NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062643

Metagenome / Metatranscriptome Family F062643

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062643
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 82 residues
Representative Sequence VHAGSPPHSGCMVVAQALDQGIALEGSVPADQVLGSVDGTELVPAGSLQTASGGGLTPGYQLISPDLGIPSFFSNLQVL
Number of Associated Samples 56
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 81.54 %
% of genes from short scaffolds (< 2000 bps) 99.23 %
Associated GOLD sequencing projects 40
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.692 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(36.154 % of family members)
Environment Ontology (ENVO) Unclassified
(63.077 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.462 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.23 %
UnclassifiedrootN/A0.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005093|Ga0062594_102204563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays596Open in IMG/M
3300005327|Ga0070658_10665358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays904Open in IMG/M
3300005327|Ga0070658_10696888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays881Open in IMG/M
3300005327|Ga0070658_10800852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays819Open in IMG/M
3300005327|Ga0070658_10938359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays752Open in IMG/M
3300005327|Ga0070658_11529327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays578Open in IMG/M
3300005327|Ga0070658_11830653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays525Open in IMG/M
3300005327|Ga0070658_11858331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays520Open in IMG/M
3300005336|Ga0070680_100591129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays953Open in IMG/M
3300005336|Ga0070680_101034470All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays709Open in IMG/M
3300005336|Ga0070680_101497011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays584Open in IMG/M
3300005336|Ga0070680_101583993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays567Open in IMG/M
3300005336|Ga0070680_101632979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays558Open in IMG/M
3300005336|Ga0070680_101714258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays545Open in IMG/M
3300005337|Ga0070682_100786602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays772Open in IMG/M
3300005337|Ga0070682_100918665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays720Open in IMG/M
3300005337|Ga0070682_101883423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays524Open in IMG/M
3300005337|Ga0070682_101974582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays512Open in IMG/M
3300005339|Ga0070660_100493213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1019Open in IMG/M
3300005339|Ga0070660_100724669All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5834Open in IMG/M
3300005339|Ga0070660_101331926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays609Open in IMG/M
3300005344|Ga0070661_100406301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1077Open in IMG/M
3300005344|Ga0070661_101815649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays517Open in IMG/M
3300005344|Ga0070661_101858707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays512Open in IMG/M
3300005366|Ga0070659_100704217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays873Open in IMG/M
3300005366|Ga0070659_101711445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays562Open in IMG/M
3300005455|Ga0070663_100253887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1392Open in IMG/M
3300005455|Ga0070663_101596231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays581Open in IMG/M
3300005455|Ga0070663_101619384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays578Open in IMG/M
3300005455|Ga0070663_101642689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays574Open in IMG/M
3300005457|Ga0070662_100754132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays826Open in IMG/M
