NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062266

Metagenome / Metatranscriptome Family F062266

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062266
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 47 residues
Representative Sequence DDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM
Number of Associated Samples 120
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.29 %
% of genes near scaffold ends (potentially truncated) 96.95 %
% of genes from short scaffolds (< 2000 bps) 92.37 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.473 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil
(16.794 % of family members)
Environment Ontology (ENVO) Unclassified
(35.115 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.748 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.50%    β-sheet: 0.00%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF03795YCII 9.16
PF00903Glyoxalase 8.40
PF00199Catalase 4.58
PF00144Beta-lactamase 3.82
PF01925TauE 2.29
PF13564DoxX_2 2.29
PF00496SBP_bac_5 2.29
PF07690MFS_1 2.29
PF00072Response_reg 1.53
PF11066DUF2867 1.53
PF00696AA_kinase 1.53
PF13229Beta_helix 1.53
PF00497SBP_bac_3 0.76
PF08281Sigma70_r4_2 0.76
PF02775TPP_enzyme_C 0.76
PF13602ADH_zinc_N_2 0.76
PF069833-dmu-9_3-mt 0.76
PF01223Endonuclease_NS 0.76
PF00378ECH_1 0.76
PF00067p450 0.76
PF05988DUF899 0.76
PF03358FMN_red 0.76
PF12681Glyoxalase_2 0.76
PF13683rve_3 0.76
PF11716MDMPI_N 0.76
PF05448AXE1 0.76
PF14248DUF4345 0.76
PF02012BNR 0.76
PF05231MASE1 0.76
PF01810LysE 0.76
PF10041DUF2277 0.76
PF00106adh_short 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 9.16
COG0753CatalaseInorganic ion transport and metabolism [P] 4.58
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 3.82
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 3.82
COG2367Beta-lactamase class ADefense mechanisms [V] 3.82
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 2.29
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.76
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 0.76
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 0.76
COG2124Cytochrome P450Defense mechanisms [V] 0.76
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.76
COG3447Integral membrane sensor domain MASE1Signal transduction mechanisms [T] 0.76
COG3458Cephalosporin-C deacetylase or related acetyl esteraseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.76
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.76
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.76
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.76


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.47 %
UnclassifiedrootN/A1.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001431|F14TB_100557422All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium556Open in IMG/M
3300002561|JGI25384J37096_10140049All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300005172|Ga0066683_10325421All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300005172|Ga0066683_10833063All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300005176|Ga0066679_11044780All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005177|Ga0066690_10763372All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005180|Ga0066685_10589512All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300005180|Ga0066685_10837851All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300005353|Ga0070669_100166616All Organisms → cellular organisms → Bacteria → Proteobacteria1715Open in IMG/M
3300005438|Ga0070701_10848273All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300005439|Ga0070711_100470227All Organisms → cellular organisms → Bacteria → Proteobacteria1032Open in IMG/M
3300005459|Ga0068867_102036061All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005459|Ga0068867_102369701All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium505Open in IMG/M
3300005467|Ga0070706_101878804All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005471|Ga0070698_100871585All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300005546|Ga0070696_100332337All Organisms → cellular organisms → Bacteria → Proteobacteria1172Open in IMG/M
