Metagenome Family F062314

Basic Information
Family ID	F062314
Family Type	Metagenome
Number of Sequences	130
Average Sequence Length	42 residues
Representative Sequence	MPSLIKLDMEFSLVIELKLAVVDTGYFVGLTPAENSQTQIGEVLR
Number of Associated Samples	69
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	52.99 %
% of genes near scaffold ends (potentially truncated)	16.92 %
% of genes from short scaffolds (< 2000 bps)	90.00 %
Associated GOLD sequencing projects	68
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.308 % of family members)
Environment Ontology (ENVO)	Unclassified (93.077 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.077 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300000651\|AP72_2010_repI_A10DRAFT_1012736	Not Available	1092	Open in IMG/M
3300005338\|Ga0068868_101233045	Not Available	693	Open in IMG/M
3300013296\|Ga0157374_12826180	Not Available	513	Open in IMG/M
3300013296\|Ga0157374_12956542	Not Available	502	Open in IMG/M
3300013297\|Ga0157378_10648515	Not Available	1071	Open in IMG/M
3300014969\|Ga0157376_10953110	Not Available	879	Open in IMG/M
3300015267\|Ga0182122_1009695	Not Available	865	Open in IMG/M
3300015267\|Ga0182122_1017896	Not Available	736	Open in IMG/M
3300015267\|Ga0182122_1043014	Not Available	583	Open in IMG/M
3300015267\|Ga0182122_1066719	Not Available	514	Open in IMG/M
3300015268\|Ga0182154_1039886	Not Available	599	Open in IMG/M
3300015268\|Ga0182154_1067508	Not Available	516	Open in IMG/M
3300015269\|Ga0182113_1050826	Not Available	613	Open in IMG/M
3300015269\|Ga0182113_1054105	Not Available	602	Open in IMG/M
3300015274\|Ga0182188_1009416	Not Available	815	Open in IMG/M
3300015274\|Ga0182188_1054775	Not Available	521	Open in IMG/M
3300015275\|Ga0182172_1010617	Not Available	863	Open in IMG/M
3300015275\|Ga0182172_1072970	Not Available	510	Open in IMG/M
3300015276\|Ga0182170_1015415	Not Available	788	Open in IMG/M
3300015276\|Ga0182170_1056865	Not Available	552	Open in IMG/M
3300015277\|Ga0182128_1028707	Not Available	672	Open in IMG/M
3300015277\|Ga0182128_1035011	Not Available	637	Open in IMG/M
3300015282\|Ga0182124_1007980	Not Available	956	Open in IMG/M
3300015283\|Ga0182156_1042099	Not Available	625	Open in IMG/M
3300015283\|Ga0182156_1060319	Not Available	564	Open in IMG/M
3300015286\|Ga0182176_1044449	Not Available	619	Open in IMG/M
3300015287\|Ga0182171_1024835	Not Available	723	Open in IMG/M
3300015287\|Ga0182171_1048920	Not Available	600	Open in IMG/M
3300015287\|Ga0182171_1049682	Not Available	598	Open in IMG/M
3300015287\|Ga0182171_1059673	Not Available	566	Open in IMG/M
3300015288\|Ga0182173_1034073	Not Available	658	Open in IMG/M
3300015291\|Ga0182125_1037486	Not Available	660	Open in IMG/M
3300015291\|Ga0182125_1040830	Not Available	645	Open in IMG/M
3300015294\|Ga0182126_1025616	Not Available	738	Open in IMG/M
3300015294\|Ga0182126_1039718	Not Available	653	Open in IMG/M
3300015294\|Ga0182126_1071864	Not Available	549	Open in IMG/M
3300015295\|Ga0182175_1091184	Not Available	515	Open in IMG/M
3300015296\|Ga0182157_1052912	Not Available	616	Open in IMG/M
3300015298\|Ga0182106_1018676	Not Available	831	Open in IMG/M
