Basic Information | |
---|---|
Family ID | F062951 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 43 residues |
Representative Sequence | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.34 % |
% of genes near scaffold ends (potentially truncated) | 30.77 % |
% of genes from short scaffolds (< 2000 bps) | 73.85 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.692 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.846 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.538 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF00196 | GerE | 18.60 |
PF00239 | Resolvase | 6.98 |
PF02397 | Bac_transf | 4.65 |
PF08937 | DUF1863 | 0.78 |
PF07730 | HisKA_3 | 0.78 |
PF13289 | SIR2_2 | 0.78 |
PF08681 | DUF1778 | 0.78 |
PF00149 | Metallophos | 0.78 |
PF13432 | TPR_16 | 0.78 |
PF02594 | DUF167 | 0.78 |
PF05746 | DALR_1 | 0.78 |
PF03551 | PadR | 0.78 |
PF12802 | MarR_2 | 0.78 |
PF12686 | DUF3800 | 0.78 |
PF00782 | DSPc | 0.78 |
PF00482 | T2SSF | 0.78 |
PF07366 | SnoaL | 0.78 |
PF00561 | Abhydrolase_1 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 6.98 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 6.98 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 4.65 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.78 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.78 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.78 |
COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.78 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.78 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.78 |
COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.78 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.78 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.69 % |
Unclassified | root | N/A | 22.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004092|Ga0062389_103448869 | Not Available | 592 | Open in IMG/M |
3300004268|Ga0066398_10119772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300004479|Ga0062595_101489852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 623 | Open in IMG/M |
3300005166|Ga0066674_10046446 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300005167|Ga0066672_10379093 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300005167|Ga0066672_10730860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300005172|Ga0066683_10673895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300005174|Ga0066680_10601272 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300005177|Ga0066690_10208365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1303 | Open in IMG/M |
3300005178|Ga0066688_10692333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300005181|Ga0066678_10295080 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300005186|Ga0066676_10494082 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300005332|Ga0066388_102720987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
3300005332|Ga0066388_106026471 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300005332|Ga0066388_107830706 | Not Available | 535 | Open in IMG/M |
3300005554|Ga0066661_10180936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300005586|Ga0066691_10765746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300005598|Ga0066706_10225408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1450 | Open in IMG/M |
3300005610|Ga0070763_10533996 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300005764|Ga0066903_100887189 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300005764|Ga0066903_106267751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
3300005764|Ga0066903_106339822 | Not Available | 617 | Open in IMG/M |