3300005555|Ga0066692_10825512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300005557|Ga0066704_10911105All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300005559|Ga0066700_10188835All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1418Open in IMG/M
3300005568|Ga0066703_10871377All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300005569|Ga0066705_10716131All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300005586|Ga0066691_10636897All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005615|Ga0070702_101702974All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005617|Ga0068859_100163864All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300005617|Ga0068859_100879180Not Available981Open in IMG/M
3300005829|Ga0074479_10778536All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005841|Ga0068863_101808008All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005843|Ga0068860_101484426All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005878|Ga0075297_1005735All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300005981|Ga0081538_10125098All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300006031|Ga0066651_10200859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1055Open in IMG/M
3300006049|Ga0075417_10316980All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium759Open in IMG/M
3300006791|Ga0066653_10531463All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006800|Ga0066660_10420122All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1109Open in IMG/M
3300006845|Ga0075421_101422428All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium762Open in IMG/M
3300006854|Ga0075425_100851237All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1044Open in IMG/M
3300006881|Ga0068865_101106139All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300007255|Ga0099791_10013261All Organisms → cellular organisms → Bacteria3476Open in IMG/M
3300009038|Ga0099829_10870182All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300009089|Ga0099828_11967246All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009090|Ga0099827_10319823All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300009090|Ga0099827_11696191All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009094|Ga0111539_12447111All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium606Open in IMG/M
3300009137|Ga0066709_103228733All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium594Open in IMG/M
3300009156|Ga0111538_11629326All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300009157|Ga0105092_10290067All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300009813|Ga0105057_1052751All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009815|Ga0105070_1034158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300009818|Ga0105072_1131351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium518Open in IMG/M
3300010029|Ga0105074_1106597All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010043|Ga0126380_12022841All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300010047|Ga0126382_10167028All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1527Open in IMG/M
3300010102|Ga0127453_1117251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300010117|Ga0127449_1056055All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300010303|Ga0134082_10083435All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1253Open in IMG/M
3300010304|Ga0134088_10651262All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010320|Ga0134109_10078199All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1129Open in IMG/M
3300010329|Ga0134111_10093623All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300010403|Ga0134123_13558781All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300011269|Ga0137392_10351113All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300011417|Ga0137326_1105870All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012200|Ga0137382_10658137All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium750Open in IMG/M
