Basic Information | |
---|---|
Family ID | F062566 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 41 residues |
Representative Sequence | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSAR |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 86.92 % |
% of genes near scaffold ends (potentially truncated) | 99.23 % |
% of genes from short scaffolds (< 2000 bps) | 91.54 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (83.846 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (46.923 % of family members) |
Environment Ontology (ENVO) | Unclassified (78.462 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.385 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF00166 | Cpn10 | 0.77 |
PF07460 | NUMOD3 | 0.77 |
PF13392 | HNH_3 | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.15 % |
Unclassified | root | N/A | 3.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559021|GXP7IEG01CPELI | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300002092|JGI24218J26658_1000609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15674 | Open in IMG/M |
3300003277|JGI25908J49247_10116812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300003393|JGI25909J50240_1081613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300003411|JGI25911J50253_10206851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300003412|JGI25912J50252_10003623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5250 | Open in IMG/M |
3300004240|Ga0007787_10245263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300004771|Ga0007797_1042390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300004806|Ga0007854_10187424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300005527|Ga0068876_10254770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300005581|Ga0049081_10113813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1004 | Open in IMG/M |
3300005583|Ga0049085_10014392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3047 | Open in IMG/M |
3300005584|Ga0049082_10254449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300006103|Ga0007813_1108878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300006113|Ga0007858_1053515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300006117|Ga0007818_1050349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300006802|Ga0070749_10674191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300007216|Ga0103961_1362198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2164 | Open in IMG/M |
3300007540|Ga0099847_1211524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300008113|Ga0114346_1080712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1535 | Open in IMG/M |
3300009151|Ga0114962_10633712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 552 | Open in IMG/M |
3300009154|Ga0114963_10621855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300009155|Ga0114968_10183298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
3300009158|Ga0114977_10240387 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
3300009158|Ga0114977_10676812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300009163|Ga0114970_10520489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300009182|Ga0114959_10290824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300009184|Ga0114976_10166077 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
3300010157|Ga0114964_10228085 | Not Available | 890 | Open in IMG/M |
3300010157|Ga0114964_10277391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300010334|Ga0136644_10605742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300010354|Ga0129333_10381689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1250 | Open in IMG/M |
3300010354|Ga0129333_11239220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300010354|Ga0129333_11428987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300010885|Ga0133913_11671746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1602 | Open in IMG/M |
3300013004|Ga0164293_10242776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1276 | Open in IMG/M |
3300013005|Ga0164292_10998691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300013372|Ga0177922_10419281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 788 | Open in IMG/M |