3300005457|Ga0070662_101101037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays681Open in IMG/M
3300005457|Ga0070662_101228045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays644Open in IMG/M
3300005458|Ga0070681_10795858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5862Open in IMG/M
3300005458|Ga0070681_10795938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays862Open in IMG/M
3300005458|Ga0070681_11742135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays549Open in IMG/M
3300005530|Ga0070679_101883642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays547Open in IMG/M
3300005535|Ga0070684_102016833All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays545Open in IMG/M
3300005535|Ga0070684_102270302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays512Open in IMG/M
3300005564|Ga0070664_100402136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1252Open in IMG/M
3300005564|Ga0070664_100703543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays941Open in IMG/M
3300005564|Ga0070664_101548847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays627Open in IMG/M
3300005564|Ga0070664_101766485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays586Open in IMG/M
3300005564|Ga0070664_102010139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays548Open in IMG/M
3300005577|Ga0068857_101866047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays588Open in IMG/M
3300005577|Ga0068857_102382672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays520Open in IMG/M
3300005614|Ga0068856_100302388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1617Open in IMG/M
3300005616|Ga0068852_102311015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays559Open in IMG/M
3300006755|Ga0079222_12349394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays533Open in IMG/M
3300006806|Ga0079220_10457267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays856Open in IMG/M
3300006806|Ga0079220_11708432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays550Open in IMG/M
3300006876|Ga0079217_10452369All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays780Open in IMG/M
3300006876|Ga0079217_11523921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays530Open in IMG/M
3300007004|Ga0079218_11861875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays678Open in IMG/M
3300007004|Ga0079218_13368722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays541Open in IMG/M
3300009093|Ga0105240_11691036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays661Open in IMG/M
3300009093|Ga0105240_11718885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays655Open in IMG/M
3300009093|Ga0105240_11774978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays643Open in IMG/M
3300009545|Ga0105237_11461746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays690Open in IMG/M
3300009545|Ga0105237_11791048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays622Open in IMG/M
3300009545|Ga0105237_12437432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays533Open in IMG/M
3300009551|Ga0105238_11585500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays684Open in IMG/M
3300012905|Ga0157296_10256811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays589Open in IMG/M
3300012905|Ga0157296_10391562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays517Open in IMG/M
3300013102|Ga0157371_10308134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1147Open in IMG/M
3300013102|Ga0157371_10440800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays957Open in IMG/M
3300013102|Ga0157371_10817005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays703Open in IMG/M
3300013105|Ga0157369_11561155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays671Open in IMG/M
3300013105|Ga0157369_11588105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays665Open in IMG/M
3300013307|Ga0157372_12504532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays592Open in IMG/M
3300014288|Ga0121464_109604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays506Open in IMG/M
3300014716|Ga0135282_10460All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays674Open in IMG/M