3300015298\|Ga0182106_1028085	Not Available	739	Open in IMG/M
3300015298\|Ga0182106_1085771	Not Available	532	Open in IMG/M
3300015299\|Ga0182107_1018792	Not Available	831	Open in IMG/M
3300015299\|Ga0182107_1031356	Not Available	720	Open in IMG/M
3300015300\|Ga0182108_1029142	Not Available	740	Open in IMG/M
3300015300\|Ga0182108_1035363	Not Available	701	Open in IMG/M
3300015300\|Ga0182108_1041621	Not Available	669	Open in IMG/M
3300015300\|Ga0182108_1077373	Not Available	556	Open in IMG/M
3300015302\|Ga0182143_1099633	Not Available	510	Open in IMG/M
3300015303\|Ga0182123_1002859	Not Available	1325	Open in IMG/M
3300015304\|Ga0182112_1091181	Not Available	527	Open in IMG/M
3300015305\|Ga0182158_1066076	Not Available	579	Open in IMG/M
3300015307\|Ga0182144_1048703	Not Available	641	Open in IMG/M
3300015307\|Ga0182144_1084556	Not Available	544	Open in IMG/M
3300015309\|Ga0182098_1100870	Not Available	549	Open in IMG/M
3300015314\|Ga0182140_1034882	Not Available	722	Open in IMG/M
3300015321\|Ga0182127_1093649	Not Available	552	Open in IMG/M
3300015322\|Ga0182110_1030104	Not Available	774	Open in IMG/M
3300015341\|Ga0182187_1117113	Not Available	611	Open in IMG/M
3300015341\|Ga0182187_1185279	Not Available	517	Open in IMG/M
3300015343\|Ga0182155_1096412	Not Available	685	Open in IMG/M
3300015343\|Ga0182155_1172472	Not Available	556	Open in IMG/M
3300015343\|Ga0182155_1223942	Not Available	503	Open in IMG/M
3300015343\|Ga0182155_1224727	Not Available	502	Open in IMG/M
3300015344\|Ga0182189_1088594	Not Available	715	Open in IMG/M
3300015344\|Ga0182189_1094331	Not Available	700	Open in IMG/M
3300015344\|Ga0182189_1213791	Not Available	516	Open in IMG/M
3300015345\|Ga0182111_1154503	Not Available	602	Open in IMG/M
3300015346\|Ga0182139_1094914	Not Available	723	Open in IMG/M
3300015346\|Ga0182139_1223512	Not Available	521	Open in IMG/M
3300015346\|Ga0182139_1244399	Not Available	503	Open in IMG/M
3300015346\|Ga0182139_1246245	Not Available	501	Open in IMG/M
3300015351\|Ga0182161_1036872	Not Available	1069	Open in IMG/M
3300015351\|Ga0182161_1096990	Not Available	749	Open in IMG/M
3300015351\|Ga0182161_1152414	Not Available	630	Open in IMG/M
3300015355\|Ga0182159_1127664	Not Available	776	Open in IMG/M
3300015355\|Ga0182159_1330013	Not Available	516	Open in IMG/M
3300017404\|Ga0182203_1022437	Not Available	936	Open in IMG/M
3300017404\|Ga0182203_1048096	Not Available	746	Open in IMG/M
3300017404\|Ga0182203_1051444	Not Available	730	Open in IMG/M
3300017407\|Ga0182220_1018486	Not Available	814	Open in IMG/M
3300017409\|Ga0182204_1022078	Not Available	830	Open in IMG/M
3300017410\|Ga0182207_1020894	Not Available	996	Open in IMG/M
3300017410\|Ga0182207_1062259	Not Available	711	Open in IMG/M
3300017410\|Ga0182207_1087798	Not Available	637	Open in IMG/M
3300017411\|Ga0182208_1079173	Not Available	588	Open in IMG/M
3300017411\|Ga0182208_1086096	Not Available	572	Open in IMG/M
3300017415\|Ga0182202_1046963	Not Available	709	Open in IMG/M
3300017417\|Ga0182230_1048610	Not Available	744	Open in IMG/M
3300017424\|Ga0182219_1051331	Not Available	687	Open in IMG/M
3300017424\|Ga0182219_1071713	Not Available	620	Open in IMG/M
