NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062219

Metagenome / Metatranscriptome Family F062219

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062219
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 43 residues
Representative Sequence GDAEMKIEMDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Number of Associated Samples 118
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.47 %
% of genes from short scaffolds (< 2000 bps) 94.66 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.420 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.450 % of family members)
Environment Ontology (ENVO) Unclassified
(29.771 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.70%    β-sheet: 23.19%    Coil/Unstructured: 68.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF02597ThiS 49.62
PF13411MerR_1 29.01
PF12543DUF3738 3.05
PF01435Peptidase_M48 2.29
PF00248Aldo_ket_red 1.53
PF00926DHBP_synthase 1.53
PF00106adh_short 0.76
PF01769MgtE 0.76
PF12773DZR 0.76
PF13231PMT_2 0.76
PF01384PHO4 0.76
PF00925GTP_cyclohydro2 0.76
PF00069Pkinase 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 49.62
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 49.62
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.05
COG01083,4-dihydroxy-2-butanone 4-phosphate synthaseCoenzyme transport and metabolism [H] 1.53
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 0.76
COG0807GTP cyclohydrolase IICoenzyme transport and metabolism [H] 0.76
COG1824Permease, similar to cation transportersInorganic ion transport and metabolism [P] 0.76
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.42 %
UnclassifiedrootN/A4.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0775610All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300001471|JGI12712J15308_10042904All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1156Open in IMG/M
3300004480|Ga0062592_100068310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2039Open in IMG/M
3300005167|Ga0066672_10724408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter634Open in IMG/M
3300005174|Ga0066680_10179326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1334Open in IMG/M
3300005175|Ga0066673_10367199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae840Open in IMG/M
3300005176|Ga0066679_10109095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1692Open in IMG/M
3300005179|Ga0066684_10531271All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300005336|Ga0070680_101650678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter555Open in IMG/M
3300005337|Ga0070682_101273254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter624Open in IMG/M
3300005364|Ga0070673_101266287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter692Open in IMG/M
3300005468|Ga0070707_100961715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae819Open in IMG/M
3300005471|Ga0070698_100966477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter798Open in IMG/M
3300005518|Ga0070699_100003819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter13308Open in IMG/M
3300005526|Ga0073909_10404976All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300005559|Ga0066700_10993569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter552Open in IMG/M
3300005563|Ga0068855_100837458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter976Open in IMG/M
3300005574|Ga0066694_10188126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae980Open in IMG/M
3300005602|Ga0070762_10740726All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300005610|Ga0070763_10868885All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300005614|Ga0068856_101897388All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300005712|Ga0070764_10295281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter934Open in IMG/M
3300005764|Ga0066903_107900149All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300005842|Ga0068858_100486607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1191Open in IMG/M
3300005921|Ga0070766_10541318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter777Open in IMG/M
3300005944|Ga0066788_10030060All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300005995|Ga0066790_10487505All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter527Open in IMG/M
