Metagenome Family F062313

Basic Information
Family ID	F062313
Family Type	Metagenome
Number of Sequences	130
Average Sequence Length	50 residues
Representative Sequence	MTEDEMVGWHHQLNGHGFGWTLGVGDGQGGLACCGSWGRKESDMTERLN
Number of Associated Samples	10
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	51.20 %
% of genes near scaffold ends (potentially truncated)	48.46 %
% of genes from short scaffolds (< 2000 bps)	94.62 %
Associated GOLD sequencing projects	8
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.17

Most Common Taxonomy
Group	Eukaryota (76.154 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Unclassified → Unclassified → Continental Margin Sediment (90.000 % of family members)
Environment Ontology (ENVO)	Unclassified (90.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Sediment (saline) (90.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF03051	Peptidase_C1_2	0.77
PF00078	RVT_1	0.77
PF02994	Transposase_22	0.77

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG3579	Aminopeptidase C	Amino acid transport and metabolism [E]	0.77

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	78.46 %
Unclassified	root	N/A	21.54 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	78.46 %
Unclassified	root	N/A	21.54 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	76.15 %
Unclassified	root	N/A	21.54 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.31 %

Name	Rank	Taxonomy	Distribution
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	76.15 %
Unclassified	root	N/A	21.54 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.54 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	49.23 %
Unclassified	root	N/A	21.54 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.54 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.77 %

Name	Rank	Taxonomy	Distribution
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	49.23 %
Unclassified	root	N/A	21.54 %
Erysipelotrichia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia	0.77 %
Epsilonproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	49.23 %
Unclassified	root	N/A	21.54 %
Erysipelotrichales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales	0.77 %
Campylobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales	0.77 %

Name	Rank	Taxonomy	Distribution
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	49.23 %
Unclassified	root	N/A	21.54 %
Campylobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae	0.77 %
Erysipelotrichaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae	0.77 %

Name	Rank	Taxonomy	Distribution
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	49.23 %
Unclassified	root	N/A	21.54 %
Campylobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter	0.77 %
Holdemanella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella	0.77 %

Name	Rank	Taxonomy	Distribution
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	49.23 %
Unclassified	root	N/A	21.54 %
unclassified Holdemanella	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Sarcopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Dipnotetrapodomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Tetrapoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Amniota	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Mammalia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia	49.23 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Theria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria	48.46 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Eutheria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria	48.46 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Boreoeutheria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria	48.46 %
Unclassified	root	N/A	21.54 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Laurasiatheria	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria	47.69 %
Unclassified	root	N/A	21.54 %
Euarchontoglires	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Artiodactyla	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla	46.92 %
Unclassified	root	N/A	21.54 %
Glires	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Ruminantia	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia	43.08 %
Unclassified	root	N/A	21.54 %
Rodentia	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Pecora	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	43.08 %