3300014502|Ga0182021_12769679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300015050|Ga0181338_1022579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300015050|Ga0181338_1029172 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300015050|Ga0181338_1062022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 537 | Open in IMG/M |
3300015050|Ga0181338_1067905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 508 | Open in IMG/M |
3300017700|Ga0181339_1003129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2251 | Open in IMG/M |
3300017707|Ga0181363_1078963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 564 | Open in IMG/M |
3300017716|Ga0181350_1011362 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
3300017716|Ga0181350_1021093 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300017722|Ga0181347_1160551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300017723|Ga0181362_1020365 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
3300017736|Ga0181365_1144464 | Not Available | 565 | Open in IMG/M |
3300017736|Ga0181365_1174100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300017747|Ga0181352_1162964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300017754|Ga0181344_1125451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300017754|Ga0181344_1208759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300017754|Ga0181344_1228545 | All Organisms → Viruses | 518 | Open in IMG/M |
3300017761|Ga0181356_1052792 | Not Available | 1397 | Open in IMG/M |
3300017761|Ga0181356_1212953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 566 | Open in IMG/M |
3300017761|Ga0181356_1233888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 530 | Open in IMG/M |
3300017761|Ga0181356_1251956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 503 | Open in IMG/M |
3300017774|Ga0181358_1098992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
3300017777|Ga0181357_1022183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2524 | Open in IMG/M |
3300017777|Ga0181357_1024374 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
3300017777|Ga0181357_1119872 | Not Available | 987 | Open in IMG/M |
3300017777|Ga0181357_1136499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
3300017777|Ga0181357_1145656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300017777|Ga0181357_1308267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300017778|Ga0181349_1206090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300017778|Ga0181349_1211751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 665 | Open in IMG/M |
3300017780|Ga0181346_1060370 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
3300017780|Ga0181346_1292614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300017780|Ga0181346_1313030 | All Organisms → Viruses | 529 | Open in IMG/M |
3300017784|Ga0181348_1063819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
3300017784|Ga0181348_1094311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300017784|Ga0181348_1266528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300017785|Ga0181355_1141631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300017785|Ga0181355_1304234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300019781|Ga0181360_111585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 732 | Open in IMG/M |
3300019781|Ga0181360_116965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300019784|Ga0181359_1094776 | Not Available | 1102 | Open in IMG/M |
3300020179|Ga0194134_10261733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300020200|Ga0194121_10489574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300020205|Ga0211731_10075420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300021093|Ga0194123_10133076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1370 | Open in IMG/M |
3300021424|Ga0194117_10512205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300021961|Ga0222714_10316940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300022179|Ga0181353_1066681 | All Organisms → Viruses | 925 | Open in IMG/M |
3300022179|Ga0181353_1073295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300022190|Ga0181354_1113642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300022407|Ga0181351_1102792 | All Organisms → Viruses | 1101 | Open in IMG/M |
3300022407|Ga0181351_1136392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300022407|Ga0181351_1208252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 646 | Open in IMG/M |