3300006050|Ga0075028_100279193All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300006163|Ga0070715_10312427All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300006176|Ga0070765_100130503All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2217Open in IMG/M
3300006806|Ga0079220_11217824All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300009088|Ga0099830_10687418Not Available842Open in IMG/M
3300009101|Ga0105247_10777318All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300009177|Ga0105248_10685329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1156Open in IMG/M
3300009525|Ga0116220_10613308Not Available501Open in IMG/M
3300009545|Ga0105237_10616263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1092Open in IMG/M
3300009545|Ga0105237_11133694All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300009839|Ga0116223_10250055All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300010047|Ga0126382_11706214All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylovorus → Methylovorus menthalis588Open in IMG/M
3300010329|Ga0134111_10344831All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300010336|Ga0134071_10580593All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300011119|Ga0105246_10341213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1224Open in IMG/M
3300011270|Ga0137391_10673095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter862Open in IMG/M
3300012200|Ga0137382_10519042All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012202|Ga0137363_11413555All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300012205|Ga0137362_10571532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter976Open in IMG/M
3300012205|Ga0137362_11313798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae608Open in IMG/M
3300012208|Ga0137376_10269681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1476Open in IMG/M
3300012917|Ga0137395_10315649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1109Open in IMG/M
3300012958|Ga0164299_10888262All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300012976|Ga0134076_10271606All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300012987|Ga0164307_11733128Not Available529Open in IMG/M
3300014493|Ga0182016_10587461Not Available635Open in IMG/M
3300015242|Ga0137412_10504172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis926Open in IMG/M
3300015245|Ga0137409_10540025All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300015371|Ga0132258_11808630All Organisms → cellular organisms → Bacteria1539Open in IMG/M
3300017656|Ga0134112_10435492All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300017822|Ga0187802_10187610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300017933|Ga0187801_10284710All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300017934|Ga0187803_10205306All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300017943|Ga0187819_10101615All Organisms → cellular organisms → Bacteria1718Open in IMG/M
3300017943|Ga0187819_10793972All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300017955|Ga0187817_10069110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2196Open in IMG/M
3300017994|Ga0187822_10062295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1072Open in IMG/M
3300018006|Ga0187804_10155091All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300018006|Ga0187804_10421268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia593Open in IMG/M
3300018012|Ga0187810_10494678All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300018047|Ga0187859_10192134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1088Open in IMG/M
3300018054|Ga0184621_10204513All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300018058|Ga0187766_10028518All Organisms → cellular organisms → Bacteria3228Open in IMG/M
3300018058|Ga0187766_10514932All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300018085|Ga0187772_11460503All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae509Open in IMG/M
3300018086|Ga0187769_10185843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1534Open in IMG/M
3300018431|Ga0066655_10620685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae730Open in IMG/M
3300018468|Ga0066662_10845300All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300018482|Ga0066669_10472713All Organisms → cellular organisms → Bacteria → Acidobacteria1081Open in IMG/M