3300006175|Ga0070712_101376560 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300009012|Ga0066710_101740955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
3300009012|Ga0066710_102829755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300009137|Ga0066709_100578174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1596 | Open in IMG/M |
3300009137|Ga0066709_102368862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300009518|Ga0116128_1017281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2481 | Open in IMG/M |
3300009518|Ga0116128_1098347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
3300009519|Ga0116108_1006571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4782 | Open in IMG/M |
3300009524|Ga0116225_1174135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
3300009547|Ga0116136_1020533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2166 | Open in IMG/M |
3300009621|Ga0116116_1067467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300009623|Ga0116133_1006998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2822 | Open in IMG/M |
3300009637|Ga0116118_1065048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
3300009640|Ga0116126_1115134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
3300009641|Ga0116120_1197603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300009646|Ga0116132_1010237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3802 | Open in IMG/M |
3300010048|Ga0126373_10362423 | Not Available | 1465 | Open in IMG/M |
3300010048|Ga0126373_10817036 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300010048|Ga0126373_11112639 | Not Available | 856 | Open in IMG/M |
3300010301|Ga0134070_10244273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300010361|Ga0126378_12769252 | Not Available | 560 | Open in IMG/M |
3300010376|Ga0126381_100020094 | All Organisms → cellular organisms → Bacteria | 7796 | Open in IMG/M |
3300010376|Ga0126381_103913705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300010379|Ga0136449_102591382 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010398|Ga0126383_11625911 | Not Available | 735 | Open in IMG/M |
3300010398|Ga0126383_13326376 | Not Available | 525 | Open in IMG/M |
3300012199|Ga0137383_10027062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4008 | Open in IMG/M |
3300012199|Ga0137383_10143213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
3300012199|Ga0137383_10144721 | Not Available | 1739 | Open in IMG/M |
3300012200|Ga0137382_10031154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3187 | Open in IMG/M |
3300012206|Ga0137380_10671165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
3300012207|Ga0137381_10248755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
3300012209|Ga0137379_10122607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2499 | Open in IMG/M |
3300012351|Ga0137386_10120260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1868 | Open in IMG/M |
3300012582|Ga0137358_10844505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300012975|Ga0134110_10542900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300014154|Ga0134075_10134827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300014501|Ga0182024_11589256 | Not Available | 742 | Open in IMG/M |
3300015374|Ga0132255_105150465 | Not Available | 553 | Open in IMG/M |
3300016270|Ga0182036_10763437 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300016319|Ga0182033_10465030 | Not Available | 1081 | Open in IMG/M |
3300016341|Ga0182035_11692585 | Not Available | 571 | Open in IMG/M |
3300016357|Ga0182032_10757278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
