NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063031

Metagenome / Metatranscriptome Family F063031

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063031
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 186 residues
Representative Sequence MNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Number of Associated Samples 111
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 43.08 %
% of genes from short scaffolds (< 2000 bps) 76.15 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.231 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(16.923 % of family members)
Environment Ontology (ENVO) Unclassified
(40.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(46.154 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 61.03%    β-sheet: 1.54%    Coil/Unstructured: 37.44%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF00437T2SSE 9.23
PF05157T2SSE_N 1.54
PF00149Metallophos 1.54
PF01272GreA_GreB 0.77
PF02371Transposase_20 0.77
PF00005ABC_tran 0.77
PF01351RNase_HII 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0164Ribonuclease HIIReplication, recombination and repair [L] 0.77
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.77
COG1039Ribonuclease HIIIReplication, recombination and repair [L] 0.77
COG3547TransposaseMobilome: prophages, transposons [X] 0.77


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.23 %
UnclassifiedrootN/A0.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003154|Ga0052186_10144161All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15793Open in IMG/M
3300003465|P52013CM_1002911All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-1553176Open in IMG/M
3300005436|Ga0070713_100244258All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151636Open in IMG/M
3300005445|Ga0070708_100541786All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151098Open in IMG/M
3300006173|Ga0070716_100140283All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151540Open in IMG/M
3300009175|Ga0073936_10080881All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152765Open in IMG/M
3300009175|Ga0073936_10151518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151743Open in IMG/M
3300009502|Ga0114951_10306194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15815Open in IMG/M
3300009502|Ga0114951_10337234All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15765Open in IMG/M
3300009537|Ga0129283_10033086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152072Open in IMG/M
3300009637|Ga0116118_1087338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151059Open in IMG/M
3300009639|Ga0116122_1089071All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151010Open in IMG/M
3300009640|Ga0116126_1041466All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151861Open in IMG/M
3300009644|Ga0116121_1200815All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15634Open in IMG/M
3300009669|Ga0116148_1000020All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15167863Open in IMG/M
3300009669|Ga0116148_1002547All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-1517825Open in IMG/M
3300009698|Ga0116216_10278412All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151021Open in IMG/M
3300009700|Ga0116217_10219386All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151244Open in IMG/M
3300009764|Ga0116134_1110823All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15987Open in IMG/M
3300009868|Ga0130016_10000419All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-1593518Open in IMG/M
3300010352|Ga0116247_10175676All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151797Open in IMG/M
3300010379|Ga0136449_100723762All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151663Open in IMG/M
3300012206|Ga0137380_10244116All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151620Open in IMG/M
3300012207|Ga0137381_10116380All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152279Open in IMG/M
3300012353|Ga0137367_10873345All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15621Open in IMG/M
3300012956|Ga0154020_10341304All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151306Open in IMG/M
3300014151|Ga0181539_1065443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151636Open in IMG/M
3300014152|Ga0181533_1133184All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151043Open in IMG/M
3300014153|Ga0181527_1032184All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153095Open in IMG/M
3300014153|Ga0181527_1065897All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151848Open in IMG/M
3300014156|Ga0181518_10098261All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151639Open in IMG/M
3300014158|Ga0181521_10210220All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151057Open in IMG/M
3300014159|Ga0181530_10047867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152828Open in IMG/M
3300014160|Ga0181517_10105998All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151629Open in IMG/M
3300014161|Ga0181529_10379948All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15768Open in IMG/M
3300014162|Ga0181538_10227215All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151037Open in IMG/M
3300014491|Ga0182014_10078778All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152078Open in IMG/M
3300014494|Ga0182017_10072981All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152265Open in IMG/M