3300018482|Ga0066669_12179937All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300020002|Ga0193730_1160641All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300020015|Ga0193734_1023519All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300020579|Ga0210407_11011573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6633Open in IMG/M
3300020581|Ga0210399_10071277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2814Open in IMG/M
3300020582|Ga0210395_10550130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae868Open in IMG/M
3300021171|Ga0210405_10216102All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300021178|Ga0210408_10810515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis733Open in IMG/M
3300021420|Ga0210394_11006135All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300021432|Ga0210384_10748280All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300021478|Ga0210402_10244863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1655Open in IMG/M
3300021861|Ga0213853_10150562Not Available742Open in IMG/M
3300022756|Ga0222622_10673400All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300025893|Ga0207682_10235115All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300025910|Ga0207684_10160975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1933Open in IMG/M
3300025911|Ga0207654_10861719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae656Open in IMG/M
3300025911|Ga0207654_11254389All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300025915|Ga0207693_10487136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis963Open in IMG/M
3300025917|Ga0207660_11288353All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300025928|Ga0207700_10227492All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300025931|Ga0207644_11234118All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300026035|Ga0207703_11571349All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300026078|Ga0207702_11273141All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300026078|Ga0207702_12251637All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300026118|Ga0207675_100221872All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300026300|Ga0209027_1036996All Organisms → cellular organisms → Bacteria1841Open in IMG/M
3300026335|Ga0209804_1330993All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300026530|Ga0209807_1071650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1552Open in IMG/M
3300026540|Ga0209376_1386130All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300026557|Ga0179587_10980863All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300027604|Ga0208324_1125253All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300027671|Ga0209588_1100569All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300027737|Ga0209038_10257075All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300027846|Ga0209180_10023275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3293Open in IMG/M
3300027846|Ga0209180_10117892All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300027882|Ga0209590_10328731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium984Open in IMG/M
3300028047|Ga0209526_10410514All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis897Open in IMG/M
3300028381|Ga0268264_10620232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1068Open in IMG/M
3300028679|Ga0302169_10033019All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300028828|Ga0307312_10292067All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300028906|Ga0308309_10518345All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300028906|Ga0308309_11220715All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300028906|Ga0308309_11800786Not Available518Open in IMG/M
3300030020|Ga0311344_10853236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae732Open in IMG/M
3300030045|Ga0302282_1180291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis810Open in IMG/M
3300030339|Ga0311360_10280391All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1350Open in IMG/M
3300031720|Ga0307469_11946197All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300031902|Ga0302322_101731490All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300031902|Ga0302322_102854254All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300031918|Ga0311367_10478606All Organisms → cellular organisms → Bacteria1279Open in IMG/M