3300016357|Ga0182032_11433661 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300016387|Ga0182040_11199800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300017925|Ga0187856_1024205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3018 | Open in IMG/M |
3300017929|Ga0187849_1036707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2435 | Open in IMG/M |
3300017931|Ga0187877_1030253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2711 | Open in IMG/M |
3300017931|Ga0187877_1324103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300017932|Ga0187814_10372668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
3300017935|Ga0187848_10261677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300017938|Ga0187854_10496110 | Not Available | 506 | Open in IMG/M |
3300017943|Ga0187819_10080793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1940 | Open in IMG/M |
3300017943|Ga0187819_10080793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1940 | Open in IMG/M |
3300017959|Ga0187779_10000006 | All Organisms → cellular organisms → Bacteria | 179696 | Open in IMG/M |
3300017959|Ga0187779_10011095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5155 | Open in IMG/M |
3300017959|Ga0187779_10457676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
3300017970|Ga0187783_10002748 | All Organisms → cellular organisms → Bacteria | 13068 | Open in IMG/M |
3300017970|Ga0187783_10011963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica | 6381 | Open in IMG/M |
3300017973|Ga0187780_10051073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2866 | Open in IMG/M |
3300017995|Ga0187816_10304422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300017998|Ga0187870_1045379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1915 | Open in IMG/M |
3300018001|Ga0187815_10525572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300018002|Ga0187868_1017484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3532 | Open in IMG/M |
3300018002|Ga0187868_1026367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2712 | Open in IMG/M |
3300018008|Ga0187888_1112515 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300018009|Ga0187884_10084562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
3300018009|Ga0187884_10087227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
3300018013|Ga0187873_1078642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
3300018018|Ga0187886_1123682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300018034|Ga0187863_10070747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1971 | Open in IMG/M |
3300018038|Ga0187855_10143726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
3300018042|Ga0187871_10118726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1512 | Open in IMG/M |
3300018042|Ga0187871_10651421 | Not Available | 585 | Open in IMG/M |
3300018431|Ga0066655_10278820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
3300018468|Ga0066662_10360288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1256 | Open in IMG/M |
3300021861|Ga0213853_10602295 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300025432|Ga0208821_1004201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4561 | Open in IMG/M |
3300025448|Ga0208037_1058354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300025576|Ga0208820_1128766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300025928|Ga0207700_11571085 | Not Available | 583 | Open in IMG/M |
3300026331|Ga0209267_1170043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300026334|Ga0209377_1194698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300026528|Ga0209378_1265600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300026529|Ga0209806_1018957 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