3300017424\|Ga0182219_1088619	Not Available	581	Open in IMG/M
3300017425\|Ga0182224_1017442	Not Available	1001	Open in IMG/M
3300017425\|Ga0182224_1058398	Not Available	700	Open in IMG/M
3300017425\|Ga0182224_1101680	Not Available	589	Open in IMG/M
3300017425\|Ga0182224_1139715	Not Available	532	Open in IMG/M
3300017427\|Ga0182190_1071984	Not Available	668	Open in IMG/M
3300017433\|Ga0182206_1025192	Not Available	892	Open in IMG/M
3300017433\|Ga0182206_1080226	Not Available	627	Open in IMG/M
3300017436\|Ga0182209_1163953	Not Available	512	Open in IMG/M
3300017442\|Ga0182221_1145642	Not Available	528	Open in IMG/M
3300017443\|Ga0182193_1032204	Not Available	915	Open in IMG/M
3300017680\|Ga0182233_1026975	Not Available	1015	Open in IMG/M
3300017680\|Ga0182233_1030472	Not Available	950	Open in IMG/M
3300017681\|Ga0182226_1103557	Not Available	538	Open in IMG/M
3300017683\|Ga0182218_1036128	Not Available	780	Open in IMG/M
3300017684\|Ga0182225_1118145	Not Available	536	Open in IMG/M
3300017685\|Ga0182227_1012642	Not Available	1464	Open in IMG/M
3300017685\|Ga0182227_1030795	Not Available	926	Open in IMG/M
3300017685\|Ga0182227_1053553	Not Available	722	Open in IMG/M
3300017685\|Ga0182227_1057400	Not Available	701	Open in IMG/M
3300017686\|Ga0182205_1122460	Not Available	564	Open in IMG/M
3300017686\|Ga0182205_1127353	Not Available	557	Open in IMG/M
3300017686\|Ga0182205_1135379	Not Available	545	Open in IMG/M
3300017689\|Ga0182231_1012584	Not Available	1538	Open in IMG/M
3300025908\|Ga0207643_10636033	Not Available	688	Open in IMG/M
3300025942\|Ga0207689_10406719	Not Available	1135	Open in IMG/M
3300026023\|Ga0207677_11795694	Not Available	569	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.23%
Environmental	Environmental	0.77%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.23%
Terrestrial	Environmental → Terrestrial	0.77%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.08%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.08%
Soil	Environmental → Terrestrial → Soil	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.08%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.08%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.08%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.08%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.77%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	92.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.08%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.08%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.77%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000651	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AP72_2010_repI_A10DRAFT_10127361	3300000651	Forest Soil	LGMESSLIIELRITCVDNGYYVGLTPAENSQIQFG*
Ga0068868_1012330452	3300005338	Miscanthus Rhizosphere	MEFSLVIELKLAVVDTGYFIGLTPAENSQTQIGEVLDKFT
Ga0157374_128261801	3300013296	Miscanthus Rhizosphere	MEFSLVIELKLVVDTGYFVGLTPAENSQTQIGEVLR*
Ga0157374_129565421	3300013296	Miscanthus Rhizosphere	EFSLVIELKLAIVDTGYFVGTPIENSQTQIGEVLR
Ga0157378_106485151	3300013297	Miscanthus Rhizosphere	MRSLIKLDMESSLVIELKIALVDTVYFVRLTPTGNSQFDLGKS*
Ga0157376_109531101	3300014969	Miscanthus Rhizosphere	MAFLIKLDMESSLVIELKIALADTGYFVGLTPVGNSQFNLGK*