3300031938|Ga0308175_100945281All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300032828|Ga0335080_10468358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1342Open in IMG/M
3300032828|Ga0335080_12278738All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300033004|Ga0335084_11255240All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300033158|Ga0335077_10560771All Organisms → cellular organisms → Bacteria1198Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.11%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.05%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.05%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.05%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.05%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.29%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.53%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.53%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.53%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.76%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.76%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_077561032228664022SoilDSAGSAEMQIEADESSLPDSSILVQASYSGRTATRKFNLRKVEA
JGI12712J15308_1004290433300001471Forest SoilEIKVEVEESSLPDSSVLVQANYEGRTATRKFLLRKAE*
Ga0062592_10006831013300004480SoilYTQVLTDASGNAEMRVDMDEASLPDSSVLVQATHAGRSATRKFRLRKVEA*
Ga0066672_1072440813300005167SoilGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQFRKIEA*
Ga0066680_1017932633300005174SoilTQVVTDPAGDAEMKIEVDESALPDSSVLVQANYLGRTATRKFQLRKIEA*
Ga0066673_1036719933300005175SoilYRQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES*
Ga0066679_1010909553300005176SoilGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA*
Ga0066684_1053127113300005179SoilTQVLTDNAGTAEMNLEVEEAALSDASVLIQASYSGRTATRKFQLRRVEA*
Ga0070680_10165067813300005336Corn RhizosphereDASGNAEMRVDMDEASLPDSSVLVQATHAGRSATRKFRLRKVEA*
Ga0070682_10127325423300005337Corn RhizosphereDPAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA*
Ga0070673_10126628733300005364Switchgrass RhizosphereSGDAEMTIEADESALPDSSVLVQASYSGRTATRKFNLRKVEA*
Ga0070707_10096171513300005468Corn, Switchgrass And Miscanthus RhizosphereAGDAEMKIDMEESALPDSSLLVQASYSGKTTTRKFRLRKIES*
Ga0070698_10096647723300005471Corn, Switchgrass And Miscanthus RhizosphereTDEAGDAEMKIDVDESSLSDSSILVQASYSGRTATRKFQLKKVEA*
Ga0070699_100003819153300005518Corn, Switchgrass And Miscanthus RhizosphereGDAEMKIEVDESALPDSSVLVQANYLGRTATRKFQLRKIEA*
Ga0073909_1040497623300005526Surface SoilIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA*
Ga0066700_1099356933300005559SoilYTQVVTDASGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA*
Ga0068855_10083745813300005563Corn RhizosphereAQVVTDPAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA*
Ga0066694_1018812613300005574SoilEMKIEVDESSLGDSSVLVQANYSGRTATRKFQLRKVEA*
Ga0070762_1074072623300005602SoilDAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA*
Ga0070763_1086888533300005610SoilDGDAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA*
Ga0068856_10189738813300005614Corn RhizosphereDAEMTIEADESALPDSSVLVQASYSGRTATRKFNLRKVEA*
Ga0070764_1029528113300005712SoilKIDVDESSLPDSAVLVQANYSGRTATRKFQLRKVEA*
Ga0066903_10790014913300005764Tropical Forest SoilAEMKLGMEEAALSDSSVLIQVSYSGRTATRKFQLRRVEA*
Ga0068858_10048660743300005842Switchgrass RhizosphereYTQVTTDSAGSAEMQIEADESSLPDSSILVQASYSGRTATRKFNLRKVEA*
Ga0070766_1054131813300005921SoilMKIDVDESSLPDSAILVQASYSGRTATRKFQLRKVEA*
Ga0066788_1003006013300005944SoilVTAESGDAEMKIDVDETSLPDSSVLVQANYAGRTATRKFQLKKVEA*
Ga0066790_1048750513300005995SoilQVITGPEGHAEMNIGVDESGLPDSSILVQARYEDRTATRKFQLRKVEA*
Ga0075028_10027919313300006050WatershedsDAEMKIDVDEASLPDSAVLVQANYSGRTATRKFQLRKVEA*
Ga0070715_1031242733300006163Corn, Switchgrass And Miscanthus RhizosphereAQVLTDQSGDAEMKIEVDESSLADSSVLVQASYSGRTATRKFQLRKVEA*
Ga0070765_10013050363300006176SoilAGEAEMKIDVDDSSLPDSSILVQASYSGRTATRKFELRKVEA*
Ga0079220_1121782413300006806Agricultural SoilGGNAEMSIAVDEAALPDSSVLVQASVSGRTATRKFHFRKID*
Ga0099830_1068741813300009088Vadose Zone SoilMKIEMDESALLDSSVLVQANYSGRTATRKFQLRKVEA*
Ga0105247_1077731813300009101Switchgrass RhizosphereEMTIEADEAALPDSSVLVQASFSGRTATRKFNLRKVEA*
Ga0105248_1068532933300009177Switchgrass RhizosphereTDPSGDTEMKIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA*
Ga0116220_1061330813300009525Peatlands SoilTDAVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA*