3300026538|Ga0209056_10011033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9149 | Open in IMG/M |
3300027855|Ga0209693_10163770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1097 | Open in IMG/M |
3300027898|Ga0209067_10485753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
3300031682|Ga0318560_10373025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300031753|Ga0307477_11086127 | Not Available | 522 | Open in IMG/M |
3300031819|Ga0318568_10407895 | Not Available | 847 | Open in IMG/M |
3300031890|Ga0306925_10041982 | All Organisms → cellular organisms → Bacteria | 4733 | Open in IMG/M |
3300031910|Ga0306923_10483546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1402 | Open in IMG/M |
3300031941|Ga0310912_10628248 | Not Available | 835 | Open in IMG/M |
3300031962|Ga0307479_10996236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300032180|Ga0307471_100828126 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300032261|Ga0306920_100054805 | All Organisms → cellular organisms → Bacteria | 5803 | Open in IMG/M |
3300032829|Ga0335070_10015733 | All Organisms → cellular organisms → Bacteria | 8795 | Open in IMG/M |
3300032893|Ga0335069_11313981 | Not Available | 786 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.08% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 10.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.15% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.38% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.62% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.31% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.54% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.77% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.77% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.77% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062389_1034488692 | 3300004092 | Bog Forest Soil | REHMMEIGEPLLTIAVESLELPVSNSKGEPDPEPNPLEPEQVPATP* |
Ga0066398_101197721 | 3300004268 | Tropical Forest Soil | MQIGEPLRTIIIEPLELPVKQPAGEPEPVVAPQPEPEQVPVAQ* |
Ga0062595_1014898522 | 3300004479 | Soil | GAHMQVGEPLRTIIVEPLEIPLKEPTGKPEPTPVPEAEPEQAPTAQ* |
Ga0066674_100464462 | 3300005166 | Soil | MMQIGEPLRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE* |
Ga0066672_103790933 | 3300005167 | Soil | MMQIGEPLRTIIVEPLELPIGDPKTEPDPEPIATPDVEPEQVPATE* |
Ga0066672_107308601 | 3300005167 | Soil | IGRQRMQIGEPLRTIIVEPLELPLDEPQVRPAPTQPEPEPEQVPATE* |
Ga0066683_106738951 | 3300005172 | Soil | MQIGEPLRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE* |
Ga0066680_106012722 | 3300005174 | Soil | MQIGEPLRTIIVEPLELPIDEPQVQPAPTQPEPEPEQVPATE* |
Ga0066690_102083652 | 3300005177 | Soil | MQIGEPLRTIIVEPLELLIDEPQVRPAPTQPEPEPEQVPATE* |
Ga0066688_106923332 | 3300005178 | Soil | MMQIGEPLRTIIVEPLALPIGDPTTEPDPEPTQTPDVEPEQVPATE* |
Ga0066678_102950801 | 3300005181 | Soil | MQIGEPLRTIIVEPLELPIDEPQVRPAPTQPEHEPEQVPTTE* |
Ga0066676_104940821 | 3300005186 | Soil | MQIGEPLRTIIVEPLELPIDEPQVRPAPTQPEPQREPEPATK* |
Ga0066388_1027209872 | 3300005332 | Tropical Forest Soil | MNIGEPLRTIIVEPLDLPVNAPTAEPKPELEPQQPQPEHEPASI* |
Ga0066388_1060264712 | 3300005332 | Tropical Forest Soil | MYIGEPLRTIIVEPLELPVNDPTVEPVPEPQEPEPTQEPATV* |
Ga0066388_1078307062 | 3300005332 | Tropical Forest Soil | MQIGEPLRTVIVEPLELPVNKPTGEAEPIPVSETEPEEAPAAQ* |
Ga0066661_101809361 | 3300005554 | Soil | LMMQIGEPLRTIIVEPLELPIGDPKTEPDPEPIQTPDVEPEQVPATE* |
Ga0066691_107657462 | 3300005586 | Soil | MQIGEPLRTIIVEPLELPIGDPKTEPNPEPIPTPDVE |
Ga0066706_102254081 | 3300005598 | Soil | MQIGEPLRTIIVEPLELPLDEPQVRPAPTQPEPEPEQVPATE* |