Ga0182122_10096951	3300015267	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPAENSQIQSW*
Ga0182122_10178961	3300015267	Miscanthus Phyllosphere	LIKLDMESHLVIELKITCVDTGYFVGISPVGTSQIQSG*
Ga0182122_10430141	3300015267	Miscanthus Phyllosphere	MGFSLVIELKLVVVDTGYFVGLTPVENSQTKIGEVLR*
Ga0182122_10667191	3300015267	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTRYFVRLTPIENSQTKIGEVLR*
Ga0182154_10398861	3300015268	Miscanthus Phyllosphere	MHVAYVKMPSLIKLDMEFSLVIELKLVVVDTSYFVLTPAENSQTQIAEVLR
Ga0182154_10675081	3300015268	Miscanthus Phyllosphere	MSFLIKLDMESSLVIELKIALADTGYFVGLTSEGNSQIQIG*
Ga0182113_10508261	3300015269	Miscanthus Phyllosphere	MGFSLVIELKLAVVDTGYFIGLTPAENSQTQIGEVLR*
Ga0182113_10541051	3300015269	Miscanthus Phyllosphere	MPSLIKLDIESSLVIELKIALADTGYFVGLTPAGNSQFNLGKS*
Ga0182188_10094161	3300015274	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVYTGYFVGLTLVENSQTQFGKFLR*
Ga0182188_10547751	3300015274	Miscanthus Phyllosphere	MEFSLVVELKLAVVDTGYFVQLTPIENSQTKIGEVLR*
Ga0182172_10106171	3300015275	Miscanthus Phyllosphere	LVKLDMESSLVIELKIACVDTDYFVGLTLAENSQIQFG*
Ga0182172_10729701	3300015275	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKHAIVDTGYFVGLTPIKNSQTKAYYSRQR*
Ga0182170_10154151	3300015276	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTSYFVGLTPVENSQTKIGEVLR*
Ga0182170_10568651	3300015276	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFVGLTPVENSQTKIGEVLR*
Ga0182128_10287071	3300015277	Miscanthus Phyllosphere	MPFLIKLDMEFSLVIELKLVVVDIGYFVGLTPAENSQIQSW*
Ga0182128_10350111	3300015277	Miscanthus Phyllosphere	MEFSLVIELKLAIVDTGYFIGLTPIENSQTQIGKVPR*
Ga0182160_10759381	3300015281	Miscanthus Phyllosphere	MEFSLVIELKTTCVDTGYFVGLTYVENSQIQFGKVLRTHTRDESR
Ga0182124_10079801	3300015282	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIELKLAIVDTGYFVGLTPIENSQTKIGEVLR*
Ga0182156_10386602	3300015283	Miscanthus Phyllosphere	MESGLVIELKISYVDAGYFVGLTPAENAQYQFGKVMR*
Ga0182156_10420991	3300015283	Miscanthus Phyllosphere	SKLDMEFSLVIELKLAIVDTGYFIGLTPVENSQTQIGEVLR*
Ga0182156_10603191	3300015283	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFVGLTPAENSQIQSG*
Ga0182176_10444491	3300015286	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPAENSHTQIGEVLR*
Ga0182171_10248351	3300015287	Miscanthus Phyllosphere	MEFSLVIELKLDVVDTSYFVGLTPVENSQTKIVEVLR*
Ga0182171_10489201	3300015287	Miscanthus Phyllosphere	MLSLIKLNMEFSLVIELKLVVVDTGYFVGLTPAENSQIQSW*
Ga0182171_10496821	3300015287	Miscanthus Phyllosphere	MEFSLVIELKLAVVDIGYFVGLTPIENSQTKIGEVLR*
Ga0182171_10596731	3300015287	Miscanthus Phyllosphere	MPCLIKLDMEFSLVIELKLVVVDTCYFVGLTPIENSQTQIRKVLR*THTG
Ga0182173_10340731	3300015288	Miscanthus Phyllosphere	WCLGSLIKLDIEFSLVIELKIVVVDTSYFVELTSIQNSQTKIGEVLR*
Ga0182173_10363461	3300015288	Miscanthus Phyllosphere	MEFSLVIELKIACVDTGYFVGLTYVENSQIQFGKVLR*
Ga0182138_10721941	3300015289	Miscanthus Phyllosphere	MEFSLVIELKTTCVDTGYFVGLTYVENSQIQFGKVLR*TH
Ga0182125_10374861	3300015291	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAIVDTGYFVGLTPVENSQTKIGEVLR*
Ga0182125_10408302	3300015291	Miscanthus Phyllosphere	FSLVIELKLAVVNTSYFVGLTPAENSQTQIGEVLR*