3300014716|Ga0135282_11252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays504Open in IMG/M
3300020077|Ga0206351_10429426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1897Open in IMG/M
3300020080|Ga0206350_11621228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays683Open in IMG/M
3300020815|Ga0214108_10076883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1013Open in IMG/M
3300020815|Ga0214108_10199155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays732Open in IMG/M
3300020815|Ga0214108_10511738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays643Open in IMG/M
3300020815|Ga0214108_10565193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays635Open in IMG/M
3300020815|Ga0214108_10933813All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays862Open in IMG/M
3300020815|Ga0214108_11112147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays807Open in IMG/M
3300020816|Ga0214090_11039748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays716Open in IMG/M
3300021966|Ga0226662_10077909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1236Open in IMG/M
3300023205|Ga0255814_11079086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays544Open in IMG/M
3300023205|Ga0255814_11234878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays730Open in IMG/M
3300023280|Ga0255813_11439828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays705Open in IMG/M
3300023300|Ga0256702_11345649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays818Open in IMG/M
3300023300|Ga0256702_11351406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays573Open in IMG/M
3300023300|Ga0256702_11829498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays617Open in IMG/M
3300023300|Ga0256702_12175057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays666Open in IMG/M
3300025909|Ga0207705_11235855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays572Open in IMG/M
3300025914|Ga0207671_10651363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays839Open in IMG/M
3300025917|Ga0207660_11387469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays569Open in IMG/M
3300025919|Ga0207657_10839781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays709Open in IMG/M
3300025919|Ga0207657_11221438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays571Open in IMG/M
3300025919|Ga0207657_11470565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays510Open in IMG/M
3300025920|Ga0207649_10352679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1089Open in IMG/M
3300025920|Ga0207649_10537138All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays893Open in IMG/M
3300025920|Ga0207649_11573993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays520Open in IMG/M
3300025921|Ga0207652_11818308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays514Open in IMG/M
3300025933|Ga0207706_10564380All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays979Open in IMG/M
3300025933|Ga0207706_11457630All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays560Open in IMG/M
3300025933|Ga0207706_11462152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays559Open in IMG/M
3300025945|Ga0207679_10893907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays812Open in IMG/M
3300025945|Ga0207679_11200937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays696Open in IMG/M
3300025945|Ga0207679_11385932All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays645Open in IMG/M
3300025945|Ga0207679_11456183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays628Open in IMG/M
3300025981|Ga0207640_11518678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays602Open in IMG/M
3300026067|Ga0207678_10201329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1703Open in IMG/M
3300026067|Ga0207678_10412250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1171Open in IMG/M
3300026067|Ga0207678_10681157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae904Open in IMG/M
3300026067|Ga0207678_10985787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays746Open in IMG/M