Unclassified	root	N/A	21.54 %
Myomorpha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.54 %
Bovidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae	12.31 %
Cervidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae	1.54 %
Muroidea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.54 %
Bovinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae	11.54 %
Muntiacinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae	1.54 %
Muridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.54 %
Bos	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	11.54 %
Muntiacus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus	1.54 %
Murinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.54 %
Bos grunniens	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens	3.85 %
Muntiacus muntjak	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus → Muntiacus muntjak	1.54 %
Rattus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Rattus	0.77 %
Holdemanella sp. DFI.5.21	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	0.77 %
Campylobacter jejuni	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300013868\|Ga0181469_103288	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	4761	Open in IMG/M
3300016461\|Ga0126362_10009271	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2067	Open in IMG/M
3300016461\|Ga0126362_10010517	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	1978	Open in IMG/M
3300016461\|Ga0126362_10015429	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1738	Open in IMG/M
3300016461\|Ga0126362_10022565	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Glires → Rodentia → Myomorpha → Muroidea → Muridae → Murinae → Rattus	1534	Open in IMG/M
3300016461\|Ga0126362_10023813	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1506	Open in IMG/M
3300016461\|Ga0126362_10027566	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1435	Open in IMG/M
3300016461\|Ga0126362_10031676	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1370	Open in IMG/M
3300016461\|Ga0126362_10033185	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia	1349	Open in IMG/M
3300016461\|Ga0126362_10034406	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1333	Open in IMG/M
3300016461\|Ga0126362_10036607	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1305	Open in IMG/M
3300016461\|Ga0126362_10039636	Not Available	1270	Open in IMG/M
3300016461\|Ga0126362_10042974	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla	1236	Open in IMG/M
3300016461\|Ga0126362_10043888	Not Available	1227	Open in IMG/M
3300016461\|Ga0126362_10055564	Not Available	1131	Open in IMG/M
3300016461\|Ga0126362_10061326	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1093	Open in IMG/M
3300016461\|Ga0126362_10064243	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1075	Open in IMG/M
3300016461\|Ga0126362_10068463	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1052	Open in IMG/M
3300016461\|Ga0126362_10076876	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1010	Open in IMG/M
3300016461\|Ga0126362_10078600	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1002	Open in IMG/M
3300016461\|Ga0126362_10079089	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	1000	Open in IMG/M
3300016461\|Ga0126362_10080380	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	995	Open in IMG/M
3300016461\|Ga0126362_10091237	Not Available	951	Open in IMG/M
3300016461\|Ga0126362_10091873	All Organisms → cellular organisms → Eukaryota → Opisthokonta	949	Open in IMG/M
3300016461\|Ga0126362_10095686	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	935	Open in IMG/M
3300016461\|Ga0126362_10105595	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter jejuni	904	Open in IMG/M
3300016461\|Ga0126362_10112352	Not Available	884	Open in IMG/M
3300016461\|Ga0126362_10120211	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla	863	Open in IMG/M
3300016461\|Ga0126362_10120736	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	862	Open in IMG/M
3300016461\|Ga0126362_10139141	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus → Muntiacus muntjak	819	Open in IMG/M
3300016461\|Ga0126362_10139208	All Organisms → cellular organisms → Eukaryota → Opisthokonta	819	Open in IMG/M