3300012362|Ga0137361_11620508All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012396|Ga0134057_1188040All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300012397|Ga0134056_1069994All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012397|Ga0134056_1102946All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300012400|Ga0134048_1277470All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300012403|Ga0134049_1333999All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300012407|Ga0134050_1161317All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012410|Ga0134060_1015159All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300012925|Ga0137419_10004273All Organisms → cellular organisms → Bacteria → Proteobacteria6980Open in IMG/M
3300012925|Ga0137419_10131543All Organisms → cellular organisms → Bacteria1782Open in IMG/M
3300012929|Ga0137404_11472123All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012930|Ga0137407_10096964All Organisms → cellular organisms → Bacteria2518Open in IMG/M
3300012931|Ga0153915_12750098All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium575Open in IMG/M
3300012944|Ga0137410_11028052All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300012964|Ga0153916_12739625All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012972|Ga0134077_10255425All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium726Open in IMG/M
3300012975|Ga0134110_10474971All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium565Open in IMG/M
3300012976|Ga0134076_10477190All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium566Open in IMG/M
3300014154|Ga0134075_10325515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300014166|Ga0134079_10654181All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300014320|Ga0075342_1205694All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300015358|Ga0134089_10006256All Organisms → cellular organisms → Bacteria3651Open in IMG/M
3300015359|Ga0134085_10536149All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium538Open in IMG/M
3300016341|Ga0182035_10165858All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300016371|Ga0182034_11166776All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Muproteobacteria → Candidatus Muproteobacteria bacterium RBG_16_62_13669Open in IMG/M
3300017657|Ga0134074_1312718All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300017659|Ga0134083_10477429All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300018052|Ga0184638_1289524All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300018059|Ga0184615_10188066All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300018071|Ga0184618_10373124All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300018074|Ga0184640_10475412All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300018076|Ga0184609_10558855All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium516Open in IMG/M
3300018078|Ga0184612_10200608All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300018431|Ga0066655_10613128All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300018468|Ga0066662_11024146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium819Open in IMG/M
3300019279|Ga0184642_1043954All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300019356|Ga0173481_10697846Not Available548Open in IMG/M
3300019377|Ga0190264_10101183All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300020170|Ga0179594_10288754All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300020170|Ga0179594_10289272All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium620Open in IMG/M
3300023266|Ga0247789_1093856All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300025569|Ga0210073_1087749All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300025922|Ga0207646_11593841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium563Open in IMG/M