3300026067|Ga0207678_11339116All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays633Open in IMG/M
3300026067|Ga0207678_11718724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays551Open in IMG/M
3300026078|Ga0207702_10713539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays988Open in IMG/M
3300026116|Ga0207674_10793028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays914Open in IMG/M
3300026142|Ga0207698_11245497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays758Open in IMG/M
3300029799|Ga0311022_15331824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays582Open in IMG/M
3300029799|Ga0311022_15867747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays558Open in IMG/M
3300031548|Ga0307408_101594709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays620Open in IMG/M
3300031824|Ga0307413_10999140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays717Open in IMG/M
3300031824|Ga0307413_11448028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays606Open in IMG/M
3300031824|Ga0307413_11959801All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays527Open in IMG/M
3300031901|Ga0307406_11286997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays638Open in IMG/M
3300031911|Ga0307412_10672418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays886Open in IMG/M
3300031911|Ga0307412_11224157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays673Open in IMG/M
3300032002|Ga0307416_101893873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays700Open in IMG/M
3300032002|Ga0307416_102395088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays627Open in IMG/M
3300032002|Ga0307416_102545689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays610Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere36.15%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere13.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere8.46%
Food WasteEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste6.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.62%
Food WasteEngineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste4.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.54%
Maize PhyllosphereHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Maize Phyllosphere1.54%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.77%
City Subway Metal/PlasticEngineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014288Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191EngineeredOpen in IMG/M
3300014716Maize phyllosphere microbial communities from California to study drought stress - PHYLLO11_watered_CA_BerkeleyHost-AssociatedOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020815Food waste microbial community from Durham, Ontario, Canada - FW2 megahitEngineeredOpen in IMG/M
3300020816Food waste microbial community from Durham, Ontario, Canada - FW1 megahitEngineeredOpen in IMG/M
3300021966Food waste microbial community from Durham, Ontario, Canada - FW2 spadesEngineeredOpen in IMG/M
3300023205Combined Assembly of Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300023280Combined Assembly of Gp0238881, Gp0242115EngineeredOpen in IMG/M
3300023300Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100EngineeredOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062594_10220456323300005093SoilPAPEGVRAGSPSCTSMDVHVGSSPRSGCMVVAQALGQGVALEASVPAGQVLGSVDGTELVPAGSLQAASGGDLMPGHQLISHDLGVPSFFSNLQVLWYILV*
Ga0070658_1066535823300005327Corn RhizosphereAGSPPHSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLRAASGGDPMPSHQLISHDLGVPSFFSNLQVL*
Ga0070658_1069688833300005327Corn RhizosphereMVARTPDQGVALEGSIPTGLELNSAECTELVPAGLLQTASSGGLAPGHQPISNDLGIPSLFSNL*
Ga0070658_1080085233300005327Corn RhizosphereSGCMVVAQALGQGVALEASVPVDQVLGSVDGTELVPAGSLRANSGDGPMPSHQLISHDLGVPSFFSNLQVL*
Ga0070658_1093835933300005327Corn RhizosphereDPAPEGARAGSPSCTSMDVHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLVLGSAECTELVPAGLLQAASGGGLTPDYQLISPDLGIPSFFSNLQVLCRALI*
Ga0070658_1152932713300005327Corn RhizosphereGGMVVAQTLDQGVALEGSIPAGLALGSVECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0070658_1183065313300005327Corn RhizosphereAGSPPHSGCMVVAQTLGQEAALEGSVPADRVLGSVEGAELISAGSLQAAPGGGLTSAYQLISPDLGIPSFFSNLQVL*