3300016461\|Ga0126362_10140579	All Organisms → cellular organisms → Eukaryota → Opisthokonta	816	Open in IMG/M
3300016461\|Ga0126362_10141224	All Organisms → cellular organisms → Eukaryota → Opisthokonta	814	Open in IMG/M
3300016461\|Ga0126362_10142938	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	811	Open in IMG/M
3300016461\|Ga0126362_10143943	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	809	Open in IMG/M
3300016461\|Ga0126362_10146086	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	805	Open in IMG/M
3300016461\|Ga0126362_10146556	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	804	Open in IMG/M
3300016461\|Ga0126362_10146909	All Organisms → cellular organisms → Eukaryota → Opisthokonta	803	Open in IMG/M
3300016461\|Ga0126362_10153222	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	791	Open in IMG/M
3300016461\|Ga0126362_10158374	Not Available	781	Open in IMG/M
3300016461\|Ga0126362_10162056	All Organisms → cellular organisms → Eukaryota → Opisthokonta	775	Open in IMG/M
3300016461\|Ga0126362_10167684	Not Available	765	Open in IMG/M
3300016461\|Ga0126362_10168982	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	763	Open in IMG/M
3300016461\|Ga0126362_10180924	All Organisms → cellular organisms → Eukaryota → Opisthokonta	744	Open in IMG/M
3300016461\|Ga0126362_10184524	All Organisms → cellular organisms → Eukaryota → Opisthokonta	739	Open in IMG/M
3300016461\|Ga0126362_10185348	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Cervidae → Muntiacinae → Muntiacus → Muntiacus muntjak	738	Open in IMG/M
3300016461\|Ga0126362_10197955	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	720	Open in IMG/M
3300016461\|Ga0126362_10200319	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	717	Open in IMG/M
3300016461\|Ga0126362_10208312	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens	706	Open in IMG/M
3300016461\|Ga0126362_10218219	All Organisms → cellular organisms → Eukaryota → Opisthokonta	694	Open in IMG/M
3300016461\|Ga0126362_10224114	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	687	Open in IMG/M
3300016461\|Ga0126362_10224205	All Organisms → cellular organisms → Eukaryota → Opisthokonta	687	Open in IMG/M
3300016461\|Ga0126362_10236125	Not Available	674	Open in IMG/M
3300016461\|Ga0126362_10238560	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla	672	Open in IMG/M
3300016461\|Ga0126362_10239210	All Organisms → cellular organisms → Eukaryota → Opisthokonta	671	Open in IMG/M
3300016461\|Ga0126362_10243770	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	666	Open in IMG/M
3300016461\|Ga0126362_10251045	Not Available	659	Open in IMG/M
3300016461\|Ga0126362_10257255	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	653	Open in IMG/M
3300016461\|Ga0126362_10260573	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens	650	Open in IMG/M
3300016461\|Ga0126362_10265578	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	645	Open in IMG/M
3300016461\|Ga0126362_10266554	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	644	Open in IMG/M
3300016461\|Ga0126362_10266866	All Organisms → cellular organisms → Eukaryota → Opisthokonta	644	Open in IMG/M
3300016461\|Ga0126362_10271959	All Organisms → cellular organisms → Eukaryota → Opisthokonta	639	Open in IMG/M
3300016461\|Ga0126362_10276580	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	634	Open in IMG/M
3300016461\|Ga0126362_10276599	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria	634	Open in IMG/M
3300016461\|Ga0126362_10279095	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	632	Open in IMG/M
3300016461\|Ga0126362_10282970	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens	628	Open in IMG/M
3300016461\|Ga0126362_10283659	All Organisms → cellular organisms → Eukaryota → Opisthokonta	628	Open in IMG/M
3300016461\|Ga0126362_10287035	Not Available	625	Open in IMG/M
3300016461\|Ga0126362_10292932	Not Available	619	Open in IMG/M
3300016461\|Ga0126362_10297576	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla	615	Open in IMG/M
3300016461\|Ga0126362_10297742	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	615	Open in IMG/M
3300016461\|Ga0126362_10306130	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	608	Open in IMG/M
3300016461\|Ga0126362_10311312	Not Available	604	Open in IMG/M
3300016461\|Ga0126362_10330224	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	588	Open in IMG/M