3300025922|Ga0207646_11780702All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300026089|Ga0207648_10267348All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300026089|Ga0207648_11976427All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300026298|Ga0209236_1175476All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300026333|Ga0209158_1006779All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5999Open in IMG/M
3300026335|Ga0209804_1338074All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300026540|Ga0209376_1334744All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium577Open in IMG/M
3300026552|Ga0209577_10150821All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1828Open in IMG/M
3300026557|Ga0179587_10371927All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300027324|Ga0209845_1074217All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300027384|Ga0209854_1000903All Organisms → cellular organisms → Bacteria4174Open in IMG/M
3300027862|Ga0209701_10482255All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium677Open in IMG/M
3300027873|Ga0209814_10236323All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium791Open in IMG/M
3300027877|Ga0209293_10766697All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027954|Ga0209859_1023292All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300028828|Ga0307312_11100220All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300028889|Ga0247827_10170163All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300031908|Ga0310900_11825330All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031944|Ga0310884_10787741All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300031965|Ga0326597_10114712All Organisms → cellular organisms → Bacteria3263Open in IMG/M
3300032180|Ga0307471_103598064All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium548Open in IMG/M
3300032205|Ga0307472_102613839All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300032828|Ga0335080_10127188All Organisms → cellular organisms → Bacteria → Proteobacteria2828Open in IMG/M
3300033433|Ga0326726_10076220All Organisms → cellular organisms → Bacteria2965Open in IMG/M
3300033433|Ga0326726_11443401All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300033486|Ga0316624_11460500All Organisms → cellular organisms → Bacteria628Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil16.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.11%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand5.34%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.29%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.53%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.53%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.76%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.76%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.76%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.76%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.76%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.76%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cmEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009813Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010102Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012397Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025569Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027324Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027954Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TB_10055742233300001431SoilTAVLHGLDDDQLAKTGTVFTDLPPMTAEQLVMLGLLGHIDDHMGSIRRTIGG*
JGI25384J37096_1014004913300002561Grasslands SoilDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHIGSIRRTVGM*
Ga0066683_1032542133300005172SoilAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0066683_1083306313300005172SoilAFAVVRGLNDDQLAKSGTVFTDAPSVTAEQLIMLGLLGHIDDHMGSIRKTVGM*
Ga0066679_1104478013300005176SoilAVVRGLSDEQLAKSGTVFTDAPPMTAERLVTAGLLNHIDEHIGSIRKTVGL*
Ga0066690_1076337223300005177SoilGLSDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHIGSIRRTVGM*
Ga0066685_1058951223300005180SoilGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0066685_1083785123300005180SoilLAKSVTVFADAPPMTVEQLVMAGLLNHVDEHIGSIRKTAGG*
Ga0070669_10016661643300005353Switchgrass RhizosphereAAAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH*
Ga0070701_1084827323300005438Corn, Switchgrass And Miscanthus RhizosphereTDEQLTKSGTVFTDAPPMTAEQLINRGLIVHIDEHVGSIRKAVGH*
Ga0070711_10047022713300005439Corn, Switchgrass And Miscanthus RhizosphereALHEKGVKAAAAVVRGLDDSQLDNSGTVFTGAPPMTCLQAIDGALINHIDEHMGSIHKTVGA*
Ga0068867_10203606123300005459Miscanthus RhizosphereDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH*
Ga0068867_10236970123300005459Miscanthus RhizosphereKSGTVFTDTPPMTAEQLINLGLLSHIDEHMGSIRTTVGM*
Ga0070706_10187880423300005467Corn, Switchgrass And Miscanthus RhizosphereLAKSGTVFTGLPPMTAEQLITRGLLNHVDEHFGSIRQTVAHPTRG*
Ga0070698_10087158513300005471Corn, Switchgrass And Miscanthus RhizosphereLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAVGH*
Ga0070696_10033233733300005546Corn, Switchgrass And Miscanthus RhizosphereKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAVGH*
Ga0066692_1082551213300005555SoilNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIQKTVGM*
Ga0066704_1091110513300005557SoilDQLAKSGTVFTDVSPMTAEQLIVLGLLGHIDDHMGSIRKTIGM*
Ga0066700_1018883513300005559SoilGTVFTDAPPMTAEQLVMRGLIAHIDEHVGSIRKTVGP*
Ga0066703_1087137723300005568SoilAATAFAVVRGLNDDQLAKSGTVFTDVSPMTAEQLILLGLLGHIDDHMGSIRKTIGM*
Ga0066705_1071613123300005569SoilGKAFAVVQGLSDDQLAKSGTVFTDAPRMTAEQLIMLGLVGHIDDHMGSIRKTIGM*
Ga0066691_1063689723300005586SoilGLSDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRRTVGM*
Ga0070702_10170297423300005615Corn, Switchgrass And Miscanthus RhizosphereSVIRGLSDDQLAQTGTVFSELPPMSAEQLVNLGLIRHIDEHIGSIRKTIGR*
Ga0068859_10016386413300005617Switchgrass RhizosphereAAAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLITHIDEHVGSIRKAVGR*
Ga0068859_10087918023300005617Switchgrass RhizosphereAAAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAVGH*
Ga0074479_1077853623300005829Sediment (Intertidal)AKSGVVFTDAPPMTAERLVMLALVNHIDEHFGSIRKTVGG*
Ga0068863_10180800813300005841Switchgrass RhizospherePMAAGVVRGLSDDQLAKSGAVFTDAPAMTAEQLVMGGLINHIDEHIGSIKKTVGK*
Ga0068860_10148442623300005843Switchgrass RhizospherePTAAGVVRGLSDDQLAKSGAVFTDAPPMTAEQLIMGGLINHIDEHIGSIKKTVGK*
Ga0075297_100573513300005878Rice Paddy SoilEQLAKSATLGPGGPTMTAEQLITRGLLNHIDEHFGSIRKTVGH*
Ga0081538_1012509813300005981Tabebuia Heterophylla RhizosphereAVVRGLHDDQLAEHGTVFTDAPPMTAEEVIASGLITHIDAHIGSIRKTVGS*
Ga0066651_1020085913300006031SoilKSGTVFTDAPPMTAEQLIMRGLLGHIDEHMGSIRKTVGV*
Ga0075417_1031698043300006049Populus RhizosphereNSGTVFTGAPPMTCLQVIDGALINHIDEHMGSIHKTVGG*
Ga0066653_1053146333300006791SoilFAVVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0066660_1042012213300006800SoilTVFTDAPPMTAEQLIMRGLLGHIDEHMGSIRKTVGV*
Ga0075421_10142242813300006845Populus RhizosphereLATSGVVLADAPPLTAEQLIERGLIAHIDEHFGNIRRAVGPAPAG*
Ga0075425_10085123713300006854Populus RhizosphereTVFADVPPMSAEQLIMLGLLGHIDEHMGSIRKTAGM*
Ga0068865_10110613913300006881Miscanthus RhizosphereVFTDAPAMTAEQLVMGGLINHIDEHIGSIKKTVGK*
Ga0099791_1001326153300007255Vadose Zone SoilSKSGTVFTDVPPMTAERLIMLGLLGHIDEHMGSIRKTVGM*
Ga0099829_1087018233300009038Vadose Zone SoilAKSGTVFAGLPPMTAEQLALRALINHTDEHYGSIKKTIGA*
Ga0099828_1196724613300009089Vadose Zone SoilTVFTDAPPMTAEQLIMLGLLGHIDDHMGSIRKTIGM*
Ga0099827_1031982313300009090Vadose Zone SoilKGAPAAAAVVRGLNDDQLAKSGTVFADAPPMTAEQLIARGLINHVDEHVGSIRKTVGH*
Ga0099827_1169619123300009090Vadose Zone SoilSDEQLAKSGTVFVGMPPMTAEDMVVRALLGHLDEHYGSIRKTVGA*
Ga0111539_1244711123300009094Populus RhizosphereTAAAAGVRGLSDDQLAKSGTVFTDAPPMTAEQLIMLALLGHIDDHMGSIRKTVGG*
Ga0066709_10322873313300009137Grasslands SoilLNDDQLAKSGTVFTDVPPMTAERLIMLGLHSHIDEHVGSIRKTIDH*
Ga0111538_1162932613300009156Populus RhizosphereSDDQLAKSGTVLSDAPPMTAEQVVTGILISHIDDHFGSIRKTVGH*
Ga0105092_1029006713300009157Freshwater SedimentTVRGLSDEELAKRGAVFTDAPPMSAEELVMGALIIHIDEHFGSIRRTVGL*