Ga0070763_105339962 | 3300005610 | Soil | MQIGEPLRTIIVEPLELPISAPVREEPYTPVHEPEKAPVKEPALVP* |
Ga0066903_1008871893 | 3300005764 | Tropical Forest Soil | MNIGEPLRTIIVEPLELPMNRPTAEPEREPVAQQPEPEHEPASV* |
Ga0066903_1062677512 | 3300005764 | Tropical Forest Soil | MQIGEPLRTIIVEPLELPVKEPTRELEPVVAPQPEPEQVPVAQ* |
Ga0066903_1063398222 | 3300005764 | Tropical Forest Soil | MDIGEPFRTIIVEPLELPVNAPTAEPQPELEPQQPQPEHEPASV* |
Ga0070712_1013765602 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIGEPLRTIIVEPLELPLNNPDTEQEPKHTPREPEPEQEPAAV* |
Ga0066710_1017409551 | 3300009012 | Grasslands Soil | MQIGEPLRTIIVEPLGLPIEEPQVRPAPTQPEPEPEQVPATE |
Ga0066710_1028297552 | 3300009012 | Grasslands Soil | EPLRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE |
Ga0066709_1005781744 | 3300009137 | Grasslands Soil | MMQIGEPLRTIIVEPLELPIEEPQVRPAPTQPEPEPEQVPATE* |
Ga0066709_1023688621 | 3300009137 | Grasslands Soil | MQIGEPLRTIIVEPLGLPIEEPQVRPAPTQPEPEPEQVPATE* |
Ga0116128_10172812 | 3300009518 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV* |
Ga0116128_10983472 | 3300009518 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPKPEPLEPEPEVPATV* |
Ga0116108_10065714 | 3300009519 | Peatland | MQIGEPLRTIIVEPLELPVSEPSFEPKPEPLEPEPEQVPATV* |
Ga0116225_11741352 | 3300009524 | Peatlands Soil | MQIGDPLRTIIVEPLELPVDEPTADPNPDPIPAPE |
Ga0116136_10205332 | 3300009547 | Peatland | QICTKKEECVMQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV* |
Ga0116116_10674671 | 3300009621 | Peatland | RRGCVMQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV* |
Ga0116133_10069981 | 3300009623 | Peatland | MQIGEPLRTIIVEPLELPVNEPRAEPEPEPLEPEPEQVPATV* |
Ga0116118_10650482 | 3300009637 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPKPEPLEPEPEQVPATV* |
Ga0116126_11151341 | 3300009640 | Peatland | IGEPLRTIIVEPLELPVSEPSFEPKPEPLEPEPEQVPATV* |
Ga0116120_11976032 | 3300009641 | Peatland | MSDLYKKEECVMQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV* |
Ga0116132_10102373 | 3300009646 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATI* |
Ga0126373_103624232 | 3300010048 | Tropical Forest Soil | MNIGEPLRTIVVEPLELPVKDPNTEHTSDPAPLEPEQVPANV* |
Ga0126373_108170361 | 3300010048 | Tropical Forest Soil | MHIGEPLRTIIVEPLELPVNDPTAEPVAEPQEPEPTQEPATV* |
Ga0126373_111126394 | 3300010048 | Tropical Forest Soil | MQIGEPLRTIIVEPLELPVKQPAGEPEPVVAPQPEPEQ |
Ga0134070_102442731 | 3300010301 | Grasslands Soil | LRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE* |
Ga0126378_127692522 | 3300010361 | Tropical Forest Soil | MNIGEPLRTIIVEPLELPVDVPEVEPESEPEPVEPEAEPVPATV* |
Ga0126381_1000200947 | 3300010376 | Tropical Forest Soil | MHIGEPLRTIIVEPLELPVNDPTAEPVPEPQEPEPTQEPATV* |
Ga0126381_1039137052 | 3300010376 | Tropical Forest Soil | QIGEPLRTVIVEPLELPVKQPTGEPEPVIAPQPEPEQEPVAQ* |
Ga0136449_1001801118 | 3300010379 | Peatlands Soil | MQIGEPLRTFIVEPLELPVGEPATVEPEPEPAVPQP |
Ga0136449_1025913822 | 3300010379 | Peatlands Soil | MMQIGEPLRTIIVEPLELPVDEPKTEPEADPVVQPDPEPEQVPAKS* |
Ga0136449_1045949702 | 3300010379 | Peatlands Soil | MQIGEPLRTFIVEPLELPVGEPATVEPEPEPVAPELEPEGVPVAP* |
Ga0126383_116259111 | 3300010398 | Tropical Forest Soil | MEIGEPLRTIIVEPLELPVTEPEAEPKPERSVPEPEQVPAAV* |
Ga0126383_133263761 | 3300010398 | Tropical Forest Soil | IGEPLRTIMVEPLELPVSTPAPEPETGPQEPETEPVTITV* |
Ga0137383_100270624 | 3300012199 | Vadose Zone Soil | MQIGEPLRTIIVEPLELPIDEPQVRPAPTQPEPEPERVPATE* |
Ga0137383_101432131 | 3300012199 | Vadose Zone Soil | MMQIGEPLRTIIVEPLELPIGDPKTEPDPEPIQTPDVEPEQVPATE* |
Ga0137383_101447213 | 3300012199 | Vadose Zone Soil | MQIGEPLRTIVVELLEIPVNEPSADPEPIVEHPEPAPEQVPVAS* |
Ga0137382_100311544 | 3300012200 | Vadose Zone Soil | MMQIGEPLRTIIVEPLELPVDEPQVRPAPTQPEPEPEQIPATE* |