Ga0182141_10516531	3300015292	Miscanthus Phyllosphere	MPSLIKLDMESSLVIELKIALVDIGYFVGLTPVGNSQFNLGKS*
Ga0182126_10256162	3300015294	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFVGLTPVKNSQTKIGKVLR*
Ga0182126_10397181	3300015294	Miscanthus Phyllosphere	MPSLIKLDIEFSLVIELKLAIVDTIYFVGLTPIENSQTQIGEVLR*
Ga0182126_10718641	3300015294	Miscanthus Phyllosphere	MEFSLVIELKLAIVDTGYFVGLTPVENSQTQIGEVLR*
Ga0182175_10188651	3300015295	Miscanthus Phyllosphere	MPSLIKLDMESSLVIELKIALVDTEYFVGLTPTENSQFNFGKS*
Ga0182175_10911841	3300015295	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFVGLTLAENSQTQIGEVLR*
Ga0182157_10529121	3300015296	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAIIDTSYFVGLTPIENSQTKIGEVLR*
Ga0182106_10186761	3300015298	Miscanthus Phyllosphere	IEFSLVIELKLAIVDTIYFVGLTPIENSQTQIGEVLR*
Ga0182106_10280851	3300015298	Miscanthus Phyllosphere	MLSLIKLNMEFSLVIELKLVVVDTGYFVRLTPAENSQIQSG*
Ga0182106_10857711	3300015298	Miscanthus Phyllosphere	MLSLIKIRHGVNLVIELKLAVVDTGYFIGLTPVENSQTQIGEVLR*
Ga0182107_10187921	3300015299	Miscanthus Phyllosphere	MEFSLVIELKLVVVHTGYFVGQTSTENSQTQIGEVLR*
Ga0182107_10313561	3300015299	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVEVDTSYFVGLTPAENSQTQIGEVLR*
Ga0182108_10291421	3300015300	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLALVDIGYFVGLTPAENSQIQSG*
Ga0182108_10353631	3300015300	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKPAVVDTGYFVGLTPAENSQIQSG*
Ga0182108_10416212	3300015300	Miscanthus Phyllosphere	MEFSLVIELKLVVVDTGYFVGLTPVENSQTKIGEVLR*
Ga0182108_10623191	3300015300	Miscanthus Phyllosphere	IKLDMESSLVIELKIVCVDTRYFARLTLAGNSQIQSW*
Ga0182108_10773731	3300015300	Miscanthus Phyllosphere	MLSLIKLNMEFSLVIELKLVVVDTGYFVGLTPIENFQTQIGEVLR*
Ga0182143_10934151	3300015302	Miscanthus Phyllosphere	MPSLIKLDMESSLIIELKIALVDIGYFARLAPAGNSQFNLGKS*
Ga0182143_10996331	3300015302	Miscanthus Phyllosphere	MLSLIKLDMEFSLVIQLKLAVVDTGYFVRLTPVENSQTQIGKVLR*
Ga0182123_10028591	3300015303	Miscanthus Phyllosphere	MLSLIKLNMEFSLVIELKLVVVDTGYFVRLTPAENSQIQSW*
Ga0182112_10911812	3300015304	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVEVDTSYFVGLTPVENSQTKIGEVLR*
Ga0182158_10660761	3300015305	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFIGLTPAENSQTQIGEVLR*
Ga0182144_10487031	3300015307	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAIVNTGYFVGLTPAENSQIQSR*
Ga0182144_10845561	3300015307	Miscanthus Phyllosphere	MEFSLVIELKFVVVDTGYFVGLTPVENSQTKIGEVLR*
Ga0182142_10971731	3300015308	Miscanthus Phyllosphere	MEFSLVIELKIACVDTGYFVGLTYVENSQIQFGKVLR*THTG
Ga0182098_11008701	3300015309	Switchgrass Phyllosphere	LIKLDMESSLVIELDITLVDIGYFVGLTPAENSQIQFE*
Ga0182140_10348821	3300015314	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIQLKLVVVDTGYFVRLTPVENSQTQIGKVLR*
Ga0182140_10662891	3300015314	Miscanthus Phyllosphere	LVIELKIACVDTGYFVRLTSVENSQIQFGKVLR*THTRDES
Ga0182127_10936491	3300015321	Miscanthus Phyllosphere	MPSIIKLDMESSLVIELKIVLPDIGYFVGLTPAENSQFNLGKS*
Ga0182110_10301041	3300015322	Miscanthus Phyllosphere	VPSLIKLDIEFSLVIELKLVVVDTSYFVRLTPVENSQTKIGEVIR*
Ga0182187_11171131	3300015341	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAIVDTGYFVGLTPIENSQTQIGEVLR*
Ga0182187_11852791	3300015341	Miscanthus Phyllosphere	MEFSLVIELKLVVVDTGYFVGLTPAENSQTQIGEVLR*