3300022407|Ga0181351_1215641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300022407|Ga0181351_1267044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300022923|Ga0255783_10396293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300022929|Ga0255752_10295974 | All Organisms → Viruses | 689 | Open in IMG/M |
3300025392|Ga0208380_1062707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300025732|Ga0208784_1009385 | All Organisms → Viruses → Predicted Viral | 3353 | Open in IMG/M |
3300025872|Ga0208783_10048022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
3300026568|Ga0255240_1046373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300027600|Ga0255117_1098028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 554 | Open in IMG/M |
3300027608|Ga0208974_1072031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300027656|Ga0209357_1176085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300027744|Ga0209355_1245692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 705 | Open in IMG/M |
3300027744|Ga0209355_1248252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300027754|Ga0209596_1060191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1935 | Open in IMG/M |
3300027754|Ga0209596_1254767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300027769|Ga0209770_10157577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300027772|Ga0209768_10031244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2913 | Open in IMG/M |
3300027798|Ga0209353_10156741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1012 | Open in IMG/M |
3300027804|Ga0209358_10552162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300031673|Ga0307377_10601861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300031707|Ga0315291_11413538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300031758|Ga0315907_11248984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300031951|Ga0315904_10604109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
3300031963|Ga0315901_10793164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300032053|Ga0315284_12282345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 536 | Open in IMG/M |
3300032092|Ga0315905_10917226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300032116|Ga0315903_10815952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 679 | Open in IMG/M |
3300032605|Ga0316232_1261933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300033418|Ga0316625_102224569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300033488|Ga0316621_11457021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300033981|Ga0334982_0135016 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
3300034050|Ga0335023_0603306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034093|Ga0335012_0185044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300034096|Ga0335025_0569661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300034116|Ga0335068_0320805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300034118|Ga0335053_0756299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300034279|Ga0335052_0656288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300034355|Ga0335039_0407384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300034374|Ga0348335_030532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2381 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 46.92% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 5.38% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.85% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.85% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.85% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.08% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.54% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.54% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.54% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.54% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.77% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.77% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.77% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.77% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559021 | Fresh water microbial communities from LaBonte Lake, Laramie, Wyoming, sample from peak-bloom 2 | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LBLPB2_03444530 | 2166559021 | Freshwater | MAYSGTIGETVINVQTLIDHGARRCGKLAEELTSEQQLSARQ |
JGI24218J26658_100060916 | 3300002092 | Lentic | MAYSGSVGNTVISIQTLIDHGARRCGKLAEELTDEEVLSARQS |
JGI25908J49247_101168123 | 3300003277 | Freshwater Lake | MSYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTARQSLYYFLS |
JGI25909J50240_10816131 | 3300003393 | Freshwater Lake | MAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVLSARQSLGF |
JGI25911J50253_102068513 | 3300003411 | Freshwater Lake | MSYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTARQSLYY |
JGI25912J50252_100036231 | 3300003412 | Freshwater Lake | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVLSARES |
Ga0007787_102452631 | 3300004240 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLS |
Ga0007797_10423904 | 3300004771 | Freshwater | MAYSGTVGTTVINVQTLIDHGARRCGKLAEELTSEQVLSSRQ |
Ga0007854_101874243 | 3300004806 | Freshwater | MAYSGTVGNTVINVQTLIDHGARRAGKLAEELTDEQVQSAKE |
Ga0068876_102547703 | 3300005527 | Freshwater Lake | MAYSGTVGETVINVQTLIDHGARRCGKLAEELTSEQQLSARQSL |
Ga0049081_101138133 | 3300005581 | Freshwater Lentic | MAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSARQSLGFL |
Ga0049085_100143921 | 3300005583 | Freshwater Lentic | MAYSNSVGTTVITVQTLIDHGARRCGKLAGELTSEQVLSSRESLFFL |
Ga0049082_102544493 | 3300005584 | Freshwater Lentic | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSE |
Ga0007813_11088782 | 3300006103 | Freshwater | MAYSGTVGTTVISVQQLIDHGARRCGKLAEELTSEQVLSAKESLYFFL |
Ga0007858_10535153 | 3300006113 | Freshwater | MAYSGTVGNTVINVQTLIDHGARRAGKLAEELTDEQVQSAKESLFY |
Ga0007818_10503491 | 3300006117 | Freshwater | MAYSGTFGTTVISVQTLIDHGARRCGKLAEELTDE |
Ga0070749_106741912 | 3300006802 | Aqueous | MAYSGTVGTTVIQVQTLIDHGARRCGKLAEELTSEQIL |
Ga0103961_13621981 | 3300007216 | Freshwater Lake | MAYSGTVGTTVIQVQTLIDHGARRCGKLAEELTSEQV |
Ga0099847_12115241 | 3300007540 | Aqueous | MAYSDTYGQIYSVQTLIDHGARRCGKLAEELTSEQLLSAKESLGFV |
Ga0114346_10807124 | 3300008113 | Freshwater, Plankton | MSYSNEYGQVYQIQTLIDHGARRCGKLAEELTSEQLLSARE |
Ga0114962_106337123 | 3300009151 | Freshwater Lake | MAYSGSVGTTVINVQTLIDHGARRCGKLAEELTDEQVLSS |
Ga0114963_106218551 | 3300009154 | Freshwater Lake | MAYSGTYGTTVINVQKLIDHGARRCGKLAEELTSEQVLSARE |
Ga0114968_101832983 | 3300009155 | Freshwater Lake | MAYSGTVGTTVVTVQSLIDHGARRCGKLAEELTSEQLVASRESLFFLL |
Ga0114977_102403871 | 3300009158 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSSRQSLGFLLS |
Ga0114977_106768122 | 3300009158 | Freshwater Lake | MAYSGTVGTTVVNVQEVIDHATRRCGKLAEELTSEQQ |
Ga0114970_105204892 | 3300009163 | Freshwater Lake | MAYSGTVGTTVITVQTLIDHGARRCGKLAEELTSEQVLSA |
Ga0114959_102908241 | 3300009182 | Freshwater Lake | MAYSGTSGQTVINVQTLIDHGARRCGKLAEELTSEQQISARESLF |
Ga0114976_101660775 | 3300009184 | Freshwater Lake | MAYSGTTGTTVITVQTLIDHGARRCGKLAEELTSEQV |
Ga0114964_102280851 | 3300010157 | Freshwater Lake | LRAGSADMAYSGTTGTTVVTVQTLIDHGARRCGKLASELTSEQVLSARESL |
Ga0114964_102773913 | 3300010157 | Freshwater Lake | MAYSGTSGQTVINVQTLIDHGARRCGKLAEELTSEQQISARESLFFLL |
Ga0136644_106057421 | 3300010334 | Freshwater Lake | MAYSGTVGETVISVQDLIDHGARRCGKLAEELTSEQ |
Ga0129333_103816893 | 3300010354 | Freshwater To Marine Saline Gradient | MPYSGTVGNTVINVQTLIDHGARRCGKLAEELTSE |
Ga0129333_112392202 | 3300010354 | Freshwater To Marine Saline Gradient | MAYSDTYGQVYNVQTLIDHGARRCGKLAEELTSEQILSARE |
Ga0129333_114289871 | 3300010354 | Freshwater To Marine Saline Gradient | MAYSGTVGDTVISVQTLIDHGARRCGKLAEELTSEQLLSAK |
Ga0133913_116717461 | 3300010885 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSA |
Ga0164293_102427764 | 3300013004 | Freshwater | MSYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQLL |
Ga0164292_109986911 | 3300013005 | Freshwater | MSYSGTIGTTVIDVQTLIEHGARRCGKLAEELTSEQ |
Ga0177922_104192813 | 3300013372 | Freshwater | MAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSAR |
Ga0182021_127696792 | 3300014502 | Fen | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVL |
Ga0181338_10225791 | 3300015050 | Freshwater Lake | MAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSEQ |
Ga0181338_10291723 | 3300015050 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAAELTSEQVVSA |
Ga0181338_10620223 | 3300015050 | Freshwater Lake | MAYSDTYGQTVDVQTLIDHGARRCGKLAEELTSEQ |
Ga0181338_10679053 | 3300015050 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSAR |
Ga0181339_10031291 | 3300017700 | Freshwater Lake | MAYSNSVGTTVITVQTLIDHGARRCGKLAGELTSEQVLSSRES |
Ga0181363_10789633 | 3300017707 | Freshwater Lake | MAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQ |
Ga0181350_10113627 | 3300017716 | Freshwater Lake | MAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSFLLQN |
Ga0181350_10210936 | 3300017716 | Freshwater Lake | MSYSGDYGQTVINVQTLIDHGARRCGKLAEELTSEQVLSARQSLYFLL |
Ga0181347_11605511 | 3300017722 | Freshwater Lake | MAYSGTVSTTVINVQQLIDHGARRCGKLAEELTSEQQ |
Ga0181362_10203651 | 3300017723 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSA |
Ga0181365_11444643 | 3300017736 | Freshwater Lake | MAYSETYGQTVDVQTLIDHGARRCGKLAEELTSEQV |
Ga0181365_11741001 | 3300017736 | Freshwater Lake | MAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSEQVLS |
Ga0181352_11629642 | 3300017747 | Freshwater Lake | MATSGTVGTTVINVQQLIDHGARRCGKLAEELTAEQQVSAREF |
Ga0181344_11254511 | 3300017754 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQS |
Ga0181344_12087592 | 3300017754 | Freshwater Lake | MAYSNTVGQTVLNVQTFIDHGARRCGKLAEELTSEQQLSARESLFILL |
Ga0181344_12285453 | 3300017754 | Freshwater Lake | MAYSETVGMTVINVQTLIDHGARRCGKLAEELTSEQVLSSRQ |
Ga0181356_10527925 | 3300017761 | Freshwater Lake | MAYSNSIGTTVITVQTLIDHGARRCGKLAGELTSE |
Ga0181356_12129531 | 3300017761 | Freshwater Lake | MAYSDTYGQTVDVQTLIDHGARRCGKLAEELTSEQVVSA |
Ga0181356_12338881 | 3300017761 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLLSN |
Ga0181356_12519561 | 3300017761 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLG |
Ga0181358_10989922 | 3300017774 | Freshwater Lake | MSYSGTVGTTVVNVQEVIDHAARRCGKLAEELTSE |
Ga0181357_10221831 | 3300017777 | Freshwater Lake | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQV |
Ga0181357_10243741 | 3300017777 | Freshwater Lake | MAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSFLLQNL |
Ga0181357_11198724 | 3300017777 | Freshwater Lake | MAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVL |
Ga0181357_11364991 | 3300017777 | Freshwater Lake | MAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVLTSRQS |
Ga0181357_11456561 | 3300017777 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLL |
Ga0181357_13082671 | 3300017777 | Freshwater Lake | MAYSGTTGTTVTTVQTLIDHGARRCGKLAGELTSEQVLSSRQSLYFLLSN |
Ga0181349_12060903 | 3300017778 | Freshwater Lake | MAYSGTVGTTVIDVQTLIEHGARRCGKLAEELTSEQQVSARESLFFFLS |
Ga0181349_12117511 | 3300017778 | Freshwater Lake | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVQSARE |
Ga0181346_10603706 | 3300017780 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQ |
Ga0181346_12926142 | 3300017780 | Freshwater Lake | MAYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTARQ |
Ga0181346_13130303 | 3300017780 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSAR |
Ga0181348_10638191 | 3300017784 | Freshwater Lake | MAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVVSARQS |
Ga0181348_10943111 | 3300017784 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSL |
Ga0181348_12665281 | 3300017784 | Freshwater Lake | MAYSGTTGTTVTTVQTLIDHGARRCGKLAGELTSEQVL |
Ga0181355_11416314 | 3300017785 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLLSNL |
Ga0181355_13042341 | 3300017785 | Freshwater Lake | MYSGTVGTTVISVQQLIDHGARRCGKLAEELTSEQ |
Ga0181360_1115853 | 3300019781 | Freshwater Lake | MSYSGTVGTTVVNVQEIIDHAARRCGKLAEELTSEQQLTA |
Ga0181360_1169651 | 3300019781 | Freshwater Lake | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVQSARESLYFF |
Ga0181359_10947764 | 3300019784 | Freshwater Lake | MAYSNSVGTTVITVQTLIDHGARRCGKLAGELTSEQVLSS |
Ga0194134_102617333 | 3300020179 | Freshwater Lake | MAFSDTYGQVYKVQVLIDHAARRCGKLAEELTSEQLVT |
Ga0194121_104895742 | 3300020200 | Freshwater Lake | MAYSGTVGATTISVQTLIDHGARRCGKLAEELTSEQVLS |
Ga0211731_100754201 | 3300020205 | Freshwater | MAYSGTVGTTVVNVQELVDHAARRCGKLAEELTSEQQLTARQSLFYFLSS |
Ga0194123_101330764 | 3300021093 | Freshwater Lake | MAYSGTTGTTVISVQTLIDHGARRCGKLAEELTSEQVLSARESLFYVLS |
Ga0194117_105122052 | 3300021424 | Freshwater Lake | MAYSGTTGTTVISVQTLIDHGARRCGKLAEELTSEQ |
Ga0222714_103169403 | 3300021961 | Estuarine Water | MAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSL |
Ga0181353_10666813 | 3300022179 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVS |
Ga0181353_10732951 | 3300022179 | Freshwater Lake | MAYSGTYGETIINVQDFIDHGARRCGKLAEELTSEQILSARQSLY |
Ga0181354_11136424 | 3300022190 | Freshwater Lake | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVLSARD |
Ga0181351_11027921 | 3300022407 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVASARQSLGFLLSNLI |
Ga0181351_11363924 | 3300022407 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQ |
Ga0181351_12082521 | 3300022407 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVS |
Ga0181351_12156412 | 3300022407 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLV |
Ga0181351_12670442 | 3300022407 | Freshwater Lake | MAYSDTFGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSF |
Ga0255783_103962932 | 3300022923 | Salt Marsh | MAYSGTVGTTVITVQTLIDHGARRCGKLAEELTSEQVLSARES |
Ga0255752_102959743 | 3300022929 | Salt Marsh | MSYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQLLT |
Ga0208380_10627072 | 3300025392 | Freshwater | MAYSGTVGNTVINVQTLIDHGARRAGKLAEELTDEQTQSAKESLFYILSN |
Ga0208784_10093851 | 3300025732 | Aqueous | MAYSGTVGTTVIQVQTLIDHGARRCGKLAEELTSEQVLSARESLFF |
Ga0208783_100480226 | 3300025872 | Aqueous | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVASRQ |
Ga0255240_10463731 | 3300026568 | Freshwater | MAYSDTYGQTYNVQTLIDHGARRCGKLAEELTSEQVLSSRQSLGFLLSNLI |
Ga0255117_10980281 | 3300027600 | Freshwater | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSARQSLGFLLSD |
Ga0208974_10720311 | 3300027608 | Freshwater Lentic | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVVSARQSLGFLLSD |
Ga0209357_11760853 | 3300027656 | Freshwater Lake | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQV |
Ga0209355_12456923 | 3300027744 | Freshwater Lake | MAYSDTYGQTVDVQTLIDHGARRCGKLAEELTSEQVVSARQSLGF |
Ga0209355_12482521 | 3300027744 | Freshwater Lake | MAYSNTVGQTVLNVQTFIDHGARRCGKLAEELTSEQQLS |
Ga0209596_10601914 | 3300027754 | Freshwater Lake | MSTSGTFGQTVIDVQTLIDHGARRCGKLAEELTSEQQ |
Ga0209596_12547672 | 3300027754 | Freshwater Lake | MAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSE |
Ga0209770_101575771 | 3300027769 | Freshwater Lake | MAYSGTIGQTVISVQTLIDHGARRCGKLAEELTSEQLLSARESLYFLLS |
Ga0209768_100312446 | 3300027772 | Freshwater Lake | MAYSGTVGTTVIDVQTLIDHGARRCGKLAEELTSEQVLSARESL |
Ga0209353_101567414 | 3300027798 | Freshwater Lake | MAYSETYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSARQSLG |
Ga0209358_105521621 | 3300027804 | Freshwater Lake | MAYSGTVSTTVINVQELIDHGARRCGKLAEELTSEQQVASRQSLYFL |
Ga0307377_106018611 | 3300031673 | Soil | MAYSGTVGTTVVNVQELVDHAARRCGKLAEELTSEQQLT |
Ga0315291_114135382 | 3300031707 | Sediment | MAYSGTIGQTVISVQTLIDHGARRCGKLAEELAVEQVQS |
Ga0315907_112489841 | 3300031758 | Freshwater | MAYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQLVTA |
Ga0315904_106041094 | 3300031951 | Freshwater | MAYSDTYGQTVNVQTLIDHGARRCGKLAEELTSEQVLSA |
Ga0315901_107931641 | 3300031963 | Freshwater | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLSF |
Ga0315284_122823451 | 3300032053 | Sediment | MATSGTVGATVIDVQQLIDHGARRCGKLAEELTSEQQTSAR |
Ga0315905_109172263 | 3300032092 | Freshwater | MAYSGSVGTTVITVQTLIDHGARRCGKLAEELTSEQVLSA |
Ga0315903_108159521 | 3300032116 | Freshwater | MAYSGSVGTTVVTVQTLIDHGARRCGKLAEELTSEQVLSARES |
Ga0316232_12619332 | 3300032605 | Freshwater | MAYSGTVGNTVISVQTLIDHGARRAGKLAEELTDEQVQ |
Ga0316625_1022245692 | 3300033418 | Soil | MAYSGTVGTTVIQVQTLIDHGARRAGKVAEELTSEQVL |
Ga0316621_114570212 | 3300033488 | Soil | MAYSGTVGTTVIQVQTLIDHGARRAGKVAEELTSEQVLSARQS |
Ga0334982_0135016_1158_1268 | 3300033981 | Freshwater | MAYSDTYGQVYNVQTLIDHGARRCGKLAEELTSEQLL |
Ga0335023_0603306_1_129 | 3300034050 | Freshwater | MAYSGTFGQTVITVQTLIDHGARRCGKLAEELTSEQLLSARES |
Ga0335012_0185044_3_125 | 3300034093 | Freshwater | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQ |
Ga0335025_0569661_3_116 | 3300034096 | Freshwater | MSYSGSVGTTVINVQTLIDHGARRCGKLAEELTSEQLL |
Ga0335068_0320805_2_115 | 3300034116 | Freshwater | MAYSGTVGTTVINTQKLIDHGARRCGKLAEELTAEQIL |
Ga0335053_0756299_2_142 | 3300034118 | Freshwater | MAYSDTYGQTVNVQTLIDHGARRAGKLAEELTSEQLVSARQSLGFLL |
Ga0335052_0656288_1_117 | 3300034279 | Freshwater | MAYSDTYGQVYNIQTLIDHGARRCGKLAEELTSEQLLSA |
Ga0335039_0407384_579_695 | 3300034355 | Freshwater | MAYSDTYGQVFNVQTLIDHAARRCGKLAEELTSEQVVAA |
Ga0348335_030532_2262_2381 | 3300034374 | Aqueous | MAYSDTYGQVYNVQTLIDHGARRCGKLAEELTSEQILSAR |
⦗Top⦘ |