Ga0070658_1185833123300005327Corn RhizosphereDPAPEGVRAGSPSCTSMDVHAGSPPHSGCMVVAQALDQGVALEGSVPADQVVGSVDGTELVPAGSLQAASGGGLTPGHQLISHDLGVPSFFSNLQVL*
Ga0070680_10059112923300005336Corn RhizosphereQAGSPSCTSMDVHAGSPPHSGCMVVAQNLDQGVALEGSAPADRVLGSVEGTELISADSLQTAPGDGLTSAYQLISPDLGIPSFFSNLQVL*
Ga0070680_10103447033300005336Corn RhizospherePSCTSMDVHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV*
Ga0070680_10149701113300005336Corn RhizosphereSMDVHAGSPPHSGCMVVAQALDQGVALEGSVPADRVLGSVEGTELIPAGSLQAASGGGLMPGYQLISSDLGIPSFFSNLQVM*
Ga0070680_10158399323300005336Corn RhizospherePSCTSMDVHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLVLGSAECTELVPAGLLQAASGGGLTPDYQLISPDLGIPSFFSNLQVLCRALI*
Ga0070680_10163297923300005336Corn RhizosphereVRAGSPSCTSMDVHAGSPPHSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLRAASGGDPMPNHQLISHDLGVPSFFSNLQVL*
Ga0070680_10171425813300005336Corn RhizosphereLDQEVALEGSVPADRVLGSVDGTELIPAGSLRAASGSVLTPSYQLISPDLGIPSFFSNLQVL*
Ga0070682_10078660223300005337Corn RhizospherePAPEGVRARSPSCTSMDVHAGSPPHSGGMVVAQTLDQGVALEGIIPAGLALGSVECTELVPAGLLQTASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0070682_10091866513300005337Corn RhizosphereLDQGVALEGSIPTGLALGSVECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVLCCALV*
Ga0070682_10188342313300005337Corn RhizosphereRAGSPSCTSMDVHAGSPPHSGCMVVAQALDQGVALEGSVPADQVLGSVDGTELVPAGSLQAASGGGLTPGHQLISHDLGVPSFFSNLQVL*
Ga0070682_10197458223300005337Corn RhizosphereEGSIPTGLALGSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCFSLIFYVA*
Ga0070660_10049321313300005339Corn RhizosphereEGVRVGSPSCTSMDVHVGSPPHSGGMTVARTSDQGVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGISSFFSNLQVLCRALI*
Ga0070660_10072466913300005339Corn RhizosphereALEGSIPTGLALGSVECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVLCCALV*
Ga0070660_10133192613300005339Corn RhizosphereRTPDQGVALEGSIPTGLELNSAECTELVPAGLLQAASGGGLIPDYQLISPDLGIPSFFSNLQVLCRALI*
Ga0070661_10040630143300005344Corn RhizosphereDPAPEGARAGSPSCTSMDVHAGSPPHSGCMVVAQTLDQGVALEGSIPTGLALGSVESTELVPAGLLQAASGGGPAPGYQLISPGLGIPSLFSNL*
Ga0070661_10181564923300005344Corn RhizosphereEGVRAGSPSCTSMDVHAGSPPHSGCMVVAQALDQGVALEGSVPADRVLGSVDGTELIPAGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0070661_10185870713300005344Corn RhizosphereHAGSPPHSGGMVVAQTLDQGVALEGSVPAGLALGSVECTELVPSGLLQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0070659_10070421713300005366Corn RhizosphereANYDPAPEGARAGSPSCTSMDVHAGSPPHSGCMVVAQTLDQGVALEGSVPADRVLSSVDGTELVSAGLLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0070659_10171144513300005366Corn RhizosphereCMVVAQTLDQGVALEGSVPADRVFGSVEGTELIPTGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0070663_10025388713300005455Corn RhizosphereSGCMVVAQTLDQGVALEGSVPADRVLGSVEGTELISAGSLQAASGGGLTPAYQLISPDLGIPSFFTNLQVP*
Ga0070663_10159623113300005455Corn RhizosphereSCTSMDVHAGSPPHSGCMVVAQALDQGVALEGSVPADRVLGSVDGTELIPAGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0070663_10161938413300005455Corn RhizosphereGSPPHSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLRAASGGDPMPSHQLISHDLGVPSFFSNLQVL*
Ga0070663_10164268913300005455Corn RhizosphereDPAPEGARAGSPSCTSMDVHAGSPPHSGCMVVAQTLGQEVALEGSVPADRVLGSVEGAELISAGSLQAAPGGGLTSAYQLISPDLGIPSFFSNLQVL*
Ga0070662_10075413223300005457Corn RhizosphereLEASVPDDRVLGSADDTELVPADSLQVAPGGDPSPSHQLISHDLGVPSFFSNLQVFWFFLV*
Ga0070662_10110103733300005457Corn RhizosphereSGGMVVAQTPDQGVALEGSIPAGLALGSAECTELVPAGLLQAVSGGGPTPDYQLISPDLGIPSFFSNLQVLCFSLIFYVA*
Ga0070662_10122804513300005457Corn RhizosphereGSANCDPAPEGVRARSPSCTSMDVHAGSPPHSGGMVVAQTLDQGVALEGSVPAGLALGSVECTELVPTGLLQAASGGGLAPSYQLISPDLGIPSLFSNLQVLCCALV*
Ga0070681_1079585813300005458Corn RhizosphereQALGQGVALEGSAPADQVLGSVDGTELVPAGSLQAASGSGLTPGHQLISHDLGVPSFFSNLQVLWYTSA*
Ga0070681_1079593813300005458Corn RhizosphereAGSPSCTSMDVHAGSPPHSGCMVVAQAFGQGVALEASVPDDQVLGSTDDTELVPAGSLQVAPDGDPTPSHQLISHDLGVPSFFSNLQVL*
Ga0070681_1174213523300005458Corn RhizosphereQTLDQEVALEGSVPADRVLGSVDGTELIPAGSLQAASGSGLMPSYQLISPDLGIPSFFSNLQVL*
Ga0070679_10188364213300005530Corn RhizosphereANYDPAPEGARAGSPSCTSMDVHAGSPPHSGCMVVAQTLGQEVALEGSVPADRVLGSVEGAELISAGSLQAAPGGGLTSAYQLISPALGIPSFFSNLQVL*