Ga0182155_10964121	3300015343	Miscanthus Phyllosphere	MSFLIKLDIEFSLVIELKLAVVYTCYFVGLTPAENSQTQFGKVMR*
Ga0182155_11724721	3300015343	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLDVVDTGYFVGLTPIENSQTKIGEVLR*
Ga0182155_12239421	3300015343	Miscanthus Phyllosphere	PSLIKLDMKFSLVIELKLAVVDIGYFVVLTPIENSQTKIREVLR*
Ga0182155_12247271	3300015343	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLPVVDTGYFIGLTPVENSQI*
Ga0182189_10369541	3300015344	Miscanthus Phyllosphere	MEFSLVIELKIACIDTGYFVGLTSTEISQIQFGKVPR*
Ga0182189_10885941	3300015344	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFVGLTPAENSQTQIGEVLS*
Ga0182189_10943311	3300015344	Miscanthus Phyllosphere	MSSLIKLDMEFSLVIELKLVVVDTGYFVGLTPAENSQIQSW*
Ga0182189_12137911	3300015344	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIELKLAIVDTGYFVGLPPTENSQIQYG*
Ga0182111_11545031	3300015345	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIELKLAIVDTGYFVGLTPIENSQIQFGKVLR*
Ga0182139_10949141	3300015346	Miscanthus Phyllosphere	MPSLIKLGMESSLVIEIKIALADIGYFVGLTHAKKLSIQFG*
Ga0182139_12235121	3300015346	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIQLKLAVVDTGYFVRLTPVENSQTQIGKVLR*
Ga0182139_12443991	3300015346	Miscanthus Phyllosphere	KLDMEFSLVIELKLAIVDTGYFVGLTPVENSQTKIGEVLR*
Ga0182139_12462451	3300015346	Miscanthus Phyllosphere	MEFSLVIELKLVVVDTGYFVGLTPVENSQTQIGEVLR*
Ga0182161_10368721	3300015351	Miscanthus Phyllosphere	KMSSLIKLDMEFSLVIELKLAVVDTGYFVVLTPSGNSQIQFG*
Ga0182161_10969901	3300015351	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTSYFVGLTPAENSQTQIREILR*
Ga0182161_11524141	3300015351	Miscanthus Phyllosphere	MPSLIKLDMEFSLAIELKLAIVDTGYFVGLTPIENSQTKIGEVLR*
Ga0182159_11276641	3300015355	Miscanthus Phyllosphere	MPSLIKLDMVFSWVIELKLVVVDTGYFVGLTPIENSQIQFG*
Ga0182159_13300131	3300015355	Miscanthus Phyllosphere	MEFSVVIELKLAIVDTGYFVGLTPIENSQTKIGEVLR*
Ga0182203_10224371	3300017404	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFVGLTPVENSQTKIGEVLR
Ga0182203_10480962	3300017404	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIELKLAVVDTGYFVGLTPTENSQTQIGEVLRLIHTR
Ga0182203_10514441	3300017404	Miscanthus Phyllosphere	MEFSLVIELKLVVDTGYFVGLTPAENSQTQIGEVLR
Ga0182220_10184861	3300017407	Miscanthus Phyllosphere	MPSLIKLDIQSSLVIKLKIALVDTSYFVGLTPVENSQFNLV
Ga0182204_10220781	3300017409	Miscanthus Phyllosphere	VPFLIKLDMEFSLVIELKLVVVDTGYFVGLTPIENSQTKIGKS
Ga0182207_10208941	3300017410	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFIGLTPVENSQTQIGKVPR
Ga0182207_10622591	3300017410	Miscanthus Phyllosphere	MSSLIKLDMESSLVIELKFALVDIGYFVGLTHAENSQIQSRQVLR
Ga0182207_10877981	3300017410	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIKLKLAIVDTGYFVGLTPVENSQTKIGEVLR
Ga0182208_10791731	3300017411	Miscanthus Phyllosphere	MPSLIKLGMEFSLVIELKLAIADTCYFVGLTPGENSQTQIGKVLR
Ga0182208_10860961	3300017411	Miscanthus Phyllosphere	MPSLIKLDMESSLVIELKIALADTGYFVGLTPVENS
Ga0182202_10469632	3300017415	Miscanthus Phyllosphere	MPSLIKLDIEFSLVIELKIACVDTRYFIGLTPVENSQTKIWEVLR
Ga0182230_10486101	3300017417	Miscanthus Phyllosphere	MSSLIKLDMESSLVIELKIALADTGYFVGLTPAENSQFSWVSHEMNSNQR
Ga0182219_10513312	3300017424	Miscanthus Phyllosphere	MPSLIRLDMEFSLVIELKLAIVDTGYFVGLTPIENSQIQFGKVLR