3300016461\|Ga0126362_10334930	Not Available	585	Open in IMG/M
3300016461\|Ga0126362_10338076	All Organisms → cellular organisms → Eukaryota → Opisthokonta	582	Open in IMG/M
3300016461\|Ga0126362_10340170	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	581	Open in IMG/M
3300016461\|Ga0126362_10343703	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	578	Open in IMG/M
3300016461\|Ga0126362_10349325	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	574	Open in IMG/M
3300016461\|Ga0126362_10355187	All Organisms → cellular organisms → Eukaryota → Opisthokonta	570	Open in IMG/M
3300016461\|Ga0126362_10375312	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	556	Open in IMG/M
3300016461\|Ga0126362_10377915	Not Available	555	Open in IMG/M
3300016461\|Ga0126362_10382119	All Organisms → cellular organisms → Eukaryota → Opisthokonta	552	Open in IMG/M
3300016461\|Ga0126362_10383967	Not Available	551	Open in IMG/M
3300016461\|Ga0126362_10384237	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	551	Open in IMG/M
3300016461\|Ga0126362_10398782	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens	542	Open in IMG/M
3300016461\|Ga0126362_10403630	Not Available	539	Open in IMG/M
3300016461\|Ga0126362_10407513	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	537	Open in IMG/M
3300016461\|Ga0126362_10409847	All Organisms → cellular organisms → Eukaryota → Opisthokonta	535	Open in IMG/M
3300016461\|Ga0126362_10410395	All Organisms → cellular organisms → Eukaryota → Opisthokonta	535	Open in IMG/M
3300016461\|Ga0126362_10413760	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	533	Open in IMG/M
3300016461\|Ga0126362_10414990	Not Available	532	Open in IMG/M
3300016461\|Ga0126362_10424376	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Erysipelotrichia → Erysipelotrichales → Erysipelotrichaceae → Holdemanella → unclassified Holdemanella → Holdemanella sp. DFI.5.21	527	Open in IMG/M
3300016461\|Ga0126362_10429371	All Organisms → cellular organisms → Eukaryota → Opisthokonta	524	Open in IMG/M
3300016461\|Ga0126362_10432512	Not Available	523	Open in IMG/M
3300016461\|Ga0126362_10434326	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	522	Open in IMG/M
3300016461\|Ga0126362_10437727	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	520	Open in IMG/M
3300016461\|Ga0126362_10437795	All Organisms → cellular organisms → Eukaryota → Opisthokonta	520	Open in IMG/M
3300016461\|Ga0126362_10438163	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	520	Open in IMG/M
3300016461\|Ga0126362_10441916	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	518	Open in IMG/M
3300016461\|Ga0126362_10452509	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	512	Open in IMG/M
3300016461\|Ga0126362_10453228	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	512	Open in IMG/M
3300016461\|Ga0126362_10456167	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	510	Open in IMG/M
3300016461\|Ga0126362_10458022	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	509	Open in IMG/M
3300016461\|Ga0126362_10463906	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	506	Open in IMG/M
3300016461\|Ga0126362_10464379	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos grunniens	506	Open in IMG/M
3300016461\|Ga0126362_10465005	Not Available	506	Open in IMG/M
3300016461\|Ga0126362_10466451	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	505	Open in IMG/M
3300016461\|Ga0126362_10468657	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora	504	Open in IMG/M
3300016461\|Ga0126362_10468844	All Organisms → cellular organisms → Eukaryota → Opisthokonta	504	Open in IMG/M
3300016461\|Ga0126362_10469831	All Organisms → cellular organisms → Eukaryota → Opisthokonta	503	Open in IMG/M
3300016461\|Ga0126362_10473619	Not Available	501	Open in IMG/M
3300017709\|Ga0181387_1071645	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos	698	Open in IMG/M
3300018475\|Ga0187907_11615691	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla	631	Open in IMG/M
3300020815\|Ga0214108_10440424	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae	668	Open in IMG/M
3300020816\|Ga0214090_10224482	Not Available	574	Open in IMG/M
3300020816\|Ga0214090_11231484	All Organisms → cellular organisms → Eukaryota → Opisthokonta	555	Open in IMG/M
3300020817\|Ga0214258_10365629	Not Available	505	Open in IMG/M
3300020818\|Ga0214277_11733684	All Organisms → cellular organisms → Eukaryota → Opisthokonta	659	Open in IMG/M
3300023280\|Ga0255813_10238875	Not Available	723	Open in IMG/M
3300023291\|Ga0256703_10005669	All Organisms → cellular organisms → Eukaryota → Opisthokonta	544	Open in IMG/M
3300023291\|Ga0256703_11048558	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1181	Open in IMG/M
3300023291\|Ga0256703_11417611	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1047	Open in IMG/M
3300023291\|Ga0256703_11596524	All Organisms → cellular organisms → Eukaryota → Opisthokonta	614	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.17
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.17
Powered by PDBe Molstar

Habitat	Taxonomy	Distribution
Environmental	Environmental	90.77%
Engineered	Engineered	8.46%
Host-Associated	Host-Associated	0.77%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	90.77%
Bioreactor	Engineered → Bioreactor	6.92%
Mammals	Host-Associated → Mammals	0.77%
Solid Waste	Engineered → Solid Waste	0.77%
Built Environment	Engineered → Built Environment	0.77%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	90.77%
Aerobic	Engineered → Bioreactor → Aerobic	6.15%
Digestive System	Host-Associated → Mammals → Digestive System	0.77%
Landfill	Engineered → Solid Waste → Landfill	0.77%
Anaerobic	Engineered → Bioreactor → Anaerobic	0.77%
Unclassified	Engineered → Built Environment → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Marine → Unclassified	90.00%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified	6.15%
Strait	Environmental → Aquatic → Marine → Strait	0.77%
Large Intestine	Host-Associated → Mammals → Digestive System → Large Intestine	0.77%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	0.77%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	0.77%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.77%

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F062313

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300013868	Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In2 SAF170 SPAdes reassembly	Engineered	Open in IMG/M
3300016461	Continental margin sediment microbial communities from China - ANME2c_DSS_Sorted metaG	Environmental	Open in IMG/M
3300017709	Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27	Environmental	Open in IMG/M
3300018475	Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 1	Host-Associated	Open in IMG/M
3300020815	Food waste microbial community from Durham, Ontario, Canada - FW2 megahit	Engineered	Open in IMG/M
3300020816	Food waste microbial community from Durham, Ontario, Canada - FW1 megahit	Engineered	Open in IMG/M
3300020817	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed1 megahit	Engineered	Open in IMG/M
3300020818	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2	Engineered	Open in IMG/M
3300023280	Combined Assembly of Gp0238881, Gp0242115	Engineered	Open in IMG/M
3300023291	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119	Engineered	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0181469_1032883	3300013868	Clean Room	MQEEKGTTEDEIVGWHHQLNGREFVLTPGVDDGQGGLACCGLWGCKESDMTEQLN*
Ga0126362_100092711	3300016461	Continental Margin Sediment	DEMVGWHHQLNGHGFGWTPGVGDGQGGLACCGSLGCKESDTTERVN
Ga0126362_100105171	3300016461	Continental Margin Sediment	MVGWHHGLNGHGFGWTLGVGDGQGGLACCASWGRKELDTTE
Ga0126362_100154291	3300016461	Continental Margin Sediment	GQEEKGMIEDEMVGWHHRLNGLGIGRTPGIGDGQGGLACCGSLGHKESDTTERLN
Ga0126362_100225651	3300016461	Continental Margin Sediment	TEDEMAGWHHRLNGHGFGWTPGVGDGQGGLACCGPGGRKESDTTERLN
Ga0126362_100238132	3300016461	Continental Margin Sediment	MTEDEVVGWHHRLNGRGFGWTPGVGDGQGGLACCGSGGRKESDMTERLNWSGSQQTLQLC
Ga0126362_100275661	3300016461	Continental Margin Sediment	EKGTTEDEMVGWHHRLNGHGFGWTPGVGDGQEGLACYGLWGRKESDTTE
Ga0126362_100316762	3300016461	Continental Margin Sediment	MTEDEMVGRHHRLDGHGFGWAPGVDDGQRGLACYGSWGHKESDTTEQLN
Ga0126362_100331851	3300016461	Continental Margin Sediment	VTEDDMVGWHHRLNGHGFGWTPGVGDGQGGLACCSPWVRKESDMTERLN
Ga0126362_100344061	3300016461	Continental Margin Sediment	HHRHNGHGFAWTLGVGDGQGGLVCCGSWDGKELDMTE
Ga0126362_100366071	3300016461	Continental Margin Sediment	DEMVGWLHGLNGYGFVWTPGLGDGQGGLVCCSSWGLKELDMTEQLN
Ga0126362_100396361	3300016461	Continental Margin Sediment	MTEDEMVGQHHQLNGHEFGWIPGVGDGQGGLACCGSWGRKESDTTERLN
Ga0126362_100429741	3300016461	Continental Margin Sediment	MTQNEMVGWHHQLDGHEFGSTPGVGGQGGLACYRSWGRKELDTTEQLN
Ga0126362_100438881	3300016461	Continental Margin Sediment	MKEDEVVGWHHQLNGHGFMWTLGVGDGQGGLVCYGSWGRKELDTVE
Ga0126362_100555642	3300016461	Continental Margin Sediment	MVGWHHQVNGHGFGWTPGVGDGQGSLAYCGSRGLKDSDTTERLN
Ga0126362_100613261	3300016461	Continental Margin Sediment	MTEDEMAGWHHRLNGHEFAYTPRVGDGQGGLACCNSWGRKESDTTEQLS
Ga0126362_100642432	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLDGHGFGWTLRVGDGQGGLAWYSSWGHKELDTTELLN
Ga0126362_100684631	3300016461	Continental Margin Sediment	MTEGETIGWHHRLNGHGFGWTPGVGDGQGGLARCSSWGCKESDTTEQLT
Ga0126362_100768762	3300016461	Continental Margin Sediment	MKEDEMVGWHDRLNGHGFGWTLGVGDGQGGLVCWGSWGRKESGTTEQLN
Ga0126362_100786001	3300016461	Continental Margin Sediment	TTEDEMVGWHHQLNGHGFGWTLGVGDGQRGLACCSSWGRKESDVTE
Ga0126362_100790891	3300016461	Continental Margin Sediment	MTEDEMVGWHHRFNGHEFGWTPGVGDGQGGLALCGSWSHKESDITELRN
Ga0126362_100803801	3300016461	Continental Margin Sediment	MTEDKMVVWYHRIDGHGFGWTPGIGDGQEGLACCGSWGRKESTQLSD
Ga0126362_100912372	3300016461	Continental Margin Sediment	MTEDEMAGWHHQLDGHGFGWTTGVGDGQGGLVCCGSCGHRELDTTE
Ga0126362_100918731	3300016461	Continental Margin Sediment	RNSGRDWGQEEKRRTEDEMVGWHHRLDGHGFGWTLAVGDGQGGLACCSSWGHKESDAT
Ga0126362_100956862	3300016461	Continental Margin Sediment	MTEDEMFGWHHRHNGHGFGWTLGVGDGQGGLACCGSWDCKELDTTEQLN
Ga0126362_101055951	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLEGHGFGWTLGVGDGQGGLVCCVSWGCKQSETTE
Ga0126362_101123521	3300016461	Continental Margin Sediment	EKGTTEDEMVGWHHRLDGHGFGWTPGVGDGQRSLACCSSCGHKESGTTERLN
Ga0126362_101202111	3300016461	Continental Margin Sediment	GMTEDEMVGWHHQLDGHGFGWTPGVGDGQGGLACCGPWGCKETRLSD
Ga0126362_101207361	3300016461	Continental Margin Sediment	GIEDEMAGWHHRLNGHEFGSTPGVGDGQGSLAWCSPWGYKELDMTDQLN
Ga0126362_101391411	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLDGHGFGWTPGVGDGQGGLACYSSWCRKELDTTERLN
Ga0126362_101392082	3300016461	Continental Margin Sediment	MTEDEMIGWHHQHNGQGFGWTLGVGDGQGGLAYCGSWGRKELDPTEQLN
Ga0126362_101405791	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLNGHDFEQTLGVGDGQEGLVCCSPWGCKESDTTE
Ga0126362_101412241	3300016461	Continental Margin Sediment	ENEMVGWHYRLDGQGFGWTPRVGDGQGGLASCGSWGRKESDTTEQLN
Ga0126362_101429381	3300016461	Continental Margin Sediment	EKETTASEMVGWHHRLNGHGFEWTPGVGDGQGGLLCCSSWGRKELDTKE
Ga0126362_101439432	3300016461	Continental Margin Sediment	MAGCHHRLDGHGFGWTPGVGDGEGGLACCDSWGRKELDVTE
Ga0126362_101460861	3300016461	Continental Margin Sediment	EEKGTTEDKMVGWHHRLNGHGFGWTPGVGDGHGGLACCGSWGHKESDMTE
Ga0126362_101465561	3300016461	Continental Margin Sediment	IEDEMVGERHRLNGHGFGWTPGVGDGQGGLVCCSSWGRKESDTTERLN
Ga0126362_101469091	3300016461	Continental Margin Sediment	ENETVGWHHRLNGDGFGWTPGVGDGQGGLACCGSWGRKESDMTERLSLSLSDCR
Ga0126362_101532221	3300016461	Continental Margin Sediment	EEKGATEDEMLGWHHRLNGHGFGWTLGVGDRQGNLACCGSWGHKESDMTE
Ga0126362_101583741	3300016461	Continental Margin Sediment	AGRDWGQEEKGTTEDEMAGWHHRLDGHGFGCPGVGDGQGGLAWCGSWGHKESDRTERLN
Ga0126362_101620561	3300016461	Continental Margin Sediment	RQEEKGTTEDEMAGWHHRLDGRAFGSTPGVGDGQGGLACCGSWGLKESDMTERLN
Ga0126362_101676842	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLNGHGFGWTLGVGDGQGGLACCGSWGRKESDMTERLN
Ga0126362_101689822	3300016461	Continental Margin Sediment	KDPDAGKDRKQEKWVTEDEMAGWHHQLNGHVFGWTPGVGDGQGGLAGCSPWGHKESDTTE
Ga0126362_101712091	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLDGHGFGRTPGFGNGQGSLACCSLWGHKELDMTERLN
Ga0126362_101809243	3300016461	Continental Margin Sediment	EEEKGTTEDEMVGWHHRLNEHGFGWAPGVGDGQGGLVCCGSWGRKESDTTERLN
Ga0126362_101845242	3300016461	Continental Margin Sediment	MTEDKMVGWHHRLNRPGLGGLGVGDGQQGLACCDSWGCKESDMTERLN
Ga0126362_101853481	3300016461	Continental Margin Sediment	MTEEEMVGWNHRRDGHGFGWSLGVGDGQGGLACCGSWGHKESDMTEQLN
Ga0126362_101979552	3300016461	Continental Margin Sediment	MTEEEKGTTEDEMVGWHHQLNGHGFEQTLGDGEGQGSVMCYSPWSSRVGHD
Ga0126362_102003192	3300016461	Continental Margin Sediment	MVGWHHRLNGHGFGWTPRVGDGQGGLACCSPWGRKESDMTERL
Ga0126362_102083121	3300016461	Continental Margin Sediment	MTEDETVGWHHRLNGHECEWTPGLGDGQGSLACCSPWSRKELDTTELLN
Ga0126362_102182192	3300016461	Continental Margin Sediment	MTGDEMAGWHHRHNGHEFGWIPGVGDGQGGLVCCGSWGRRESDTTERLN