Ga0105057_105275113300009813Groundwater SandAVLRGLSDDQLAKSGIVLTDAPPMSVEQIVTGGLILHLDDHFGSIRKTLGQ*
Ga0105070_103415823300009815Groundwater SandVAAAAATIRGLSDDQLAKSGTVFTGMPPMTAEQLITSGLLDHTDEHFGSIRKTVGHGTGR
Ga0105072_113135123300009818Groundwater SandDQLAKSGTVFTGMPPMTAEQLITCGLLDHTDEHFGSIRKTVGHGTGR*
Ga0105074_110659713300010029Groundwater SandIVFTDAPPMAVEQLVTSGLIIHIDEHFGSIRKTVGK*
Ga0126380_1202284113300010043Tropical Forest SoilEAVIAAGLVRRLSDDDLAKSGTVLTDRPPMTAEQLITAGLIVHIDQHSGSIRKTVDHSRVKPIPE*
Ga0126382_1016702843300010047Tropical Forest SoilATSGTVFTDAPPMTAEQLIRLGLLGHIDDHMGSIRKTVGV*
Ga0127453_111725123300010102Grasslands SoilLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0127449_105605523300010117Grasslands SoilAFAVVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0134082_1008343513300010303Grasslands SoilDQLAKSGTVFTDVSPMTAEQLILLGLLGHIDDHMGSIRKTVGV*
Ga0134088_1065126213300010304Grasslands SoilGTVFTDAPPMTAEQLIMLGLVGHIDDHMGSIRKTIGM*
Ga0134109_1007819923300010320Grasslands SoilAATAFAVVRGLNDDQLAKSGTVFTDVSPMTAEQLIVLGLLGHIDDHMGSIRKTIGM*
Ga0134111_1009362313300010329Grasslands SoilLATSETVFTDAPPMTAEQLIMLGLVGHIDDHTGSIRKTVGM*
Ga0134123_1355878123300010403Terrestrial SoilVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIMHIDEHVGSIRKAVGH*
Ga0137392_1035111313300011269Vadose Zone SoilEQLAKSGTVFAGLPPMTAEQLALRALINHTDEHYGSIRKTIGA*
Ga0137326_110587023300011417SoilRGLSDEQLAKRATVLADAPPMSVEELIMGGLLGHIDDHFGSIRKTVGR*
Ga0137382_1065813723300012200Vadose Zone SoilFTDGPPMTAEQLINLGLLSHVDEHMGSIRTTVGM*
Ga0137361_1162050813300012362Vadose Zone SoilLAKSVTVFTDGPPMTAEQLIMLGLLGHIDEHVGSIRKTIDH*
Ga0134057_118804023300012396Grasslands SoilAFAVVRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0134056_106999423300012397Grasslands SoilFAVVRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIEEHMGSIRKTVGM*
Ga0134056_110294623300012397Grasslands SoilDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0134048_127747013300012400Grasslands SoilNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0134049_133399923300012403Grasslands SoilAVRAFAVVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0134050_116131723300012407Grasslands SoilVWGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0134060_101515923300012410Grasslands SoilGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIEEHMGSIRKTVGM*
Ga0137419_1000427313300012925Vadose Zone SoilSVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM*
Ga0137419_1013154313300012925Vadose Zone SoilTAAATIRGLSDAELAASGTVLKGLPPMTAEQLIAGGLLGHIDEHYGSIRKTVGH*
Ga0137404_1147212313300012929Vadose Zone SoilVQSLSDDQLATSGTVFTDAPPMTAEQLTMLGLIGHIDDHVGSIRKTVGM*
Ga0137407_1009696413300012930Vadose Zone SoilQLATSGTVFTDAPPMTAEQLTMLGLIGHIDDHVGSIRKTVGM*
Ga0153915_1275009813300012931Freshwater WetlandsGAATAAAVVRGLSDDQLAKSGIVFTDAPPMTAEQLVQRGLVGHIDEHFGSIRKTVAKP*
Ga0137410_1102805213300012944Vadose Zone SoilSDDQLAKSGAVFTDAPPMTAEQLVMGGLINHIDEHIGSIQKTVGK*
Ga0153916_1273962523300012964Freshwater WetlandsAIAVAVIRGLSDDQLAKSGIVFTDAPPMTAEQLITGGLLGHIEEHFGSIRKTVGN*
Ga0134077_1025542533300012972Grasslands SoilGTVFTDAPPMTAEQLIKLGLVGHIDDHMGSIRKTVGM*
Ga0134110_1047497113300012975Grasslands SoilDDQLAKSGTVFTDVSPMTAEQLIVLGLLGHIDDHMGSIRKTIGM*
Ga0134076_1047719013300012976Grasslands SoilLAKSGTVFADAPPMTAEQLIARGLINHVDEPVASIRKTVGH*
Ga0134075_1032551523300014154Grasslands SoilATASAVVRGLNDDQLAKSGIVFTDAPPMTAEQLIMRGLLGHIDDHMGSIRRTVAA*
Ga0134079_1065418113300014166Grasslands SoilTVFAGAPPMTAEQLITRGLIGQIDEHFGSIRKTVGR*
Ga0075342_120569413300014320Natural And Restored WetlandsAAVVLGLSDQELAKSGTVLTGAPPMTAEQVVTGILINHIDSHFGSIRKTVGR*
Ga0134089_1000625613300015358Grasslands SoilQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGV*
Ga0134085_1053614923300015359Grasslands SoilLHDDQLTKSGTVFTDAPPMTAEQLIMRGLLGHIDEHMGSIRKTVGV*
Ga0182035_1016585833300016341SoilSLSDDQLAKSGAVFSDVPPITAEQLIMRGLLSHIDEHMGSIRKTVGM
Ga0182034_1116677623300016371SoilPVFTEAPPMTAEQLIQGALIHHVDEHIGSIRKTVGH
Ga0134074_131271813300017657Grasslands SoilVVQSLSDDQLATSGTVFTDAPPMTAEQLIMLGLVGHIDDHTGSIRKTVGM