Ga0182219_10717131	3300017424	Miscanthus Phyllosphere	MTSLIKLDMEFSLVIELKLAIIDTSYFVGLTPIENSQTKIGEVLR
Ga0182219_10886191	3300017424	Miscanthus Phyllosphere	MPSLIKLDMEFSFVIELKLVVVDTGYFVGLTPTENSQTQFGKVLR
Ga0182224_10174421	3300017425	Miscanthus Phyllosphere	PSLIQLDMEYSLVIELKIACVDTSYFVRLTHAENSQIQFGKVPR
Ga0182224_10583981	3300017425	Miscanthus Phyllosphere	MPSLIKLDMESSLVIELKIVSAYTGYFVGLTPVGNSQFNLGKSRD
Ga0182224_11016801	3300017425	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFVELTPAENSQTQIGVVLR
Ga0182224_11397151	3300017425	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPVENSQTKIREVLR
Ga0182190_10673082	3300017427	Miscanthus Phyllosphere	MPSLIKLDMESSLVIELKIALVDIGYFTGLTHAGNSQFNLGKS
Ga0182190_10719841	3300017427	Miscanthus Phyllosphere	MEFSLVIELKLVVVDTGYFVGLTPAENSQTQIGEVLR
Ga0182206_10251922	3300017433	Miscanthus Phyllosphere	MEFSLVIELKLVVVDTGYFVGLTPIENFQTQIGEVLR
Ga0182206_10802261	3300017433	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPVENSQTKIGVVLR
Ga0182209_11639531	3300017436	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAIVDIGYFVRLTPVETSKIQSR
Ga0182191_11603311	3300017438	Miscanthus Phyllosphere	MESSLVIELKISYVDAGYFVGLTPAENAQYQFGKVMRXTHIRDE
Ga0182221_11456421	3300017442	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIQLKLVVVDTGYFVGLTPAENSQTQIGEDLR
Ga0182193_10322041	3300017443	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFIGLTPVENSQTKIGEVLR
Ga0182233_10269752	3300017680	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPAENSQTQIGKVLR
Ga0182233_10304721	3300017680	Miscanthus Phyllosphere	MEFSLVIELKIAYVDIGNFVGLTPAENSQTQIREILR
Ga0182226_11035571	3300017681	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFVGLTPVENSQTQIGEVMR
Ga0182218_10361281	3300017683	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDIGYFVGLTPIENSQTKIGEVLR
Ga0182225_11181451	3300017684	Miscanthus Phyllosphere	MPSLIKLDMKFSLVIELKLAVVDTGYFIGLTPIENSQTKIGDVLR
Ga0182227_10126421	3300017685	Miscanthus Phyllosphere	MPSLIKLDMESSLVIELKIVLADTGYFIGLTPVEHSQFNLGKS
Ga0182227_10307951	3300017685	Miscanthus Phyllosphere	MEFSLVIELKLAVVDTGYFIGLTLVENSQAQIGEVLR
Ga0182227_10535531	3300017685	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPVENSQIQYG
Ga0182227_10574001	3300017685	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAIVDTGYFVGLTPVENSQTKIGEVLR
Ga0182205_11224601	3300017686	Miscanthus Phyllosphere	MEFSLVIELKLVVVDTCYFVGLTPIENSQTQIRKVLRXTHTGDE
Ga0182205_11273531	3300017686	Miscanthus Phyllosphere	MSFLIKLDIEFSLVIELKLAVVYTCYFVGLTPAENSQTQFGKVMR
Ga0182205_11353791	3300017686	Miscanthus Phyllosphere	MEFSLVIELKLDVVYTGYFVGLTPAENSQTQIGGVLR
Ga0182231_10125841	3300017689	Miscanthus Phyllosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFIGLTPAENSQTQIGEVLR
Ga0207643_106360331	3300025908	Miscanthus Rhizosphere	MPSLIKLDMESSLVIELKIALADTRYFVGLTPVENSQIQFGKVPR
Ga0207689_104067191	3300025942	Miscanthus Rhizosphere	MPSLIKLDMEFSLVIELKLVVVDTGYFVGLTPAENSHTQIGEVLR
Ga0207677_117956941	3300026023	Miscanthus Rhizosphere	MPSLIKLDMEFSLVIELKLAVVDTGYFVGLTPAENSQTQIGEVLR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F062314

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign