKRQRARLSNGLEVILVESHTIPKFHGE |
Ga0068853_1019379152 | 3300005539 | Corn Rhizosphere | MATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLEIVLAE |
Ga0070764_110430411 | 3300005712 | Soil | MATQTRVESAGTTVPALGAERAVTWPKRTRVRLANG |
Ga0075028_1003077302 | 3300006050 | Watersheds | MATRAVEVATSVPALTSERAVTWPKRTRARLSNGL |
Ga0075019_106933572 | 3300006086 | Watersheds | MATRAAEIATGVPALSAERSVAWPKQTKARLSNGLEIILAES |
Ga0075030_1009051601 | 3300006162 | Watersheds | MATRASEIATGVPALSAERSVAWPKQTKARLSNGLEIILAES |
Ga0075014_1004347231 | 3300006174 | Watersheds | MATQAAEISNLVPGLAPERPVTWPKRTKARLSNGLQVVLA |
Ga0066665_111385451 | 3300006796 | Soil | MAARVVEVANGVPGLAAERAVTWPKRTKAQLSNGLEV |
Ga0099791_104242611 | 3300007255 | Vadose Zone Soil | MATRTVEVATGIPGLAAERAVTWPKRTKARLSNGLEVIL |
Ga0099829_110960662 | 3300009038 | Vadose Zone Soil | MAPRSVEVANGVPALAPEREVTWPKRAKTRLANGLEVIL |
Ga0116119_10409451 | 3300009629 | Peatland | MATREAEVPTLAPALTPERPVTWPKRTRARLANGLE |
Ga0116219_105883461 | 3300009824 | Peatlands Soil | MATRAPEVAIAAPALAPERAVTWPNRTRARLSNGLEIVLAEARSIPKFH |
Ga0126380_104190122 | 3300010043 | Tropical Forest Soil | MATRAAEIPTTVPALSAERAVTWPKVTKARLANGLQVVLA |
Ga0099796_105111312 | 3300010159 | Vadose Zone Soil | MATRTVEVATGIPALAAERAVTWPERTRARLSNGL |
Ga0134064_100317053 | 3300010325 | Grasslands Soil | MATRAFVVAVGVPALAPERPMTWPKRTMARLSNGLEVILAEAHSIP |
Ga0134064_101820581 | 3300010325 | Grasslands Soil | MTARVAEIANGVPGLAVERAVTWPKRTKARLPNGLDVILAEAHS |
Ga0134063_107802992 | 3300010335 | Grasslands Soil | MASRTVEVAVGVPVLAPEREVTWPKRTKTRLSNGLEVIL |
Ga0074046_108457232 | 3300010339 | Bog Forest Soil | MAPIATEVPTLAPALTPERPVTWPKRTRARLANGLAVVLAEAHSIP |
Ga0126381_1025463572 | 3300010376 | Tropical Forest Soil | MATKAAEISNLVPALTAERPVTWPKRTRTRLANGL |
Ga0126381_1045948172 | 3300010376 | Tropical Forest Soil | MASRAQEIPSAVPALTAERAVTWPKRTRARLANGLEVV |
Ga0134121_100788724 | 3300010401 | Terrestrial Soil | MATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLEIVLA |
Ga0137392_107094361 | 3300011269 | Vadose Zone Soil | MATRTVEVATGVPALAPERAVTWPKRTRARLSNGLEVILAE |
Ga0137392_113363891 | 3300011269 | Vadose Zone Soil | MATRVVEVANGVPGLAAERAVTWPKRTTARFSNGLEVILAEARS |
Ga0137389_104063782 | 3300012096 | Vadose Zone Soil | MASRAPEFSAAVPALTAERPVTWPKRTRARLANGL |
Ga0137389_104623191 | 3300012096 | Vadose Zone Soil | MATRVVEVANGVPGLAAERAVTWPKRTRARLSNGLEVILAEAHS |
Ga0137389_107502601 | 3300012096 | Vadose Zone Soil | MATRAAADIHTAVPRLSPERQVTWPKRTKTRLANG |
Ga0137389_109856761 | 3300012096 | Vadose Zone Soil | MATRAVEVANGVPGLAPERAVTWPKRTKARLSNGL |
Ga0137388_106224932 | 3300012189 | Vadose Zone Soil | MATRTVEVATGVPGLSAERAVTWPKRTKTRLSNGLEVVLAEA |
Ga0137399_111490291 | 3300012203 | Vadose Zone Soil | MATRTVEVATGVPGLSAERAVTWPKRTKAKLSNGL |
Ga0137387_102387531 | 3300012349 | Vadose Zone Soil | MVARVAEIANGVPGLAAERAVTWPKRTKARLPNGLDVI |
Ga0137360_105453861 | 3300012361 | Vadose Zone Soil | MATRTVEVATGAPALSAERAVTWPKRTKARLSNGLEVVL |
Ga0137361_116420852 | 3300012362 | Vadose Zone Soil | MATRTVEVAQGVPALAPERAVTWPKRTKARLSNGLEVILAE |
Ga0137394_116224312 | 3300012922 | Vadose Zone Soil | MATRTVEVATGVPGLSAERAVTWPRRSKSRLSNGLEVVLAE |
Ga0137416_118956431 | 3300012927 | Vadose Zone Soil | MATRAVEVANGVPALSSERAVTWPKRTRARLSNGLEIILAEAHS |
Ga0137404_109129231 | 3300012929 | Vadose Zone Soil | VATRAVEVNEAVPALSPERQVTWPPRKRTRLSNGLEVILVESH |
Ga0137407_106889631 | 3300012930 | Vadose Zone Soil | MATSAVEVAVGVPALSSERAVTWPKRTRARLSNGLEVILAE |
Ga0137407_123127812 | 3300012930 | Vadose Zone Soil | MATRTVEVATGVPALSAERAVTWPKRTKARLSNGLEVVL |
Ga0164304_112110631 | 3300012986 | Soil | MATRAVEVNNAVPALAPERQVTWPKRQRARLSNGLEVILVESHTIPKFHGELF |
Ga0181535_104382782 | 3300014199 | Bog | MVTRAPQGAIAAPALASERAVTWPKRTRARLSNGLQV |
Ga0182032_107884272 | 3300016357 | Soil | MASRAQEIPAVPALAAERPVTWPKRTRTRLSNGLEVVLA |
Ga0182040_101533091 | 3300016387 | Soil | MATQATEMPVAVPALAPERAVKWPKRTRAQLANGLQVVLA |
Ga0182037_121404021 | 3300016404 | Soil | MATQATEIAKGVPALAAERAVTWPKRTRARLANGLEVVLA |
Ga0182038_104035321 | 3300016445 | Soil | MASRPVEVAVGVPALAPERQVTWPKLTRTRLANGLEVILA |
Ga0182038_107815521 | 3300016445 | Soil | MATQATEMLVAAPALAPERAVKWPKRTRARLANGLQV |
Ga0187802_101398012 | 3300017822 | Freshwater Sediment | MTTRTVEVATDVPALAAERAVTWPKRRKAVLSNGL |
Ga0187801_102301061 | 3300017933 | Freshwater Sediment | MATREAEVPTLAPPLTPERPVTWPKRTRARLLNGL |
Ga0187821_103537992 | 3300017936 | Freshwater Sediment | MATRTAEVTNSVPALTAERAVAWPKRTRARLSNGL |
Ga0187817_109945241 | 3300017955 | Freshwater Sediment | MATKAPQVATAAPALAPERSVNWPKRTRARLSNGLQV |
Ga0187778_103355432 | 3300017961 | Tropical Peatland | MATREAEVPTLAPGLTPERPVTWPKRTRARLANGLEVV |
Ga0187805_101896132 | 3300018007 | Freshwater Sediment | MATRAPEVAIAAPALAPERPVSWPKRTRARLSNGLE |
Ga0187863_104396021 | 3300018034 | Peatland | MATIAKEVPTLPPALTPERPVTWPKRTRTRLANGL |
Ga0187772_113696232 | 3300018085 | Tropical Peatland | MATRAQGVATTVPALAAERSVTWPKRTRARLSNGLEIVLAE |
Ga0179594_100149221 | 3300020170 | Vadose Zone Soil | MATRAVEVAVGVPALAAERAVTWPKRTKARLSNGLEVIL |
Ga0210407_100855853 | 3300020579 | Soil | MATRPAAEIHNAVPPLSAERQVTWPKRTKARLANGLEVV |
Ga0210407_104947041 | 3300020579 | Soil | MATQATEVSTLVPALTAEQEVNWPKRTRAKLSNGLQVV |
Ga0210403_100479264 | 3300020580 | Soil | VATRTAQLPTEAPALSPERPVSWPKRTKARLSNGLEVI |
Ga0210403_110037552 | 3300020580 | Soil | MATRAAEVQTSVPPLSPERQVTWPKRTRTQLANGL |
Ga0210404_103985282 | 3300021088 | Soil | MATRAVEVSDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTIPKFHG |
Ga0210404_106678442 | 3300021088 | Soil | MASRTMEVATGVPRLSAERAVTWPKRTKARLSNGLEVVLAEA |
Ga0210406_109182792 | 3300021168 | Soil | MMASRATEISAAVPALTAERPVTWPKRTRARLANGLEVVLAEA |