3300014502|Ga0182021_12242550All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15657Open in IMG/M
3300017925|Ga0187856_1105242All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151116Open in IMG/M
3300017940|Ga0187853_10162546All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151063Open in IMG/M
3300017946|Ga0187879_10091575All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151749Open in IMG/M
3300017973|Ga0187780_10751848All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15704Open in IMG/M
3300018008|Ga0187888_1150498All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15952Open in IMG/M
3300018016|Ga0187880_1024736All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153519Open in IMG/M
3300018017|Ga0187872_10287675All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15723Open in IMG/M
3300018020|Ga0187861_10377756All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15596Open in IMG/M
3300018021|Ga0187882_1219283All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15744Open in IMG/M
3300018022|Ga0187864_10034436All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152966Open in IMG/M
3300018024|Ga0187881_10054660All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151925Open in IMG/M
3300018026|Ga0187857_10133045All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151191Open in IMG/M
3300018030|Ga0187869_10072752All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151772Open in IMG/M
3300018033|Ga0187867_10132074All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151442Open in IMG/M
3300018034|Ga0187863_10732986All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15559Open in IMG/M
3300018037|Ga0187883_10254855All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15897Open in IMG/M
3300018038|Ga0187855_10053585All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152499Open in IMG/M
3300018040|Ga0187862_10310748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15992Open in IMG/M
3300018042|Ga0187871_10137881All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151384Open in IMG/M
3300018043|Ga0187887_10035879All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153099Open in IMG/M
3300018044|Ga0187890_10136790All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151408Open in IMG/M
3300018057|Ga0187858_10086131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152162Open in IMG/M
3300018058|Ga0187766_11363769All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15519Open in IMG/M
3300018085|Ga0187772_10391078All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15966Open in IMG/M
3300018086|Ga0187769_10467437All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15951Open in IMG/M
3300019082|Ga0187852_1022943All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153098Open in IMG/M
3300020158|Ga0194038_1102461All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15844Open in IMG/M
3300021074|Ga0194044_10340462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15565Open in IMG/M
3300021349|Ga0194052_1109051All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15986Open in IMG/M
3300021520|Ga0194053_10311575All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15607Open in IMG/M
3300021602|Ga0194060_10514377All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15562Open in IMG/M
3300021605|Ga0194054_10084386All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151117Open in IMG/M
3300022555|Ga0212088_10145836All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152013Open in IMG/M
3300022555|Ga0212088_10679369All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15617Open in IMG/M
3300023090|Ga0224558_1011352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-155337Open in IMG/M
3300023090|Ga0224558_1020582All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153359Open in IMG/M
3300023090|Ga0224558_1029461All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152548Open in IMG/M
3300023091|Ga0224559_1245217All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15607Open in IMG/M
3300025162|Ga0209083_1018954All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153517Open in IMG/M
3300025316|Ga0209697_10273892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15896Open in IMG/M
3300025576|Ga0208820_1041044All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151348Open in IMG/M
3300025708|Ga0209201_1000039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15203794Open in IMG/M
3300027432|Ga0209421_1083593All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15648Open in IMG/M
3300028804|Ga0268298_10178278All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151177Open in IMG/M
3300028868|Ga0302163_10196083All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15557Open in IMG/M
3300029798|Ga0239581_1055086All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15885Open in IMG/M
3300029817|Ga0247275_1138656All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15620Open in IMG/M
3300029990|Ga0311336_10444228All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151093Open in IMG/M
3300030114|Ga0311333_11636401All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15557Open in IMG/M
3300031873|Ga0315297_11012338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15687Open in IMG/M
3300031902|Ga0302322_102229420All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15674Open in IMG/M
3300031997|Ga0315278_10162306All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152288Open in IMG/M
3300031999|Ga0315274_10299332All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151922Open in IMG/M
3300032118|Ga0315277_10287663All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151737Open in IMG/M
3300032118|Ga0315277_10771306All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15913Open in IMG/M
3300032156|Ga0315295_11262425All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15722Open in IMG/M
3300032160|Ga0311301_13045079All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15502Open in IMG/M
3300032164|Ga0315283_11462393All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15701Open in IMG/M
3300032173|Ga0315268_10458393All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151253Open in IMG/M
3300032173|Ga0315268_12566213All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15523Open in IMG/M
3300032256|Ga0315271_10059292All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152795Open in IMG/M
3300032275|Ga0315270_10158490All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151366Open in IMG/M
3300032397|Ga0315287_11074592All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15933Open in IMG/M
3300032401|Ga0315275_10806746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151040Open in IMG/M
3300032770|Ga0335085_10449011All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151484Open in IMG/M
3300032782|Ga0335082_10259838All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151617Open in IMG/M
3300032783|Ga0335079_10584442All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151180Open in IMG/M
3300032805|Ga0335078_11618711All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15716Open in IMG/M
3300032828|Ga0335080_10091280All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153378Open in IMG/M
3300032828|Ga0335080_10479492All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151323Open in IMG/M
3300032829|Ga0335070_10808727All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15872Open in IMG/M
3300032892|Ga0335081_10266989All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152295Open in IMG/M
3300032892|Ga0335081_11000916All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15974Open in IMG/M
3300032893|Ga0335069_10098589All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153696Open in IMG/M
3300032893|Ga0335069_10205127All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-152399Open in IMG/M
3300032893|Ga0335069_10792229All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151069Open in IMG/M
3300032893|Ga0335069_11617225All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15694Open in IMG/M
3300032897|Ga0335071_10555360All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151100Open in IMG/M
3300032897|Ga0335071_10880407All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15843Open in IMG/M
3300032897|Ga0335071_11272973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15680Open in IMG/M
3300032897|Ga0335071_11746082All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15566Open in IMG/M
3300032954|Ga0335083_11085798All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15626Open in IMG/M
3300032955|Ga0335076_10531683All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151059Open in IMG/M
3300032955|Ga0335076_10968447All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15733Open in IMG/M
3300033004|Ga0335084_11193862All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15761Open in IMG/M
3300033233|Ga0334722_10213470All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-151427Open in IMG/M
3300033402|Ga0326728_10923371All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15615Open in IMG/M
3300033561|Ga0371490_1079597All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15903Open in IMG/M
3300033823|Ga0334837_014141All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-153318Open in IMG/M
3300034125|Ga0370484_0086601All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15809Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland16.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil16.15%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment11.54%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.69%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater4.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.62%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion3.85%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.08%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.08%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.08%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge3.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.31%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.31%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.54%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.77%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.77%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil0.77%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.77%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.77%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.77%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.77%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.77%
BioreactorEngineered → Bioreactor → Unclassified → Unclassified → Unclassified → Bioreactor0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003154Anode biofilm microbial communities from J. Craig Venter Institute, USA, in microbial fuel cellsEngineeredOpen in IMG/M
3300003465Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sampleEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009669Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaGEngineeredOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020158Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6mEnvironmentalOpen in IMG/M
3300021074Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17mEnvironmentalOpen in IMG/M
3300021349Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-6mEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300021602Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5mEnvironmentalOpen in IMG/M
3300021605Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-10mEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025316Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025708Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)EngineeredOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028804Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP WeurtEngineeredOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300029798Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0052186_1014416123300003154BioreactorMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQ
P52013CM_1002911273300003465Ore Pile And Mine Drainage Contaminated SoilMNPRNLKLPVIIDLQPEPAAPILRLPGWMKYLFVLLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIAALNEQLMENRRNQNNYEQFKYRQRTVTRPGPLLGWLPSLVGRAQRAHYITLQQANDRVNVRLALEKAIADGVVQNPAPPSEYQIIQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0070713_10024425833300005436Corn, Switchgrass And Miscanthus RhizosphereDLQPEPDAPILRLPGWMKYLFILLYVCTLFGMGLLLKEGYAFFKLYQSKVQALRISETTTRKIATLNEQLMENRRTQNDYEQFKYRQRNVTRPGPLLGWLPTLVGRAQRAQFITLQQGSDRVNVRLTLEKAVADGVVQNPAPPADYQIIQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0070708_10054178623300005445Corn, Switchgrass And Miscanthus RhizosphereMNPRNCKLPVVIDLQPEPDAPILRLPGWMKYLFILLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIATLNEQLMENRRTQSNYEQFKYRQRNVTRPGPLLGWLPTLVGRAQRAQFITLQQGSDRVNVRLTLEKAVADGVVQNPAPPADYQIMQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0070716_10014028323300006173Corn, Switchgrass And Miscanthus RhizosphereMNPRNCKLPVVIDLQPEPDAPILRLPGWMKYLFILLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTRKIATLNEQLMENRRTQNDYEQFKYRQRNVTRPGPLLGWLPTLVGRAQRAQFITLQQGSDRVNVRLTLEKAVADSVVQNPAPPADYQIMQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0073936_1008088143300009175Freshwater Lake HypolimnionMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSAK
Ga0073936_1015151833300009175Freshwater Lake HypolimnionMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAAVAAQLKKP*
Ga0114951_1030619423300009502FreshwaterFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0114951_1033723413300009502FreshwaterMKPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPTN
Ga0129283_1003308633300009537Beach Aquifer PorewaterMNPRNLKLPVVIDLQPEPDAPVLRLPGWMKYLFILLYICTLFGMGLLLKEGYAFLKLYQLKVQALRISEATTREIATLNAQLMENRRAQSNYEQFKHRQRIVARPGPLLGWLPTLVGRSQRAHFITVQQANDRVNVRLTLEKAIADGVVQNPTPPSDYQVIQAGEETPKYQELPANQRPNPRNEYTAFAMQLKKQ*
Ga0116118_108733823300009637PeatlandPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0116122_108907123300009639PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0116126_104146633300009640PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADGVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAIAAQLKKP*
Ga0116121_120081513300009644PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQAYDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRP
Ga0116148_1000020663300009669Anaerobic Digestor SludgeMTSHQLKLPVIIDLQPEPEDAVLKLPGWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLLENRRTQNSYEQFKYRQRTIVRPGPLLDWLPTLVGRAQRAHFITVQPAADKVNLRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ*
Ga0116148_1002547173300009669Anaerobic Digestor SludgeMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0116216_1027841223300009698Peatlands SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPP
Ga0116217_1021938623300009700Peatlands SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAGLNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0116134_111082313300009764PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLHICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0130016_1000041973300009868WastewaterMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0116247_1017567623300010352Anaerobic Digestor SludgeMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKMQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0136449_10072376223300010379Peatlands SoilMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRYIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0137380_1024411633300012206Vadose Zone SoilMNPRNLKLPVIIDLQPEPDAPLLRLPGWMKYLFVLLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIAALNEQLMENRRTQNNYEQFKYRQRTVTRPGPLLGWLPTLVGRAQRAHYITLQQANDRVNVRLTLEKAIAESVVQNPTPPSDYQIIQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0137381_1011638033300012207Vadose Zone SoilMNPRNLKLPVIIDLQPEPDAPLLRLPGWMKYLFVLLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIAALNEQLMENRRTQNNYEQFKYRQRTVTRPGPLLGWLPTLVGRAQRAHYITLQQANDRVNVRLTLEKAIAESVLQNPTPPSDYQIIQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0137367_1087334523300012353Vadose Zone SoilWMKYLFVLLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIAALNEQLMENRRTQNNYEQFKYRQRTVTRPGPLLGWLPTLVGRAQRAHYITLQQANDRVNVRLTLEKAIAESVVQNPTPPSDYQIIQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ*
Ga0154020_1034130433300012956Active SludgeKLPVIIDLQPEPDAPLLRLPGWMKYLFILLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIATLNEQLMENRRTQHNYEQFKYRQRTVPRPGPLLGWLPALVGRAQRAHYITLQPANDRVNVRLALEKAIADGVVQNPAPPSDYQIIQAGEETPKYQELPANQRPNPKNEYTAFAIQLKKQ*
Ga0181539_106544333300014151BogMTPHHLKLPVIIDLQPEPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAQFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0181533_113318423300014152BogMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAQFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0181527_103218413300014153BogMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQ
Ga0181527_106589713300014153BogMNPHHLKLPVIIDLQPEPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAQFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0181518_1009826113300014156BogMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAQFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFA
Ga0181521_1021022023300014158BogMNPHHLKLPVIIDLQPEPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAQFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAIAAQLKKP*
Ga0181530_1004786723300014159BogMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADGVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAIAAQLKKP*
Ga0181517_1010599823300014160BogMNPHHLKLPVIIDLQPEPENAIPRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0181529_1037994813300014161BogMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0181538_1022721513300014162BogMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0182014_1007877823300014491BogMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQASRDIAALNQTLVENRRTQNSYEQFKYRQRTVARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP*
Ga0182017_1007298133300014494FenMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPANQRPSAKNEYAAVAAQLKKP*
Ga0182021_1224255023300014502FenMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLNEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIKNPAPPPDYQIVQSGEETPKYQELPTNQRPS
Ga0187856_110524223300017925PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187853_1016254623300017940PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187879_1009157533300017946PeatlandMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMDLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187780_1075184813300017973Tropical PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPP
Ga0187888_115049823300018008PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYA
Ga0187880_102473643300018016PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187872_1028767523300018017PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPS
Ga0187861_1037775623300018020PeatlandYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187882_121928313300018021PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAIAAQLKKP
Ga0187864_1003443633300018022PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAIAAQLKKP
Ga0187881_1005466023300018024PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAAVAAQLKKP
Ga0187857_1013304523300018026PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLHIYTLFGLGLLLKEGYGFFQLYQLKVQALRTSEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPALVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187869_1007275223300018030PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187867_1013207423300018033PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187863_1073298613300018034PeatlandYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFVSLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187883_1025485513300018037PeatlandMNPHHLKLPVIIDLQPEPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187855_1005358523300018038PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187862_1031074823300018040PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187871_1013788113300018042PeatlandILLYICTLFGMGLLLKEGYGFFKLYQQKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187887_1003587933300018043PeatlandMNPHHLKLPVIIDLQPEPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLFGRAQRAQFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187890_1013679033300018044PeatlandYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAGLNQTLVENRHTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187858_1008613133300018057PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQAYDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKK
Ga0187766_1136376913300018058Tropical PeatlandMNSRHLKLPVIIDLQAEPETAILRLPGWMKYLFLLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAVEQATRDITALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAVADGVIQNPAAP
Ga0187772_1039107823300018085Tropical PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187769_1046743723300018086Tropical PeatlandMNPFTKKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0187852_102294343300019082PeatlandMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0194038_110246123300020158Anoxic Zone FreshwaterPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTSEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0194044_1034046213300021074Anoxic Zone FreshwaterNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTRVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFA
Ga0194052_110905113300021349Anoxic Zone FreshwaterMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTSEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPK
Ga0194053_1031157513300021520Anoxic Zone FreshwaterMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNE
Ga0194060_1051437713300021602Anoxic Zone FreshwaterMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQ
Ga0194054_1008438613300021605Anoxic Zone FreshwaterMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELP
Ga0212088_1014583623300022555Freshwater Lake HypolimnionMNPHHLKLPVIIDLQPEPENAILRLPDWMKHLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0212088_1067936913300022555Freshwater Lake HypolimnionLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAAVAAQLKKP
Ga0224558_101135233300023090SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTSEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0224558_102058233300023090SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNERVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0224558_102946123300023090SoilMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAALAAQLKKP
Ga0224559_124521713300023091SoilDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0209083_101895423300025162FreshwaterMKPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0209697_1027389213300025316Freshwater Lake HypolimnionMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAAVAAQLKKP
Ga0208820_104104423300025576PeatlandMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAGQATRDIAALNQTLVENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADGVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAIAAQLKKP
Ga0209201_10000391093300025708Anaerobic Digestor SludgeMTSHQLKLPVIIDLQPEPEDAVLKLPGWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLLENRRTQNSYEQFKYRQRTIVRPGPLLDWLPTLVGRAQRAHFITVQPAADKVNLRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0209421_108359313300027432Forest SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAGLNQTLVENRHTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0268298_1017827813300028804Activated SludgeMNPRNLKLPVIIDLQPEPDAPLLRLPGWMKYLFVLLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTTREIAALNEQLMENRRNQNNYEQFKYRQRTVTRPGPLLGWLPALVGRAQRAHYITLQQANDRVNVRLALEKAIAEGVVQNPAPPSDYQIIQAGEETPKYQELPANQRPNPKNEYTAFAIQLKKQ
Ga0302163_1019608313300028868FenHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRAIARPGPLLDWVPTLVGRAQRAQFISLQQANDKVNVRITLEKAIADSVIQNPAPPADYQIIQSGEETPKYQELPTNQRPSPKNEYAAF
Ga0239581_105508613300029798Freshwater LakeMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAGLNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAF
Ga0247275_113865623300029817SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQI
Ga0311336_1044422813300029990FenMNPHHLKLPVIIDLQPEPENPILRLPHWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQQKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELP
Ga0311333_1163640113300030114FenHHLKLPVIIDLQPEPENPILRLPHWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQQKVQALRTAEQATRDIAALNQKLMEHRRTQNSYEQFKYRQRAIARPGPLLDWVPTLVGRAQRAQFISLQQANDKVNVRITLEKAIADSVIQNPAPPADYQIIQSGEETPKYQELPTNQRPSPKNEYAAF
Ga0315297_1101233813300031873SedimentMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0302322_10222942013300031902FenMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQQKVQALRTAEQATRDIAALNQKLMEHRRTQNSYEQFKYRQRAIARPGPLLDWVPTLVGRAQRAQFISLQQANDKVNVRITLEKAIADSVIQNPAPPADYQIIQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0315278_1016230613300031997SedimentMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPD
Ga0315274_1029933223300031999SedimentMNQRNLRLPVIIDLQPEPDAPILRLPSWMRYLFVLLYICTLFGMGLLLKEGYVFFKLYQLKVQALRISEATTRDIAALNGTLLENRRAQNNYEQFRHRQRIIPRPGPLLGWLPTLVGRAQRAHYVTLQQVNERVNVRLTLEKAIAEGVVQNPTPPADYQIVQAGEETPKYQELPANQRPNPRNEYTAFAMQLKKQ
Ga0315277_1028766323300032118SedimentMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLERAIADSVVQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0315277_1077130623300032118SedimentTNLNMNPRNLKLPVIIDLQPEPDTPILRLPGWMKYLFILLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISEATTRDIAALNAQLMENRRAQNNYEQFKHRQRLVARPGPLLAWLPSLVGRSQRAHFITLQQANDRVNVRLTLEKAIADGVGQNPAPPADYQVIQAGEETPKYQELPVNQRPNPKNEYTAFAVQLKKQ
Ga0315295_1126242523300032156SedimentMNQRNLRLPVIIDLQPEPDAPILRLPSWMRYLFVLLYICTLFGMGLLLKEGYAFFKLYQLKVQALRISEATTRDIAALNGTLMENRRAQNNYEQFRHRQRIIPRPGPLLGWLPTLVGRAQRAHYVTLQQVNERVNVRLTLEKAIAEGVVQNPTPPADYQIVQAGEETPKYQ
Ga0311301_1304507913300032160Peatlands SoilPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNE
Ga0315283_1146239313300032164SedimentMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSG
Ga0315268_1045839333300032173SedimentIIDLQPEPEAPILRLPSWMRYLFVLLYICTLFGMGLLLKEGYAFFKLYQLKVQALRISEATTRDIAALNGTLLENRRAQNNYEQFKHRQRIVPRPGPLLGWLPTLVGRAQRAHYVTLQQVNERVNVRLTLEKAIAEGVVQNPTPPADYQIVQAGEETPKYQELPANQRPNPRNEYTAFAMQLKKP
Ga0315268_1256621313300032173SedimentMNQRNLRLPVIIDLQPEPDAPILRLPSWMRYLFVLLYICTLFGMGLLLKEGYAFFKLYQLKVQALRISEATTRDIAALNGTLMENRRAQNNYEQFRHRQRIIPRPGPLLGWLPTLVGRAQRAHYVTLQQVNERVNVRLTLEKAIAEGVVQNPTPPADYQ
Ga0315271_1005929233300032256SedimentMNPRNLKLPVIIDLQPEPATPLLRLPGWMKYLFVLLYVCTLFGMGLLLKEGYAFFKLYQLKVQALRISETTAREIAALNEQLMENRRNQNNYEQFKYRQRTVTRPGPLLGWLPSLVGRAQRTHYITLQQANDRVNVRLALEKAIADGVVQNPAPPSDYQIIQAGEETPKYQELPANQRPNPKNEYTAFAMQLKKQ
Ga0315271_1079423323300032256SedimentTLFGMGLLLKEGYAFFKLYQLKVQALRISEATTRDIAALNGTLMENRRAQNNYEQFRHRQRIIPRPGPLLGWLPTLVGRAQRAHYVTLQQVNERVNVRLTLEKAIAEGVVQNPTPPADYQIVQAGEETPKYQELPANQRPNPRNEYTAFAMQLKKQ
Ga0315270_1015849023300032275SedimentMKPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKK
Ga0315287_1107459223300032397SedimentMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYA
Ga0315275_1080674613300032401SedimentMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVLQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAF
Ga0335085_1044901123300032770SoilMNPQQPKLPIIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLFENRRTQNSYEQFKYRQRAIVRPGPLLDWLPALVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335082_1025983823300032782SoilMNPQQPKLPIIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLFENRRTQNSYEQFKYRQRAIVRPGPLLDWLPTLVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335079_1058444223300032783SoilMNSRHLKLPVIVDLQPEPETAILRLPGWMKYLFFLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDISALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYQVVQSGEETPKYQELPTNQRPSPKNEYAALAVQLKKQ
Ga0335078_1161871123300032805SoilMNSRHLKLPVIIDLQPEPEAAILRLPGWMKYLFLLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAALAVQLKKQ
Ga0335080_1009128053300032828SoilIIDLQPEPETAILRLPDWMKYLFLLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYQVVQSGEETPKYQELPTNQRPSPKNEYAALAVQLKKQ
Ga0335080_1047949223300032828SoilMNPQQPKLPIIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLFENRRTQNSYEQFKYRQRAIVRPGPLLDWLPALVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKY
Ga0335070_1080872723300032829SoilPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLLENRRTQNSYEQFKYRQRAIVRPGPLLDWLPTLVGRAQRAHFITVQPAADKVNLRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335081_1026698923300032892SoilMNPQQPKLPIIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLFENRRTQNSYEQFKYRQRAIVRPGPLLDWLPALVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQVVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335081_1100091623300032892SoilMNSRHLKLPVIIDLQAEPETAILRLPGWMKYLFLLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYEIVQSGEETPKYQELPTNQRPSPKNEYAAFAVQLKKQ
Ga0335069_1009858923300032893SoilMTSHQLKLPVIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLFENRHTQNSYEQFKYRQRAIVRPGPLLDWLPTLVGRAQRAHFITVQPAADKVNLRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335069_1020512713300032893SoilMNSRHLKLTVIVDLQPEPETAILRLPGWMKYLFFLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDISALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYQVVQSGEETPKYQELPTNQRPSPKNEYAALAVQLKKQ
Ga0335069_1079222923300032893SoilMNSRHLNLRVIIDLQPEPEAAILRLPGWMKYLFLLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDIAALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAALAVQLKKQ
Ga0335069_1161722523300032893SoilMNPNHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQL
Ga0335071_1055536023300032897SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPPPPPDYQIVQAGEETPKYQELPTNQRPSPKNEYAAFAAQ
Ga0335071_1088040713300032897SoilMNPQQPKLPIIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLLENRRTQNSYEQFKYRQRAIVRPGPLLDWLPALVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335071_1127297323300032897SoilLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLLENRRTQNSYEQFKYRQRAIVRPGPLLDWLPTLVGRAQRAHFITVQPAADKVNLRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335071_1174608213300032897SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPP
Ga0335083_1108579813300032954SoilMTSHQLKLPVIIDLQPEPEDAVLKLPDWMKYLFILLYICTLFGMGLLLKEGYGFLKLYQLKVQALRTAEQATRDIAALNQKLFENRRTQNSYEQFKYRQRAIVRPGPLLDWLPALVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0335076_1053168323300032955SoilMNPNHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0335076_1096844713300032955SoilMNSRHLKLPVIIDLQPEPETAILRLPGWMKYLFLLLYVCTLFGMGLLLKEGYGFFKLYQLKVQALRAAEQATRDISALNQKLVENRRTQNSYEQFKYRQRVIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVNVRITLEKAIADGVIQNPAAPPDYQVVQSGEETPKYQELPTNQRPSPKNEYAALAVQLKKQ
Ga0335084_1119386213300033004SoilMNPHHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGLGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRAIVRPGPLLDWLPALVGRAQRAHFITVQPAGDKVNVRLTLEKAIADSVIQNPTPPPDYQLVQSGEETPKYQELPANQRPSPKNEYAAFAAQLKKQ
Ga0334722_1021347023300033233SedimentMNPPHLKLPVIIDLQPEPENAILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0326728_1092337113300033402Peat SoilLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFISLQQANDKVSVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP
Ga0371490_107959713300033561Peat SoilMNPHHLKLPVIIDLQPAPENPILRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTAEQATRDIAALNQKLMENRRTQNSYEQFKYRQRAIARPGPLLNWLPTLVGRAQRAHFISLQQANDKVNVRVTLEKAIADSVIQNPAPPADYQIVQSGEETPKYQELPTNQRPSPKNEYAAFA
Ga0334837_014141_1153_17403300033823SoilMNPHHLKLPVIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQAQRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAAVAAQLKKP
Ga0370484_0086601_252_8093300034125Untreated Peat SoilIIDLQPEPENTVLRLPDWMKYLFILLYICTLFGMGLLLKEGYGFFKLYQLKVQALRTGEQATRDIAALNQKLVESRRTQNSYEQFKYRQRAIARPGPLLDWLPTLVGRAQRAHFVSLQQANDKVNVRVTLEKAIADSVVQNLAPPPDYQIVQSGEETPKYQELPTNQRPSAKNEYAAVAAQLKKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.