Ga0105237_1061626313300009545Corn RhizosphereAEMRIEIDESALTESSVLVQANYSGRTATRKFQLRRVVA*
Ga0105237_1113369433300009545Corn RhizosphereGSAEMQIEADESSLPDSSILVQASYSGRTATRKFNLRKVEA*
Ga0116223_1025005533300009839Peatlands SoilAELKIDVDESSLPDSAVLVQANYSGRTATRKFHLRKVEA*
Ga0126382_1170621413300010047Tropical Forest SoilTQVLTDSTGDAEMKIDIDESSLPDSSVLVQASYSGRTATRKFHLRKIEA*
Ga0134111_1034483123300010329Grasslands SoilSGHAEMKIEVDESSLGDSSVLVQANYSGRTATRKFQLRKVEA*
Ga0134071_1058059313300010336Grasslands SoilMKVEVDESSLSDSSVLVQANYSGRTTTRKFQLRKVEA*
Ga0105246_1034121313300011119Miscanthus RhizosphereSGDTEMKIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA*
Ga0137391_1067309533300011270Vadose Zone SoilDAEMKIEMEESSLPDSSVLVQASYSGRTATRKFQLKKVEA*
Ga0137382_1051904213300012200Vadose Zone SoilMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES*
Ga0137363_1141355533300012202Vadose Zone SoilPFYTQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES*
Ga0137362_1057153213300012205Vadose Zone SoilIEVDEASLPDSSVLVQASYSGRTATRKFQLRKVEA*
Ga0137362_1131379813300012205Vadose Zone SoilDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA*
Ga0137376_1026968153300012208Vadose Zone SoilSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES*
Ga0137395_1031564913300012917Vadose Zone SoilAGDAEMKIDVDESSLSDSSVLVQASYSGRTATRKFQLKKVEA*
Ga0164299_1088826213300012958SoilTDPAGDTEMQIAVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA*
Ga0134076_1027160613300012976Grasslands SoilASGDVEMNMEMDEPSLQDCSVLVQANYSGRTATRKFQLRKIEA*
Ga0164307_1173312823300012987SoilMKIEVDESSLPDSSVLVQASYSGRTATRKFHLKKVEA*
Ga0182016_1058746113300014493BogNAAGEAEMKIDADEADLPDSSMLVQASFDGRTATRKFNLRKIET*
Ga0137412_1050417233300015242Vadose Zone SoilVTDPSGNTEMNIEVDESSLPDSSVLVQASYSGRTATRKFQLKKVEA*
Ga0137409_1054002513300015245Vadose Zone SoilSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES*
Ga0132258_1180863043300015371Arabidopsis RhizosphereDASGNAEMRVDMDEASLPDSSVLVQATHAGRSTTRKFRLRKVEA*
Ga0134112_1043549223300017656Grasslands SoilAEMKIEVDESSLGDSSVLVQANYSGRTATRKFQLRKVEA
Ga0187802_1018761023300017822Freshwater SedimentDEVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA
Ga0187801_1028471033300017933Freshwater SedimentQAVTGSNGDAEMKIDMAESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0187803_1020530633300017934Freshwater SedimentFYTQVVTGSDGDAEMKIDVGESALPDSAILVQANYSGRTATRKFQLRKVEA
Ga0187819_1010161513300017943Freshwater SedimentANGDAEMKFDAEEFSLPDAAILVQTSYTGRTATRKFQLRRVEA
Ga0187819_1079397213300017943Freshwater SedimentTQVMTGANGEAEMNIDVDESALPDASVLVQASYTGRTATRKFHLRKVEA
Ga0187817_1006911033300017955Freshwater SedimentEVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA
Ga0187822_1006229513300017994Freshwater SedimentMKIEMDETSLPDSSVLVQASYSGRTATRKFQLKKIEA
Ga0187804_1015509113300018006Freshwater SedimentAEMKFDAEEFSLPDAAILVQTSYTGRTATRKFQLRRVEA
Ga0187804_1042126823300018006Freshwater SedimentFYTQVLTDEVGAAEMKIDVDESALPDSSLLVQASYSGRTATRKFQLRKVEA
Ga0187810_1049467813300018012Freshwater SedimentGDAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA
Ga0187859_1019213413300018047PeatlandMKIDVDESSLPDSAILVQASYSGRTATRKFQLRKVEA
Ga0184621_1020451333300018054Groundwater SedimentQVVTNSAGDAEMKIDMEESALPDSSLLVQASYSGRTTTRKFRLRKIES
Ga0187766_1002851813300018058Tropical PeatlandEMRIDVEESALPDSMVLVQASYTDRRATRKFQLRKVES
Ga0187766_1051493223300018058Tropical PeatlandADGSAEMKIDVDESSLPDSAILVQASLSGRTATRKFQLRKVEA
Ga0187772_1146050313300018085Tropical PeatlandTAAGGDAELKIDVNESSLPDSSVLVQASYQGRTATRKFELRQVES
Ga0187769_1018584343300018086Tropical PeatlandTGANGEAEMHIDVDESALPDASVLVQASYTGRTATRKFHLRKVEA
Ga0066655_1062068513300018431Grasslands SoilNGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA
Ga0066662_1084530013300018468Grasslands SoilDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA
Ga0066669_1047271333300018482Grasslands SoilTQVVTGTSGDAEMIIEADEAALPDSSVLVQASYSGRTATRKFNLRKVEA
Ga0066669_1217993723300018482Grasslands SoilEMKLEMDEASLPDSSVLVQASHSGRTATRKFQLKKVEA
Ga0193730_116064113300020002SoilKIEMDEFSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0193734_102351943300020015SoilMKIEMDEFSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0210407_1101157323300020579SoilAEMKVDVDESSLPDSAILVQASYSGRTATRKFQLRKVEA
Ga0210399_1007127713300020581SoilGDAEMKIEMEESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0210395_1055013033300020582SoilSDGDAEMKIDVDESSLPDSAVLVQANYSGRTATRKFQLRKVEA