Ga0210396_102937301 | 3300021180 | Soil | MATRAPEVAIAAPALAPERPVTWPHRTRARLSNGLEVVLAEAH |
Ga0210393_107242881 | 3300021401 | Soil | MATQTRVESAGTTVPALGAERAVTWPKRTRVRLAN |
Ga0210397_113955081 | 3300021403 | Soil | MATRAVEVNHAVPALSAERQVTWPNRKRARLSNGLEVILVESHT |
Ga0210387_112763292 | 3300021405 | Soil | MATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVILVES |
Ga0210386_100324345 | 3300021406 | Soil | MATQATEVSTLVPALTAERQVNWPKRTRATLSNGLQVVLAE |
Ga0210383_106922301 | 3300021407 | Soil | VATRTAQVPTEAPSLSPERPVSWPKRTKARLSNGLEVIL |
Ga0210391_104069432 | 3300021433 | Soil | MATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTI |
Ga0210398_100972763 | 3300021477 | Soil | MATRAAEANDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTIPKFHG |
Ga0210402_113362332 | 3300021478 | Soil | MATRPAAEIHTAVPPLTSERQVTWPKRTRARLANGLEV |
Ga0210409_107797472 | 3300021559 | Soil | MASRAAEVAVGVPALTPERSVTWPKRSKSRLANGLEIVLV |
Ga0224549_10255672 | 3300022840 | Soil | MAVFAVEVLAHAPALTAERPVTWPKRTKTRLANGLEVVLAE |
Ga0247691_10622812 | 3300024222 | Soil | MASSAPEYSAAVPALTAERPVTWPKRARARLANGL |
Ga0137417_11706272 | 3300024330 | Vadose Zone Soil | MATRAAAEIHTAVPPLSPERQVTWPKRTRARLANGL |
Ga0208321_10671431 | 3300025409 | Peatland | MATREAEVPTLAPALTPERPVTWPKRTRARLANGLEVVLA |
Ga0208692_10190423 | 3300025472 | Peatland | MATREAEVPTLAPALTPERPVTWPKRTRARLANGLEVVLAEAHS |
Ga0207684_116426251 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MATSVAEARSEVPALSTERAVTWPKRTKAKLVNGLEVVLAES |
Ga0207646_107434701 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAATEIATSVPPLSAERQVTWPKRTKARLANGLEVV |
Ga0207669_118106142 | 3300025937 | Miscanthus Rhizosphere | MATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLE |
Ga0209237_11320502 | 3300026297 | Grasslands Soil | VMAATPAPQALAGVPALAPERRVEWPKRTRARLANG |
Ga0209240_11892693 | 3300026304 | Grasslands Soil | MATRAVEVAMGVPALAPERSVTWPKRTRARLSNGLEVILAEAHSI |
Ga0209802_10873462 | 3300026328 | Soil | MAATPAPQALAGVPALAPERRVEWPKRTRARLANGMEVIL |
Ga0209158_12493072 | 3300026333 | Soil | MATRAMEVAIGVPALAAERAVTWPKRTRARLSNGL |
Ga0257172_10765692 | 3300026482 | Soil | MATRVAEIAKGVPALSEERQVTWPKRTRARLPNGLEVVLAESHA |
Ga0209157_13076761 | 3300026537 | Soil | MATRTVEVPRGAPALAAERAVTWPKRTKARLSNGLEVILA |
Ga0209156_101631762 | 3300026547 | Soil | MASRPVEVAVGVPALAPEREVTWPKRTKAKLANGLEVILAE |
Ga0209735_10317561 | 3300027562 | Forest Soil | MATRVVEVANGVPGLAAERAVTWPKRTKARLSNGL |
Ga0209329_11118881 | 3300027605 | Forest Soil | MATRTAPSLTGAPGLSPERPVTWPKRTKARLSNGLE |
Ga0209422_10134981 | 3300027629 | Forest Soil | MASRAPEFSAAVPALTAERPVTWPKRTRTRLANGLEIVLAES |
Ga0209178_11310432 | 3300027725 | Agricultural Soil | MATRAIETNSSAPALAPERQVTWPKRKKARLSNGLELIL |
Ga0209328_101243031 | 3300027727 | Forest Soil | MATRTAQLPTEAPALTAERPVTWPKRTKTRLANGL |
Ga0209248_102360121 | 3300027729 | Bog Forest Soil | MATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLE |
Ga0209656_104835242 | 3300027812 | Bog Forest Soil | MATRAVEVNDAVPALAAERQVTWPNRKRARLSNGLEV |
Ga0209580_106751332 | 3300027842 | Surface Soil | MATRPAAEIHTAVPPLTAERQVTWPKRTRARLTNGLEVVLAE |
Ga0209275_108303342 | 3300027884 | Soil | MATRAVEVNDAVPGLSAERQVTWPNRKRARLSNGLE |
Ga0209380_103983231 | 3300027889 | Soil | MATRAVEVNDAVPALSAERQVRWPNRKRARLSNGLEVIL |
Ga0247684_10222192 | 3300028138 | Soil | MATRAVEVNNGVPGLSPERQVTWPKRQRARLSNGL |
Ga0268265_107919572 | 3300028380 | Switchgrass Rhizosphere | MATRAAEVPTTVPALSAERPVTWPKVTKSRLANGLEIV |
Ga0137415_109146311 | 3300028536 | Vadose Zone Soil | MATRAAEIHTSVPPLSAERQVTWPKRTRTRLGDGLE |
Ga0265338_103662111 | 3300028800 | Rhizosphere | MATRAADVNAAVPALSPERQVTWPKRTRARLSNGLEVVLVESH |
Ga0170834_1027993991 | 3300031057 | Forest Soil | MASRAPEYSAAVPALTAERPVTWPNRARARLANGLEIVLAEAHSIP |
Ga0318574_107778862 | 3300031680 | Soil | MATQAKEMPVAAPALAAERAVKWPKRTRAQLTNGLRVVL |
Ga0310686_1089466881 | 3300031708 | Soil | MATRAVEVNDAVPALSAERQVTWPNRKRARLSNGLEVILVESHTIPKF |
Ga0307476_110815591 | 3300031715 | Hardwood Forest Soil | MATQTRAQSAGTTVPALGTERTVTWPKRTRTRLTNGLEVLLAE |
Ga0307469_104714521 | 3300031720 | Hardwood Forest Soil | MATRPAAEIHTAVPPLTAERQVTWPKRTRARLANG |
Ga0318493_101627331 | 3300031723 | Soil | MATQAKEMPVAAPALAAERAVKWPKRTRAQLTNGLR |
Ga0318500_105781452 | 3300031724 | Soil | MATRAAEVSFGVPALTPERAVSWPKRTRAQLANGLQVVLAE |
Ga0318501_107559602 | 3300031736 | Soil | MGSRPAEVAVGVPALAPERQVTWPKRTGTRLANGLEVILAESH |
Ga0307477_108619771 | 3300031753 | Hardwood Forest Soil | MATKAAEVANGVPALAPERAVTWPKRTKDRLSNGLEVILVEAHSI |
Ga0318523_102615052 | 3300031798 | Soil | MATQATEMPVAAPALAPERAVKWPKRNRARQKKGKK |
Ga0307473_110312351 | 3300031820 | Hardwood Forest Soil | MATKAAEISNLVPALTAERPVTWPKRTRARLSNGLQVVLA |
Ga0310917_106142372 | 3300031833 | Soil | MATQATEMPVAVPALAPERAVKWPKRTRAQLANGL |
Ga0306926_105483272 | 3300031954 | Soil | MATQATEMPVAAPALAPERAVKWPKRTRARLANGLQ |
Ga0307479_121013831 | 3300031962 | Hardwood Forest Soil | MMATRAAAEIQTAVPPLAPERQVTWPKVTRTRLANGLEVVL |
Ga0310911_108365162 | 3300032035 | Soil | MATQAKEMPVAAPALAAERAVKWPKRTRAQLTNGLRVVLAE |
Ga0318533_101753621 | 3300032059 | Soil | MATQATEMPVAAPALAPERAVEWPKRTRARLANGLQV |
Ga0318540_103934161 | 3300032094 | Soil | MATQATEMPVAAPALAPERAVEWPKRTRARLANGL |
Ga0307471_1005952921 | 3300032180 | Hardwood Forest Soil | MATRAVEVAVGVPALAAERAVTWPKRTKARLSNGLEVILVEAHS |
Ga0335080_105960652 | 3300032828 | Soil | MATPAIEKNSPVPALTPERQVTWPKRQRTKLANGLEVILV |
Ga0335081_107058142 | 3300032892 | Soil | MATRAVETNSMVPALAPERQVTWPKRRRSVLANGLEVI |
Ga0335077_105317542 | 3300033158 | Soil | MATRAPEMNAAVPALAAERAVEWPKRTRVRLNNGMQVVLA |
Ga0318519_100893052 | 3300033290 | Soil | MATQATEMPVAVPALAPERAVKWPKRTRAQLANGLQVV |
Ga0326727_104428802 | 3300033405 | Peat Soil | MATRAPEVAIAAPALAPERPVTWPKRTRARLSNGMEV |
⦗Top⦘ |