Ga0070684_10201683313300005535Corn RhizosphereMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLQAASGGDLTPSRQLISHDLGVPSFFSNLQ
Ga0070684_10227030223300005535Corn RhizosphereMVVAQALGQGVALEASVPTDQVLGSVDGTELVPAGSLRAASGGDPMPSHQLISHDLGVPSFFSNLQVL*
Ga0070664_10040213633300005564Corn RhizosphereSPRSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLQAASGGDLTPGRQLISHDLGVPSFFSNLQVLWYILA*
Ga0070664_10070354313300005564Corn RhizosphereQGVALEGSVPADRAFGFVEGTELIPTGPLLAASGGALVSGYQLISPDLGIPSFFSNLQVLCCILA*
Ga0070664_10154884713300005564Corn RhizospherePRSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLQAASGGDLMPGHQLISHDLGVPSFFSNLQVL*
Ga0070664_10176648513300005564Corn RhizosphereSPSCTSMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQAASSGGLAPGHQLISPDLGIPSLFSNLQVLCCALV*
Ga0070664_10201013923300005564Corn RhizosphereQTLDQGVALEGSVPADRVFGSVEGTELIPTGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0068857_10186604723300005577Corn RhizosphereGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVLCCALV*
Ga0068857_10238267213300005577Corn RhizosphereDPAPEGARAGSPSCTSMDIHAGSPPHSGCMVVAQTLDQGVALEGSIPADQVLGSVDDTELVPAGSLQAASGGDLTPGHQLISHDLGVPSFFSNLQVLWYILA*
Ga0068856_10030238813300005614Corn RhizosphereMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV*
Ga0068852_10231101513300005616Corn RhizosphereVHAGSPPHSGCMVVAQALDQGIALEGSVPADQVLGSVDGTELVPAGSLQTASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0079222_1234939413300006755Agricultural SoilAQAFGQGAALEASVLGSAGDTELVCAGSLQVAPGGDPSPSHELISHDLGVPSFFSNLQVLWSILV*
Ga0079220_1045726713300006806Agricultural SoilAGSPPHSSCMVVAQALDQGVALEGSVPADRVLGSVDGTELVPAGLLQAASGGGLTPGYQLISPDLGIPSFFSNLQVR*
Ga0079220_1170843213300006806Agricultural SoilHSGCMVVAQAFGQGVALEASVPDDKVLGSADDTELVPAGSLQVAPGGDPSPSHQLISHDLGVPSFFSNLQVFWFLLV*
Ga0079217_1045236913300006876Agricultural SoilMVVAQAFGQGVALEASVPDDKVLRSADDTELVPASSLQVAPNGDPTPSHQLISHDLGVPSFFSNLQVLWSILVCFLHRMNC
Ga0079217_1152392113300006876Agricultural SoilVAQALGQGVALEASVPVDQVLGSVDGTELVPAGSLQAASGGDLMPGHQLISYDLGVPSFFSNLQVL*
Ga0079218_1186187513300007004Agricultural SoilSPAPEGVRAGSPSCTSMDVHAGSPPHSGCMVVAQALGQGVALEASVPADRVLGSVDGTELVHAGSLRAASGGDPMPSRQLISHDLGVPSFFSNLQVL*
Ga0079218_1336872223300007004Agricultural SoilGVRVGSASCSSMDVHVGSPPHSGGMTMARTSDQEVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGISSFFSNLQVLCRALI*
Ga0105240_1169103623300009093Corn RhizosphereMVIAQAFGQGVALEASAPDDRVLGSADDTKLVPADSLQVAPGGDPSLSHQLISHDLGVPSFFSNLQVFWFLLI*
Ga0105240_1171888513300009093Corn RhizosphereMDVHAGSPPHSGCMVVAQALGQGVALEASVPADQVLGSVDGAELVPAGSLQAASGGDLMPGHQLISHDLGVPSFFSNLQVL*
Ga0105240_1177497833300009093Corn RhizosphereMDIHAGSPPHSGCMVVAQTLDQGVALEGSIPTGLALSSAERTALVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVLCCALV*
Ga0105237_1146174623300009545Corn RhizosphereMVVAQTPDQGVALEGSIPTGLALGSVECIKLVPAGPLQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0105237_1179104813300009545Corn RhizosphereEGVRAGSPSCTSMDVHAKSPPHSGCMVVAQVSGQGVALEASVPGDQALGSADDTELVPAGSLQVAPDGDSTPSHQLISHDLGVPSFFSNLQVL*
Ga0105237_1243743213300009545Corn RhizosphereSCTSMDVHVGSPPHSGGMMVAQTPDQGVTLEGSIPTGLALSSAECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVLCCALV*
Ga0105238_1158550013300009551Corn RhizosphereMDVHAGSSPRSGCMVVAQALDQGVALEGSVPADRVFGSVEGTELIPSGPLEAASGGGLAPGYQLISPDLGIPSFFSNLQVL*
Ga0157296_1025681113300012905SoilMVVAQTLDQGVALEGSVPADRVFGSVEGTELIPTGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL*
Ga0157296_1039156213300012905SoilMVVAQTPDQRVALEGSIPTGLALGSVECTELVPAGLLQAALGGGLAPGYQLISPDLGIPSLFSNLQVLC
Ga0157371_1030813433300013102Corn RhizosphereMDVHAGSPPHSGGMVVAQTLDQGVALEGIVPAGLALGSVECTELVPAGLLQAASGGGPAPGYQLISPGLGIPSLFSNLQVLCCALV*
Ga0157371_1044080013300013102Corn RhizosphereAGSPPHSGCMVVAQTLDQGVALEGSVPADRAFGSVEGTELIPTGPSQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0157371_1081700513300013102Corn RhizosphereRAGSPSCTSMDVHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTELVPTGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV*
Ga0157369_1156115513300013105Corn RhizosphereGCMVVAQALDQGVALEGSVPADQVVGSVDGTELVPAGSLQAASSGSLTPGHQLISHDLGVPSFFSNLQVLWYTSA*
Ga0157369_1158810513300013105Corn RhizosphereMDVHAGSPPHSGGMVVAQTLGQGVALEGSVPAGLALGSVECTELVPTGLLQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0157372_1250453213300013307Corn RhizosphereVGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTEFVPAGLLQAASGGGLIPDYQLISPDLGIPSFFSNLQVLCRALI*
Ga0121464_10960413300014288City Subway Metal/PlasticMVVAQTPDQRVALEGSIPTGLALGSAECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVMCCALV*
Ga0135282_1046013300014716Maize PhyllosphereMVVAQTLDQGVTLEGSVPAGLALGFVECTELVPTGLLQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA*
Ga0135282_1125233300014716Maize PhyllosphereVALEASVPADQVLGSVDGTELVPAGSLQAASGGDLTPGRQLISHDLGVPSFFSNLQVLWYILA*
Ga0206351_1042942613300020077Corn, Switchgrass And Miscanthus RhizospherePEGARAGSPSCTSMDVHVGSPPHSGCMVVAQTLDQGVALEDSVPADRMLGSVEGTELIPPGSLQTASGGGLAPGYQLISPDLGIPSFFSNLQVL
Ga0206350_1162122823300020080Corn, Switchgrass And Miscanthus RhizosphereSGVALEASVPDDRVLGSADDTELVPADSLQVAPGGGPSPSHQLISHDLWVPSFFSNLQVFWFLLV
Ga0214108_1007688313300020815Food WasteMDVHVGSPPHSGGMTVARTSDQGVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGIPSFFSNLQVLCRALT
Ga0214108_1019915513300020815Food WasteMAAVENLALKDGVDTYPAPEGVRAGSPSGTSMDVLVGSPPHSGCMVVAQAFGQGAALEASVPDDKVLGSADDTELVPAGSLQVAPGGDPSPSHQLISHDLGVPSFFSNLQVLWSILV
Ga0214108_1051173823300020815Food WastePEGARVGSPSCTSMDGHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQTASGGGLASDYQLISPDLGIPSFFSNLQVLCCALV
Ga0214108_1056519323300020815Food WasteCMVVAQALDQGVALEGSVPADQVVGSVDGTVLVPTGSLQAASGGSLTPGYQLISPDLGISSFFSNLQVL
Ga0214108_1093381313300020815Food WasteCTSMDVHAGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSVECTELVPAGLLQAASGGGLARGYQLISPDLGIPSLFSNLQVLCCALV
Ga0214108_1111214723300020815Food WasteSPPHSGCVVVAQAFGQGVALEASVPDDQVLGCADDTELGPAGSLQVAPDGDPTPSHQLISHDFGIPSFFSNLQVL
Ga0214090_1103974833300020816Food WasteVAQTLDQGVALEGSIPTGLALGSVECTELVPAGLLQAASSGGLAPGRQLISPDLGIPSLFSNLQVLCCALV
Ga0226662_1007790913300021966Food WasteMDVHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQTASGGGLIPDYQLISPDLGIPSFFSNLQVLCCALV
Ga0255814_1107908613300023205Food WastePSCTSMDVHAGSPPHSGCVVVAQAFGQGVALEASVPDDQVLGCADDTELGPAGSLQVAPDGDPTPSHQLISHDFGIPSFFSNLQVL
Ga0255814_1123487813300023205Food WasteMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQAASSGGLASGYQLISPDLGIPSLFSNLQVPCCALV
Ga0255813_1143982823300023280Food WasteGSPPHTGCIVVAQALGQGVALEASVPADQVLGSVDGIELVPAGLLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0256702_1134564923300023300Food WasteMDVHAESPPHSGCMVVAQALDQGVALEGSVPAARVLGSVEGTELIPAGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0256702_1135140623300023300Food WasteGVRAGSPSCTSMDVHAGSPPHSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLRAASGGDPMPSHQLISHDLGVPSFFSNLQVL
Ga0256702_1182949813300023300Food WasteANYGPAPEGVRAGSPSCTSMDVHAGSSPRSGCMVVAQALGQGVALEASVPADQALGSVDGAELVPAGSLQAASGGDLMPGHQLISHDLGVPSFFSNLQVL
Ga0256702_1217505723300023300Food WasteAGSPPHSGCMVVAQTVDQGVALEGSVPADRVFGSVEGTELIPTGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0207705_1123585533300025909Corn RhizosphereAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQAASGGGLAPGHQLISPDLGIPSLFSNLQVLCCALV
Ga0207671_1065136323300025914Corn RhizosphereQAGSPSCTSMDVHAGSPPHSGCMVVAQTLDQGVALEGSVPADRVFGSVEGTKLIPTGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0207660_1138746913300025917Corn RhizospherePSCTSMDVHAGSPPHSGCMVVAQALGQGVALEASVPSDQVLGSVDGTELVPAGSLQAASGGDPTPGRQLISHDLGVPSFFSNLQVLWYILA
Ga0207657_1083978113300025919Corn RhizosphereEGVRARSPSCTSMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV
Ga0207657_1122143813300025919Corn RhizosphereQAGSPSCTSMDVHAGSPPHSGCMVVAQTLDQGVALEGSVPADRVLGSVEGAELISAGSLQAASGGGLTPAYQLISPDLGIPSFFSNLQVP
Ga0207657_1147056513300025919Corn RhizosphereVGSANYVPAPEGVRAGSPSCTSMDVHVGSPPHSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLRAASGGDPMPSHQLISHDLGVPSFFSNLQVL
Ga0207649_1035267933300025920Corn RhizosphereMVVAQALDQGVALEGSVPADQVLGSVDGTELVPAGSLQAASGGDLTPGHQLISHDLGVPSFFSNLQVL
Ga0207649_1053713813300025920Corn RhizosphereMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLQAASGGDLMPGRQLISHDLGVPSFFSNLQVLWYILA
Ga0207649_1157399323300025920Corn RhizosphereSANLDPAPEGVRVGSPSCTSMDVHVGSPPHSGGMTVARTSDQGVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGISSFFSNLQVLCRALI
Ga0207652_1181830813300025921Corn RhizosphereSPSCTSMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQAASSGGLAPGHQLISPDLGIPSLFSNLQVLCCALV
Ga0207706_1056438013300025933Corn RhizosphereTSMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV
Ga0207706_1145763023300025933Corn RhizosphereHSGCMVVAQAFGQGIALEASVPDDQVLGSADDTELVPAGSLQAAPDGDPTPSHQLISHDFGIPSFFSNLQVL
Ga0207706_1146215213300025933Corn RhizosphereMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQAASSGGLAPGRQLISPDLGIPSLFSNLQVLCCALV
Ga0207679_1089390713300025945Corn RhizosphereCMVVAQAFGQGVALEASVPDDKVLGSADDTELVPADSLQVAPGGDPSPSHQLISHDLGVSSFFSNLQVLWFILV
Ga0207679_1120093723300025945Corn RhizosphereAGSPPHSGCMVVAQALDQGVALEGSVPADQVVGSVDGTELVPAGSLQAASGGGLTPGHQLISHDLGVPSFFSNLQVLWYTSA
Ga0207679_1138593223300025945Corn RhizosphereVGSANYGPAPEGVRAGSPSCTSMDVHAGSPPHSGCMVVAQAFGQGVALEASVPDDKVLGSADDTELVPAGSLQVAPGGDPTPSHQLISHDLGVPSFFSNLQVL
Ga0207679_1145618313300025945Corn RhizosphereMAIAQAFGQGVALEASAPDDRVLGSADDTELVPTDLLRVVPVGDPSPSHQLISHDLGVPSFFSNLQVFWFLLV
Ga0207640_1151867813300025981Corn RhizosphereMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV
Ga0207678_1020132913300026067Corn RhizosphereANYDPAPEGARAGSPSCTSMDVHVGSPPHSGCMVVAQTLDQGVALEGSVPADRVFGSVEGTELIPTGSLQAASGGGLTPDYQLISPDLGIPSFFSNLQVL
Ga0207678_1041225033300026067Corn RhizospherePSCTSMDVHAGSPPHSGCMVVAQTLDQEVALEGSVPAERVLGSVDGAELIPADSLQAASGSGLTPSYQLISPDLGIPSFFSNLQVL
Ga0207678_1068115713300026067Corn RhizosphereHSVCMVVAQSLDQGIALEGSVPADRVLGSVEGTELISADSLQTAPGDGLTSAYQLISPDLGIPSFFSNLQVL
Ga0207678_1098578713300026067Corn RhizosphereMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQAASGGGLAPGHQLISPDLGIPSLFSNLQVLCCALV
Ga0207678_1133911613300026067Corn RhizosphereDPAPEGARAGSPSCTSMDVHVGSPPHSGGMVVAQTPDQGVALEGSIPTGLALGSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV
Ga0207678_1171872413300026067Corn RhizosphereGPAPEGVRARSPSCTSMDVHAGSPPYSGCMVVAQALGQGVALEASVPADQVLGSVDGTELVPAGSLRAASGGDPMPSHQLISHDLGVPSFFSNLQVL
Ga0207702_1071353933300026078Corn RhizospherePEGVRAGSPSCTSMDVHAGSPPHSGCMVVAQALGQGVALEASVPADQVLGSADDTELVPVGSLRAASDDDPMPSHQLISHDLGVPSFFSNLQVL
Ga0207674_1079302823300026116Corn RhizosphereMDVHAGSPPHSGCMVVAQTLDQGVALEGSVPADRAFGSVEGIELIPTGPLQAASGGGLAPGYQLISPDLGIPSFFSNL
Ga0207698_1124549713300026142Corn RhizosphereMDVHVGSPPHSGGMMVAQTPDQGVALEGSIPTGLALSSAECTELVPAGLLQTASGGGLTPDYQLISPDLGIPSFFSNLQVLCCALV
Ga0311022_1533182413300029799Anaerobic Digester DigestatePSCTSMDVHVGSPPHSGGMMVARTPDQGVALEGSIPTDLELNSAECTELVPAGLLQAASGGGLIPDYQLISPDLGIPSFFSNLQVLCRALI
Ga0311022_1586774723300029799Anaerobic Digester DigestateHSGCMVVAQALDQGVALEGSVPADRVLGSVDGTELIPAGSLQAASGSGLTPGYQLISPDLGIPSFFSNLQVL
Ga0307408_10159470913300031548RhizosphereMVIAQAFGQGVALEASAPDDRVLGSTDDTELVPADSLQVAPGGNPSPSHQLISRDLGVSSFFSNLQVLWFILV
Ga0307413_1099914013300031824RhizosphereMDVHVGSPPHSGGMMVARTPDQGVALEGSIPTGLELNSAECTELVPAGLLQTASSGGLAPGHQPISNDLGIPSLFSNL
Ga0307413_1144802813300031824RhizosphereQGVALEGSVPADRVLGSVDGTELVPAGLLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0307413_1195980113300031824RhizosphereGVRARSPSCTSMDIHAGSPPHSGGMVVAQTLDQGVALEGIIPAGLALGSVECTELVPAGLLQTASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA
Ga0307406_1128699733300031901RhizosphereFGQGDALEASVPDDKVLGSADDTELVPADSLQVAPGGDPSSSHQLISHDLRVPSFFSNLQVLWFILSDFYTG
Ga0307406_1156812933300031901RhizosphereVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGISSFFSNLQVLCRALI
Ga0307412_1067241813300031911RhizosphereALGQGVALEASVPADRVLGSADDTELVPAGSLQAAPDGDPAPSRQLISHDFGIPSFFSNLQVLWSILV
Ga0307412_1122415713300031911RhizosphereDQGVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGISSFFSNLQVLCRALI
Ga0307416_10189387313300032002RhizosphereAQTMDQGVALEGSVPADRVFGSVEGTELIPTGSLQAASGGGLTPGYQLISPDLGIPSFFSNLQVL
Ga0307416_10239508813300032002RhizosphereVAQTPDQGVALEGSIPTGLVLGSAECTELVPAGLLQAASGGGLTPDYQLISPDLGIPSFFSNLQVLCRALI
Ga0307416_10254568923300032002RhizosphereDPAPEGVRARSPSCTSMDVHAGSPPHSGGMVVAQTLDQGVALEGSIPAGLALGPVECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSFFSNLQVLCCTLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.