Ga0126362_102241141	3300016461	Continental Margin Sediment	KDPDAGRNWGQEEKGTTEDEMVGWHHRLNGRGFGWTLGIGDGQGGLACCNSWGHKESDTTEQLN
Ga0126362_102242052	3300016461	Continental Margin Sediment	GQEENGTTEDEMVGWHHQLNGHGFECTPGVGDRQGGLVCCGSWGHKESDTTERLN
Ga0126362_102361251	3300016461	Continental Margin Sediment	MTEDETAGWHHLLDGHGFGWTPGVGDGQGGLACCGSWGHKELDTTE
Ga0126362_102385602	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLYGHGFGWAPGIGDAQGGLACCGSWGRKELDATQRLN
Ga0126362_102392101	3300016461	Continental Margin Sediment	KGTTEDEMVGWHHQLDGHEFGSTTGVGDGQGGLACCDSWGPIESDTSEQLN
Ga0126362_102437702	3300016461	Continental Margin Sediment	MIEDKMVGWHHRLNGHGFGWTPRVGDGQEGLACCGSWGCKELDTTEQLN
Ga0126362_102454851	3300016461	Continental Margin Sediment	MTEDEMVGWHHGHNEHGFGWTLGVGDGQEGLVCCGSWGCKELDTTERLN
Ga0126362_102510451	3300016461	Continental Margin Sediment	EDEMVGLHHRFNGHGFGDGQGGLECSGSWGRKESDMTELN
Ga0126362_102572551	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLNGHEFGWTPGVGDGQGGLACCGSWGHKESDTTE
Ga0126362_102605732	3300016461	Continental Margin Sediment	MTEDEMAGWHHRRNAHGFGWTPGDGDGQGGLACYDSWGHKESDTTERLNEPLCGGAAQDA
Ga0126362_102655781	3300016461	Continental Margin Sediment	GMTEDEMVGWHHRLNGHGFGWTPGVSDGQGGLARYSPWGRIESDMTV
Ga0126362_102665542	3300016461	Continental Margin Sediment	EEKGMTEDKMVGWHHRLNGHGFGWTPGVGDGQGGLACCSSWGRKESDTTERLN
Ga0126362_102668661	3300016461	Continental Margin Sediment	GMTEDEMAGWHHQLDAHGFGWTPGVGDGQGGLACCGSWCRKESDTTERLN
Ga0126362_102719591	3300016461	Continental Margin Sediment	MEKTFDVGRDWGQEEKRPTEDEMAGWHHQLHEHEFEFTPGVGDGQGGLACCNSWGHKESDTTERLN
Ga0126362_102765801	3300016461	Continental Margin Sediment	MTEDAVIGWHHRLNRHGFEWAPGVSDGQGGLACCGSWGHKELDTTE
Ga0126362_102765991	3300016461	Continental Margin Sediment	QEKKGTTEEEMVGWHHRLTRHGFGWTPGVGDGQRGLACCGSWGHKESDMTERLN
Ga0126362_102790951	3300016461	Continental Margin Sediment	EKGTTEDEMVGWHHQLNGHGFGWTLGVGDGQGGLACWGSRGCKELDTTEQLN
Ga0126362_102829702	3300016461	Continental Margin Sediment	MTEDEMVGWRHRLDGHRFGWTLGVGDGQGGLACCGSRGCKESDTNELLN
Ga0126362_102836592	3300016461	Continental Margin Sediment	MTEDEMVGWHHQFNGHGFVWIPGVGDRQGVLACCSSWGCKELDIAERVN
Ga0126362_102870351	3300016461	Continental Margin Sediment	RDWGQEEEGTTEDEMAGWQHRLDGHEFVYTPGVGDGQGGLVCCDSWGHKESDTTERLN
Ga0126362_102929322	3300016461	Continental Margin Sediment	MLGKIEGRQEEKGTTEDEMAGWHHRFNGHEFEHTAGVGDGQGSLACQSPWGCKELDMTEQLN
Ga0126362_102975762	3300016461	Continental Margin Sediment	MGTTEDEMVGWYHLLYGHGFGWTPEVDDGRGGLVCCGSWGCKESDTTEQLN
Ga0126362_102977422	3300016461	Continental Margin Sediment	EKGTTEDEMVGWHHRRNGHGFGWTLAVGEGQGRLVCCGSWGSKESDTTERLN
Ga0126362_103061301	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLDGHGFGWTPGVGNGQGGLACCGSWGRKELDTSEQLN
Ga0126362_103113121	3300016461	Continental Margin Sediment	VGGKGTTKDEIAGWHHRLNGHEFEWTPGVGDGQGGLVGCSPWGHKESATTE
Ga0126362_103302241	3300016461	Continental Margin Sediment	VKGTTKDEMVGWHHRLNGRGFEWTLGVGDGQGGLACCSSLGCKESDTTEQLN
Ga0126362_103349301	3300016461	Continental Margin Sediment	QEEKGTTEDEMVGWHHRLNDEKTLGVGEGQGGLACCGPWGHKESDMTEQLN
Ga0126362_103380762	3300016461	Continental Margin Sediment	MTEDKMAGWHHRLDGHEFEWTPGVGDGQGGLACWNSWGCKESDMTEQLN
Ga0126362_103401701	3300016461	Continental Margin Sediment	KGTTEDEMVGWHHRLNGHEFGWTPGVGDGQGGLACCGSWGHKESDMTEQLN
Ga0126362_103437031	3300016461	Continental Margin Sediment	DAGKDKGKEKKGTTENEMVGWHHQLDGHGFGWTLGVGDGQGGLACCGSWGHNESDATE
Ga0126362_103493251	3300016461	Continental Margin Sediment	TEDEMVGWYHRLNGHGFGWTPGVGDGQGGLACCGSQDHKESDTNERLN
Ga0126362_103525881	3300016461	Continental Margin Sediment	GQEEKGTTEDEMVGWHHRLIGHEFGQTPGVGDGQRSLACCDSWGCKELDMTERLN
Ga0126362_103551871	3300016461	Continental Margin Sediment	MTEDEMVEWHHRLNGHGFGWTLGVGDGQGGLACCGSWGRKESDRTKRLN
Ga0126362_103658512	3300016461	Continental Margin Sediment	WGQEDKGTTEDEMVGWHHRFNEHEFTWVNSGSLVHCGSWGCKELDTTEQLK
Ga0126362_103753121	3300016461	Continental Margin Sediment	MVGWHHRLNGHGFGWTLGVGNGQGGLVCCGSCARKESDMTDRLFPS
Ga0126362_103779151	3300016461	Continental Margin Sediment	MTEDETAGWHHLLDGHGFGWTPRVGDGQGGLACCGSWGHKELDMTEPLILN
Ga0126362_103821191	3300016461	Continental Margin Sediment	MTEDEMVGWHDEVNGHGFGWTLGVGDGQGGLVCFGSQVRKELDMTE
Ga0126362_103839671	3300016461	Continental Margin Sediment	CWERLRAGEEKDTENEMVGWHHQLNGHEFEQTPGDTEGQGSLACCSLLGRKESDMT
Ga0126362_103842371	3300016461	Continental Margin Sediment	QEEKGMTEDEMVGWHHQLNGHGFGWTLGVGDGQGGLVCCSSWGCKELDMTEQLN