Ga0137380_106711651 | 3300012206 | Vadose Zone Soil | MMQIGEPLRTIIVEPLELPVDEPQVRPAPTQPEPEPEQVPATE* |
Ga0137381_102487553 | 3300012207 | Vadose Zone Soil | MQIGEPLRTIIVEPLELPVDEPQVRPAPTQPEPEPEQVPATE* |
Ga0137379_101226071 | 3300012209 | Vadose Zone Soil | MMQIGEPLRTIIVEPLELPIDEPQVRPAPTQSEPEPEQVPATE* |
Ga0137386_101202603 | 3300012351 | Vadose Zone Soil | MMQIGEPLRTIVVEPLELPIDEPQVRPAPTQSEPEPEQVPATE* |
Ga0137358_108445052 | 3300012582 | Vadose Zone Soil | MQIGEPLRIIVVEPLELPLKQPRGESEPVHAPEPEPEQMPVTP* |
Ga0134110_105429002 | 3300012975 | Grasslands Soil | MQIGEPLRTIIVEPLELPIKEPQVRPAPTQPEPEPEQVPATE* |
Ga0134075_101348271 | 3300014154 | Grasslands Soil | EPLRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE* |
Ga0182024_115892562 | 3300014501 | Permafrost | MQIGKPLRTVIVEPLELPVDEPTAEPQPEPTHASEPEPEQVPTAS* |
Ga0132255_1051504651 | 3300015374 | Arabidopsis Rhizosphere | MNIGAPLRTILVEPLELPVNDPKVEHEPELEPAEPAPEQAPAKV* |
Ga0182036_107634372 | 3300016270 | Soil | MDIGEPLRTIVVEPLKLPVKDPNIEHEPEPAPLEPEPEHILASV |
Ga0182033_104650302 | 3300016319 | Soil | MEIGIPLRTIIVEPLELPVNEPAVEPEGEPETPEPN |
Ga0182035_116925851 | 3300016341 | Soil | MQIGEPLRTIIVEPLELPMKPPMRETEPTPVPEAE |
Ga0182032_107572782 | 3300016357 | Soil | MQIGEPLRTIIVEPLELPVKQPAGEPEPVVAPQPEPEQEPVAQ |
Ga0182032_114336612 | 3300016357 | Soil | MNIGEPLRTIVVEPLELPVKDPNIEHEPEPVPLEPEPEQIPASV |
Ga0182040_111998002 | 3300016387 | Soil | MEIGVPVRTIVVDPLELPVNDPNIDHEPEQEPLEPEPEQVPA |
Ga0187856_10242053 | 3300017925 | Peatland | MQIGEPLRTIIVEPLELPVSEPSFEPKPEPLEPEPEQVPATV |
Ga0187807_11613482 | 3300017926 | Freshwater Sediment | GEPLRTFIVEPLELPVDEPATVQPEPEPAVSQSEPERMPVAP |
Ga0187806_13620792 | 3300017928 | Freshwater Sediment | MQIGEPLRTVIVEPLELPVGEPATVEPEPEPAVPQHEPETVPVAP |
Ga0187849_10367072 | 3300017929 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV |
Ga0187877_10302532 | 3300017931 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPESLEPEPEQVPATV |
Ga0187877_13241032 | 3300017931 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPKPEPLEPEPEVPA |
Ga0187814_103726682 | 3300017932 | Freshwater Sediment | GVRHMEIGEPLRTILVEPLELPVNAPATEPETEPEPRVPEPESEPASV |
Ga0187848_102616771 | 3300017935 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPE |
Ga0187854_104961102 | 3300017938 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPKPEPLEPEPEVPATV |
Ga0187808_101980271 | 3300017942 | Freshwater Sediment | MQIGEPLRTVIVEPLEVPAGEPATVQPEPEPAVPQPEREKVPVAP |
Ga0187819_100807931 | 3300017943 | Freshwater Sediment | MEIGEPLRTILVEPLELPVNAPATEPETEPEPRVPEPESEPASV |
Ga0187819_100807933 | 3300017943 | Freshwater Sediment | MNIGEPLRTIIVEPLELPVDAPSIEPGPETEPDEPGTVPVTVTP |
Ga0187779_1000000682 | 3300017959 | Tropical Peatland | MNIGEPLRTIIVEPLELPVNDPEAEPESYPEPLQPEPESVPANV |
Ga0187779_100110954 | 3300017959 | Tropical Peatland | MHIGEPLRTIIVEPLELPVDAPALEPEPEPIQPEIEPVPAGL |
Ga0187779_104576762 | 3300017959 | Tropical Peatland | MNIGEPLRTIIVEPLELPVDAPAAKPEPEPEPLEPEAE |
Ga0187783_1000274821 | 3300017970 | Tropical Peatland | RTIIVEPLELPVNEPAVEPEGEPEPLEPNSEPEPVPASV |
Ga0187783_100119631 | 3300017970 | Tropical Peatland | MQIGRPLRTIIVEPLELPVNEPAVEPEGEPEPLEPNSEPEPVPASV |
Ga0187780_100510732 | 3300017973 | Tropical Peatland | MQIGRPLRTIIVEPLELPVNEPAVEPEGEPEPLEPNSEPEAVPASV |
Ga0187782_100261527 | 3300017975 | Tropical Peatland | MQIGEPRRTFIVEPLELPVGEPQEEPEPNAPEPEPETEPATK |
Ga0187816_103044221 | 3300017995 | Freshwater Sediment | KLPSTCEGVRHMEIGEPLRTILVEPLELPVNAPATEPETEPEPRVPEPESEPASV |
Ga0187816_105849841 | 3300017995 | Freshwater Sediment | MQIGEPLRTFIVEPLELPVGEPATVEPEPEPAVPQPEPER |
Ga0187870_10453792 | 3300017998 | Peatland | CVMQIGEPLRTIIVEPIELPVNELSAEPEPEPEPLEPEPEQVPATV |
Ga0187815_105255722 | 3300018001 | Freshwater Sediment | MNIGEPLRTIIVEPLELPVDAPSIEPEPETEPDEPGTVPVPVTP |
Ga0187868_10174841 | 3300018002 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPA |
Ga0187868_10263671 | 3300018002 | Peatland | RGCVMQIGEPLRTIIVEPLELPVSEPSFEPKPEPLEPEPEQVPATV |
Ga0187888_11125152 | 3300018008 | Peatland | MQIGEPLRTIIVEPLELPVSEPSAEPEPEPLEPEPEQVPATV |
Ga0187884_100845622 | 3300018009 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPAT |
Ga0187884_100872272 | 3300018009 | Peatland | RTIIVEPLELPVSEPSFEPKPEPLEPEPEQVPATV |
Ga0187873_10786421 | 3300018013 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQ |
Ga0187886_11236822 | 3300018018 | Peatland | MQIGEPLRTLIVEPLELPVNEPSAEPEPEPLEPEPEVPATV |
Ga0187863_100707471 | 3300018034 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPKPEPLEPEPEQVPATI |
Ga0187855_101437261 | 3300018038 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATI |
Ga0187871_101187262 | 3300018042 | Peatland | MQIGEPLRTIIVEPLELPVNEPRAEPEPEPLEPEPEQVPATV |
Ga0187871_106514211 | 3300018042 | Peatland | MQIGEPLRTIIVEPLELPVNEPSFEPKPEPLEPEPEQVPATV |
Ga0066655_102788203 | 3300018431 | Grasslands Soil | LRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE |
Ga0066662_103602881 | 3300018468 | Grasslands Soil | MMQIGGPLRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE |
Ga0213853_106022952 | 3300021861 | Watersheds | MQIGEPLRMIVVEPLELPVDQPQERPEPTALEPETEPQQVPATP |
Ga0208821_10042016 | 3300025432 | Peatland | MQIGEPLRTIIVEPLELPVNEPSAEPKPEPLEPEPEQVPATV |
Ga0208037_10583541 | 3300025448 | Peatland | TERRGCVMQIGEPLRTIIVEPLELPVNEPSAEPEPEPLEPEPEQVPATV |
Ga0208820_11287661 | 3300025576 | Peatland | GEPLRTIIVEPLELPVSEPSFEPKPEPLEPEPEQVPATV |
Ga0207700_115710851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIGEPLRTIIVEPLELPLNNPDTEQEPKHTPREPEPEQEPAAV |
Ga0209267_11700431 | 3300026331 | Soil | MQIGEPLRTIIVEPLELPIDEPQVRPAPTQPEPEPEQVPATE |
Ga0209377_11946981 | 3300026334 | Soil | MMQIGEPLRTIIVEPLELPVDEPQVRPAPTQPEPEPEQVPATE |
Ga0209378_12656002 | 3300026528 | Soil | MQIGEPLRTIIVEPLELPLDEPQVRPAPTQPEPEPEQVPATE |
Ga0209806_10189572 | 3300026529 | Soil | MQIGEPLRTIIVEPLELPIDEPQVQPAPTQPEPEPEQVPATE |
Ga0209056_100110331 | 3300026538 | Soil | MQIGEPLRTIIVEPLELPLDEPQVRPAPTQPEPEPE |
Ga0209693_101637702 | 3300027855 | Soil | MQIGEPLRTIIVEPLELPISAPVREEPYTPVHEPEKAPVKEPALVP |
Ga0209067_104857532 | 3300027898 | Watersheds | MQIGEPLRTIIVEPLEVPVKPPTSELEPVPVPEAEPEQVPAQ |
Ga0318560_103730252 | 3300031682 | Soil | MEIGVPVRTIVVDPLELPVNDPNIDHEPEQEPLEPEPEQVPASV |
Ga0307477_110861271 | 3300031753 | Hardwood Forest Soil | MQIGEPLRTIIVEPLVLPVPEPRREAQPEPEPAVATPEPEKVVAP |
Ga0318568_104078951 | 3300031819 | Soil | MEIGVPVRTIVVDPLELPVNDPNIEHEPEQEPLEPEP |
Ga0306925_100419825 | 3300031890 | Soil | MEIGVPVRTIVVDPLELPVNDPNIEHEPEQEPLEPEPEQVPASV |
Ga0306923_104835462 | 3300031910 | Soil | MQIGEPLRTIIVEPLELPVKQTIREPEPTSVPEAEPEQVPSAQ |
Ga0310912_106282482 | 3300031941 | Soil | MQIGEPLRTIIVEPLELPVKQPAGEPEPVVGPQPEPEQEPVAQ |
Ga0307479_109962361 | 3300031962 | Hardwood Forest Soil | PPPKNRRRCAMNIGEPLRTIVVEPLELPVSDPTAEPDPLPVEPETEPVSEPAAV |
Ga0311301_129021511 | 3300032160 | Peatlands Soil | MQIGEPLRTFIVEPLELPVGEPATVEPEPEPVAPELEPEGVPVAP |
Ga0307471_1008281262 | 3300032180 | Hardwood Forest Soil | RESPAGVYVDMNIGMPLRTIIVEPLELPVNDTNIEHEPEHEPLEPEPEQVPATV |
Ga0306920_1000548053 | 3300032261 | Soil | VNIGEPLRTIIVEPLELPVDQPNFEKEPEPQEPEPEQVPATV |
Ga0335079_100288542 | 3300032783 | Soil | MQIGEPLRTFIVEPLELPAGEPATVEPTPEPAVPQTEPERVPVAP |
Ga0335070_1001573315 | 3300032829 | Soil | MQIGEPLRTIIVEPLELPVEQPTGEPEPTPVPEAEPEEAPTAQ |
Ga0335069_113139813 | 3300032893 | Soil | MQIGEPLRTVIVEPLELPVDEPTTAQPEPEPAAPQP |
⦗Top⦘ |