Ga0210405_1021610213300021171SoilGDAEMKIEMDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0210408_1081051533300021178SoilKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA
Ga0210394_1100613513300021420SoilGEAEMKIDVDESSLPDSAVLVQASYSGRTATRKFQLRKVEA
Ga0210384_1074828013300021432SoilTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0210402_1024486313300021478SoilAQVLTDQAGDAEMKIEMDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0213853_1015056213300021861WatershedsDEAGDAEMKIDVDESSLSDSSVLVQASYSGRTATRKFQLKKVEA
Ga0222622_1067340013300022756Groundwater SedimentKIDMEESALPDSSLLVQASYSGRTTTRKFRLRKIES
Ga0207682_1023511513300025893Miscanthus RhizospherePAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0207684_1016097513300025910Corn, Switchgrass And Miscanthus RhizosphereVVTDPAGDAEMKIELDESSLPDSSVLVQANYSGRTATRKFQLRKIEA
Ga0207654_1086171913300025911Corn RhizosphereMTIEADESALPDSSVLVQASYSGRTATRKFNLRKV
Ga0207654_1125438923300025911Corn RhizosphereSDGSGNAEMRIEIDESALTESSVLVQANYSGRTATRKFQLRRVVA
Ga0207693_1048713633300025915Corn, Switchgrass And Miscanthus RhizosphereGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0207660_1128835313300025917Corn RhizosphereDASGNAEMRVDMDEASLPDSSVLVQATHAGRSATRKFRLRKVEA
Ga0207700_1022749253300025928Corn, Switchgrass And Miscanthus RhizosphereQAGDAEMKLEMDESSLPDSSVLVQASYSGRTATRKFQLRRVEA
Ga0207644_1123411813300025931Switchgrass RhizosphereIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA
Ga0207703_1157134923300026035Switchgrass RhizosphereAGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0207702_1127314133300026078Corn RhizosphereDAEMTIEADESALPDSSVLVQASYSGRTATRKFNLRKVEA
Ga0207702_1225163713300026078Corn RhizospherePSGDTEMKIEVDDFALPDASVLVQANYSGRTATRKFQLRKVEA
Ga0207675_10022187213300026118Switchgrass RhizosphereEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0209027_103699613300026300Grasslands SoilTDSAGDAEMKIDMEESYLPDSSLLVQASYSGRTTTRKFRLRKVES
Ga0209804_133099313300026335SoilVVSDANGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQFRKIEA
Ga0209807_107165013300026530SoilYRQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES
Ga0209376_138613023300026540SoilKVEVDESSLSDSSVLVQANYSGRTATRKFQLRKVEA
Ga0179587_1098086323300026557Vadose Zone SoilMKIEVDEASLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0208324_112525333300027604Peatlands SoilAELKIDVDESSLPDSAVLVQANYSGRTATRKFHLRKVEA
Ga0209588_110056933300027671Vadose Zone SoilQVMTDSSGDAEMKIDMEESSLPDSSLLVQASYSGRTTTRKFRLRKVES
Ga0209038_1025707513300027737Bog Forest SoilGSDGDAEMKIDVDESSLPDSAVLVQANYSGRTATRKFHLRKVEA
Ga0209180_1002327513300027846Vadose Zone SoilAEMRIEMDEFALPDSSVLVQASYSGRTATRKFQLKKVEA
Ga0209180_1011789243300027846Vadose Zone SoilVTDPAGDAEMKIEVDESALPDSSVLVQANYLGRTATRKFQLRKIEA
Ga0209590_1032873113300027882Vadose Zone SoilTQVVTDASGDVEMSMEMDEPSLQDSSVLVQANYSGRTATRKFQLRKIEA
Ga0209526_1041051413300028047Forest SoilQVVTDPSGDTEMKIEVDESSLPDSSVLVQASYSGRTATRKFQLRKVEA
Ga0268264_1062023233300028381Switchgrass RhizosphereNAEMRIEIDESALTESSVLVQANYSGRTATRKFQLRRVVA
Ga0302169_1003301913300028679FenEMSVQVEEASLPESSVLVQASYSGRTATRKFRLRAAG
Ga0307312_1029206713300028828SoilSGDAEMRIEVDESSLADSSVLVQASYSGRTATRKFQLRKVEA
Ga0308309_1051834513300028906SoilDAEMKIDVDESSLPDSAVLVQANYSGRTATRKFHLRRVEA
Ga0308309_1122071523300028906SoilTDSAGEAEMKIDVDDSSLPDSSILVQASYSGRTATRKFELRKVEA
Ga0308309_1180078613300028906SoilSDGDAEMKIDVDESSLPDSAILVQASYSGRTATRKFQLRRVET
Ga0311344_1085323613300030020BogEAEMKIDADEADLPDSSMLVQASFDGRTATRKFNLRKIET
Ga0302282_118029133300030045FenQVVTNAAGEAEMKIDADEADLPDSSMLVQASFDGRTATRKFNLRKIET
Ga0311360_1028039113300030339BogVVTDSAGNAEMKIEMDEASLPDSSVLIQANHSGRTATRKFRLRKLET
Ga0307469_1194619713300031720Hardwood Forest SoilIEVDESSLPDSSVLVQASYSGRTATRKFQLRKAEA
Ga0302322_10173149013300031902FenYAQVLTDASGNAEMSFQVDESSLPDSSVLVQANFSGRTATRKFRLRAGN
Ga0302322_10285425413300031902FenVTDSAGNAEMKIEMDEASLPDSSVLIQANHSGRTATRKFRLRKLET
Ga0311367_1047860613300031918FenSGNAEMSFQVDESSLPDSSVLVQANFSGRTATRKFRLRAGN
Ga0308175_10094528113300031938SoilQVLTDNAGTAEMNLEVEEAALSDASVLIQASYSGRTATRKFQLRRVEA
Ga0335080_1046835813300032828SoilYFQVLTDAAGNAELQIDVEESALPDSSILVQASYSGRAATRKFQLRKVEA
Ga0335080_1227873833300032828SoilGNAEMSVQVEESALPDSSVLVQASYSGRTATRKFRVRAAG
Ga0335084_1125524013300033004SoilQIVTDASGEAEMKLEMEESALPDSSVLVQASYSGRTATRKFRLRKVEA
Ga0335077_1056077113300033158SoilTGPNGEAEMRIDVEESALPDSMILVQASYTDRRATRKFQLRKVET


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.