Ga0134083_1047742923300017659Grasslands SoilLSDDQLATSGTVFTDAPPMTAEQLIKLGLVGHIDDHMGSIRKTVGM
Ga0184638_128952413300018052Groundwater SedimentVVRGLSDDQLARSGTVVRDAPPMTAEQVVTGGLFRHIDDHIGSIRKTVGK
Ga0184615_1018806613300018059Groundwater SedimentRGLSDDQMAKSGIVFTDAPAMTAEQLVQRGLVSHIDEHVGSIRKTVGR
Ga0184618_1037312413300018071Groundwater SedimentTVFTDAPPLTAEQVIAGGLINHIDEHFGSIRRTVGG
Ga0184640_1047541223300018074Groundwater SedimentPVAAAVVRGLSDDQLAKSGAVFTDAPPMTAEQVVMGGLITHIDEHFGSIRKTVGQ
Ga0184609_1055885513300018076Groundwater SedimentSGTVMKEMPPLTAEQMVIGGLIKHVDEHVASIRGTVGA
Ga0184612_1020060833300018078Groundwater SedimentSDDQLAKSGAVFTDAPPMTAEQVVMGGLITHIDEHFGSIRKTVGG
Ga0066655_1061312823300018431Grasslands SoilAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM
Ga0066662_1102414633300018468Grasslands SoilAKSGTVFADAPPMTAEQLIARGLINHVDEHVASIRKTVGH
Ga0184642_104395423300019279Groundwater SedimentVRGLSDDQLAKSGTVFTDAPPLTAEQVIAGGLINHIDEHFGSIRRTVGG
Ga0173481_1069784613300019356SoilHLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHIGSIRKAIAH
Ga0190264_1010118343300019377SoilGLSDAELATSGTLLKGLPPMTAEQVIVNGLLVHIDEHFGSIRKTVGH
Ga0179594_1028875413300020170Vadose Zone SoilVFTDAPPMTAERLIMLGLLGHIDEHLGSIRKTVGM
Ga0179594_1028927223300020170Vadose Zone SoilGTVFTEVPPMTAEQLIVLGLLGHIDDHMGSIRKTIGM
Ga0247789_109385623300023266SoilAAVVRGLTDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH
Ga0210073_108774933300025569Natural And Restored WetlandsARTGVVFAGAPAMSSEQLIMLGLINHIDEHFGSIQKTVGG
Ga0207646_1159384123300025922Corn, Switchgrass And Miscanthus RhizosphereDQLAKSGTVFTGLPPMTAEQLITRGLLNHVDEHFGSIRQTVGDATRG
Ga0207646_1178070213300025922Corn, Switchgrass And Miscanthus RhizosphereLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH
Ga0207648_1026734823300026089Miscanthus RhizosphereTAAAVVRGLSDEQLAKSGAVFTDAPAMTAEQLVMGGLINHIDEHIGSIKKTVGK
Ga0207648_1197642713300026089Miscanthus RhizosphereDDQLAKSGTVFTDAPPMTAEQLITRGLIIHIDEHVGSIRKAVGH
Ga0209236_117547613300026298Grasslands SoilMRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDDHMGSIRRAVGM
Ga0209158_100677983300026333SoilRAFAVVRGLNDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHMGSIRKTVGM
Ga0209804_133807423300026335SoilLHNQGVAAAAAVVRGLSDEQLAKSGTVFTDAPPMTAERLVTAGLLNHIDEHIGSIRKTVG
Ga0209376_133474413300026540SoilRGLSDDQLAKSGTVFTDAPPMTAEQLIMLGLLGHIDEHIGSIRRTVGM
Ga0209577_1015082143300026552SoilLSDDQLAKSGTVFTDAPPMTAEQLVMRGLIAHIDEHVGSIRKTVGP
Ga0179587_1037192733300026557Vadose Zone SoilAAATIRGLSDAELAASGTVLKGLPPMTAEQLIAGGLLGHIDEHYGSIRKTVGH
Ga0209845_107421713300027324Groundwater SandLDDDQLAKSGTVVTDAPPMTAEQVVTGGLFRHIDEHFGSIRKTVGK
Ga0209854_100090363300027384Groundwater SandRNLSDDQLAKSGIVLTDAPPMSVEQIVTGGLILHLDDHFGSIRKTLGQ
Ga0209701_1048225523300027862Vadose Zone SoilVRPRLYAPRGTAAAVVRGLSDEQLARSGIVFAGMPPSAEQLVMGGLINHVDEHSGSVRKTIGY
Ga0209814_1023632343300027873Populus RhizosphereVVRGLDDSQLNNSGTVFTGAPPMTCLQVIDGALINHIDEHMGSIHKTVGG
Ga0209293_1076669723300027877WetlandIAVAVIRGLSDDQLAKSGIVFSDAPPMTAEQLITGGLLNHIDAHFGSIRKTVRNS
Ga0209859_102329213300027954Groundwater SandATIRGLSDDQLAKSGTVFTGMPPMTAEQLIISGLLDHTDEHFGSIRKTVGDGTEW
Ga0307312_1110022023300028828SoilDQLAKSGTVFTDAPPLTAEQVIAGGLINHIDEHFGSIRRTVGG
Ga0247827_1017016313300028889SoilLAKSGTVFTDAPPMTAEQLVTRGLINHIDEHVGSIRKAVGH
Ga0310900_1182533023300031908SoilSGLVFSELPPMTAEQLIMGGLLNHIDEHIGSIRTTVGR
Ga0310884_1078774123300031944SoilLSDDQLAKSGTVFSDAPPMTAEQLMMRALLSHIDEHIGSIRKTVGI
Ga0326597_1011471223300031965SoilVRDLSDEQLAKSGIVFTGMPPMTAEQLVMRGLLGHIDEHFGSIRKTIGG
Ga0307471_10359806413300032180Hardwood Forest SoilGTVFTDVPPMTAEQLVMRGLIGHIDEHVGSIRKTVGP
Ga0307472_10261383913300032205Hardwood Forest SoilGVVRGLNDDQLGKSGTVFTDTPPMTAEQMIMLGLLGHIDEHIGSIRKTVGR
Ga0335080_1012718843300032828SoilAATVRGLSDDQLAKTGTVFTDMPPMTAEQLIMRGLLSHIDEHIGSIRKTVGM
Ga0326726_1007622013300033433Peat SoilAATVRGLSDEQLAKRGTVFSDAPPMSAEELIMGGLILHIDEHVGSIRKTVGL
Ga0326726_1144340123300033433Peat SoilGAAIAAAVIRGLSDDQLGKSAIVIANAPPMTAEQLITGGLLGHIDEHFRSIRKTV
Ga0316624_1146050013300033486SoilSDDQLAKSGMIVPGAPPMTVEQLITGGLINHLDQHFGSIRKTVGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.