Ga0126362_103987821	3300016461	Continental Margin Sediment	VQEEKGMTEDKMAGWYHRPNVNEFGRTPAVGAGQGGLACCDPWGHKESDMAEQLN
Ga0126362_104036301	3300016461	Continental Margin Sediment	GKGTTEDEIVGWHQRLNGHKFGQTPGVGDEQGDLACCSPWGCKGSDRPERLN
Ga0126362_104075131	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLDGHGFGWTLGVGDGQGGLACCGTWGRKESDTTERLN
Ga0126362_104098471	3300016461	Continental Margin Sediment	QEEKGTTEDEMVGWHHQLNGHGFGWTPGIGDGQGGLVCCGSWGLKELDTTE
Ga0126362_104098911	3300016461	Continental Margin Sediment	MVGGHHRLDGYGIGWTPGVGDGQGGLACCGSRGHKESDMTKPLNRTD
Ga0126362_104103951	3300016461	Continental Margin Sediment	MVGWHHQFSGDESEYTLGVGDGQEGLVCCGSWGRKESDTTEQLN
Ga0126362_104137602	3300016461	Continental Margin Sediment	MTEDEMVGWHDRLDGHEFGWTPGVGDGQGGLVCCGSWGHKESDMTEQLN
Ga0126362_104149901	3300016461	Continental Margin Sediment	EKGTTEDEMVGWHHRLNGHGFGWTPGVGDGQGGLACCWCATLCWGHKELDMTEQLN
Ga0126362_104243761	3300016461	Continental Margin Sediment	QEEKGTTEDETVGWHHLLNGHESGETSGLGDGQGGLACCGSWNDKESDTTE
Ga0126362_104293711	3300016461	Continental Margin Sediment	MTEDEMVGWYHQVNGHGFGLTPGVGDEQGGQACCSSWGCKESETTERLN
Ga0126362_104325121	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLNGHEFGSALGVGDGQGGLACCGSWGCKESDTTE
Ga0126362_104343261	3300016461	Continental Margin Sediment	EEKGTTEDEMVGWHHRLNGHGFGWTPGIGDGQGGLVCCGSWGVKESDTN
Ga0126362_104377272	3300016461	Continental Margin Sediment	EMLGKKEEKGTTEDEMAGWHHRHSGHRFGWTPGVGDGQGGLACCGSWGRKELDTTE
Ga0126362_104377951	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLNGHGFGWTPGVGDGQGGLVCCDLWGHKESDTTERLN
Ga0126362_104381631	3300016461	Continental Margin Sediment	MTEDEMVGWHHRLNGHEFGWTLGVGDGQGGLACCGSWGRRELDTTERLN
Ga0126362_104419161	3300016461	Continental Margin Sediment	DSDAGRDWGQEVKRMTEDEMAGWHHRLDGHEFGKTSGVGYGQGGLACRDSWGHKESDMTERLN
Ga0126362_104525091	3300016461	Continental Margin Sediment	MTEDEMVGWHLRLNGHAFGWTPGVGDGQRGLVCCSSSGRKESDMTEGLN
Ga0126362_104532281	3300016461	Continental Margin Sediment	EKGTTEDEMVGWHHQLNGHGFGWTPGVGDGQGGLACSSLWRCKESDVSERLN
Ga0126362_104561672	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLDGHEFEQSPGVGDGRGGLVCYGSWGHKELDTTGQLN
Ga0126362_104580221	3300016461	Continental Margin Sediment	MIENEMVGWHHRLNGHEFGWPPRVGDGQGGLACCSPLGRKEADTTEGLN
Ga0126362_104639062	3300016461	Continental Margin Sediment	RREKGTTEDEMAGWHHSLGGLEFGWTPGVGDGQGGLACCNSWGRKESDMTERLN
Ga0126362_104643792	3300016461	Continental Margin Sediment	MTEDEMIGWHHRLNGHEFGWTPTVGDGQGSLAWCSPWGHKESDTTE
Ga0126362_104650051	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLNEYGFGWNPGVGDGREGLVCCSSWGLKESGMTKRLN
Ga0126362_104664511	3300016461	Continental Margin Sediment	MTEDEMAGWHHRLDGHGFGWTLRVGDGQGGLACCSLRGHEESDKTERLN
Ga0126362_104686571	3300016461	Continental Margin Sediment	EKGTTEDEMAGWHHQLDAHEFRWTLGVDDGQGGLACCDSWGRKESDTTE
Ga0126362_104688441	3300016461	Continental Margin Sediment	KDSDAGRDWGQEEKGTTEDEMAGWHHRLDGREFVCTLGVGDGQGGLVCYNSRGRKESDMT
Ga0126362_104698312	3300016461	Continental Margin Sediment	MTEDEMVGWHHQLNGHGFGWIPGVGDGQGGLECCSSWGCKESDTTE
Ga0126362_104736191	3300016461	Continental Margin Sediment	KGTTEDEMAGWHHQLNGHGFGWILAVGNGQGCLVCCGSWGHKELDTTK
Ga0181387_10716451	3300017709	Seawater	MDKMVGWHHRHNGHGFGWTPGVSDGQGGLECCSSWGHKVPDTTE
Ga0187907_116156912	3300018475	Goat Feces	MTEDEMVGWHHQLNGHGFGWTLGVGDGQGGLVCCGSWGRKESDTTEQLK
Ga0214108_104404241	3300020815	Food Waste	MTDDEMAGWYHGLYGRESECTLGDGDGQGGLACCDSWGCKESDTTE
Ga0214090_102244821	3300020816	Food Waste	MTMCVGMTEDEMVGWHHQLNGHGFGWTPEFGDGQGGLECCGSWTHKESDTTERLN
Ga0214090_112314841	3300020816	Food Waste	MTEDKMVGWHHRLNGHEFGWTPGVGDGQRGLVYCGTWGHKKSNTIEQLN
Ga0214258_103656292	3300020817	Food Waste	MLGKIEQEEKRTTEDEMVGWHHQLDGHGFGWTPGVGDGQGGLACCGSWGHKESGTTEPLN
Ga0214277_117336841	3300020818	Food Waste	MTEDEMVGWHLRLNGHAFGWTPGVGDGQRALVCCSSSGRKESDMTE
Ga0255813_102388752	3300023280	Food Waste	MTEDEMAGWHHRVDGHEFEWTLGVGDGQGGLECCYSWGHKEADMTE
Ga0256703_100056691	3300023291	Food Waste	HHRLNGREFGWTLGVGDGQEGLACCSPWGRKVSDVTEQLN
Ga0256703_110485581	3300023291	Food Waste	QEEKRTTEDEMVGWHHQLDGHGFGWTPGVGDGQGGLACCGSWGHKESGTTESLN
Ga0256703_114176113	3300023291	Food Waste	SKADSLEKTLMQGKTRQKEKGTTDNKMVRWHHQLNGHGFGWTPRVGDGQGGLVCCGSWGRKESHATERLI
Ga0256703_115965241	3300023291	Food Waste	MTEDETVGWYHLLNGHGFGCTLGVGDGQGGMACCDSYSRKESDMTERLN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign