NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063129

Metagenome / Metatranscriptome Family F063129

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063129
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 39 residues
Representative Sequence MSMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLARG
Number of Associated Samples 96
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 86.92 %
% of genes near scaffold ends (potentially truncated) 13.85 %
% of genes from short scaffolds (< 2000 bps) 63.08 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.692 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(27.692 % of family members)
Environment Ontology (ENVO) Unclassified
(40.769 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(69.231 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF02954HTH_8 63.08
PF13590DUF4136 6.15
PF08281Sigma70_r4_2 3.85
PF00158Sigma54_activat 3.08
PF04542Sigma70_r2 2.31
PF07676PD40 1.54
PF13581HATPase_c_2 0.77
PF00072Response_reg 0.77
PF13185GAF_2 0.77
PF01594AI-2E_transport 0.77
PF00196GerE 0.77
PF13561adh_short_C2 0.77
PF13492GAF_3 0.77
PF12833HTH_18 0.77
PF00128Alpha-amylase 0.77
PF08299Bac_DnaA_C 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.31
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.31
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.31
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.31
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.77
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.77
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.77
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.77
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.77
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 0.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.69 %
UnclassifiedrootN/A12.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16937350All Organisms → cellular organisms → Bacteria2815Open in IMG/M
2170459005|F1BAP7Q01CTHH6All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1057158All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1027449All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300001593|JGI12635J15846_10068960All Organisms → cellular organisms → Bacteria2622Open in IMG/M
3300002245|JGIcombinedJ26739_100115033All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300004114|Ga0062593_100103601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2016Open in IMG/M
3300004157|Ga0062590_100012065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3680Open in IMG/M
3300004633|Ga0066395_10045157All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300004633|Ga0066395_10088354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1468Open in IMG/M
3300005163|Ga0066823_10012755All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300005293|Ga0065715_10930979All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005332|Ga0066388_102006158Not Available1037Open in IMG/M
3300005332|Ga0066388_104152335All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005332|Ga0066388_107366816All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005341|Ga0070691_10857762All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005356|Ga0070674_100385125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1142Open in IMG/M
3300005436|Ga0070713_100023507All Organisms → cellular organisms → Bacteria4784Open in IMG/M
3300005436|Ga0070713_100607218All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300005437|Ga0070710_10656670All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005439|Ga0070711_100025926Not Available3838Open in IMG/M
3300005439|Ga0070711_101201367All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005445|Ga0070708_101502657All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005471|Ga0070698_100018366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7362Open in IMG/M
3300005471|Ga0070698_100113435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2675Open in IMG/M
3300005542|Ga0070732_10027930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3203Open in IMG/M
3300005542|Ga0070732_10059630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2215Open in IMG/M
3300005602|Ga0070762_10014238All Organisms → cellular organisms → Bacteria4050Open in IMG/M
3300005610|Ga0070763_10069899All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300005718|Ga0068866_10079235All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300005764|Ga0066903_100464243All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300005764|Ga0066903_103623993Not Available831Open in IMG/M
3300005764|Ga0066903_107030983All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005844|Ga0068862_101858923Not Available612Open in IMG/M
3300005844|Ga0068862_102748527All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005921|Ga0070766_10161433All Organisms → cellular organisms → Bacteria1379Open in IMG/M
3300006041|Ga0075023_100307021All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300006050|Ga0075028_100045565All Organisms → cellular organisms → Bacteria2088Open in IMG/M
3300006163|Ga0070715_10129816All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300006163|Ga0070715_10189739All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300006163|Ga0070715_10498474Not Available697Open in IMG/M
3300006172|Ga0075018_10326862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae763Open in IMG/M
3300006174|Ga0075014_100110462All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300006175|Ga0070712_101088209All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300006176|Ga0070765_100535259All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300006176|Ga0070765_101674903Not Available597Open in IMG/M
3300006806|Ga0079220_11246273Not Available618Open in IMG/M
3300006854|Ga0075425_100956762All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300006871|Ga0075434_101151220All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300006893|Ga0073928_10794814Not Available654Open in IMG/M
3300007076|Ga0075435_100420731All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300010043|Ga0126380_10010289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4168Open in IMG/M
3300010048|Ga0126373_10007838All Organisms → cellular organisms → Bacteria8438Open in IMG/M
3300010048|Ga0126373_10249039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1747Open in IMG/M
3300010359|Ga0126376_10035307All Organisms → cellular organisms → Bacteria3424Open in IMG/M
3300010361|Ga0126378_11266187All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300010366|Ga0126379_11494237Not Available781Open in IMG/M
3300010398|Ga0126383_10587848All Organisms → cellular organisms → Bacteria1183Open in IMG/M
3300012958|Ga0164299_10477674All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300012984|Ga0164309_10321032All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300012984|Ga0164309_11276969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium620Open in IMG/M
3300017822|Ga0187802_10002293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 835382Open in IMG/M
3300017995|Ga0187816_10006038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4257Open in IMG/M
3300020579|Ga0210407_10239954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1411Open in IMG/M
3300020579|Ga0210407_10573088All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300020580|Ga0210403_10033447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4111Open in IMG/M
3300020580|Ga0210403_10152216All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300020581|Ga0210399_10136425All Organisms → cellular organisms → Bacteria2022Open in IMG/M
3300020581|Ga0210399_11175368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300020583|Ga0210401_10039076All Organisms → cellular organisms → Bacteria → Acidobacteria4504Open in IMG/M
3300020583|Ga0210401_10060944All Organisms → cellular organisms → Bacteria3554Open in IMG/M
3300020583|Ga0210401_10138248All Organisms → cellular organisms → Bacteria2279Open in IMG/M
3300020583|Ga0210401_11167457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300020583|Ga0210401_11556676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300021046|Ga0215015_10844019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300021088|Ga0210404_10003050All Organisms → cellular organisms → Bacteria6823Open in IMG/M
3300021088|Ga0210404_10331873All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300021168|Ga0210406_10090552All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300021168|Ga0210406_10137208All Organisms → cellular organisms → Bacteria2058Open in IMG/M
3300021168|Ga0210406_11033057All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300021170|Ga0210400_10320636All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300021170|Ga0210400_10758473Not Available796Open in IMG/M
3300021171|Ga0210405_10007331All Organisms → cellular organisms → Bacteria9705Open in IMG/M
3300021403|Ga0210397_10112956All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300021405|Ga0210387_10136951All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300021405|Ga0210387_11863417All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300021406|Ga0210386_10567038Not Available981Open in IMG/M
3300021407|Ga0210383_10416939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1158Open in IMG/M
3300021420|Ga0210394_10060654All Organisms → cellular organisms → Bacteria3288Open in IMG/M
3300021432|Ga0210384_10041548All Organisms → cellular organisms → Bacteria4219Open in IMG/M
3300021432|Ga0210384_10106601All Organisms → cellular organisms → Bacteria2513Open in IMG/M
3300021432|Ga0210384_10135371All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300021432|Ga0210384_10151280All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300021432|Ga0210384_10261274All Organisms → cellular organisms → Bacteria1558Open in IMG/M
3300021474|Ga0210390_10902465Not Available727Open in IMG/M
3300021478|Ga0210402_10236240All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300021479|Ga0210410_10212975All Organisms → cellular organisms → Bacteria1731Open in IMG/M
3300021559|Ga0210409_11542178Not Available540Open in IMG/M
3300022898|Ga0247745_1094444Not Available512Open in IMG/M
3300025320|Ga0209171_10009006All Organisms → cellular organisms → Bacteria9662Open in IMG/M
3300025899|Ga0207642_10306233All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300025936|Ga0207670_11672416Not Available541Open in IMG/M
3300026285|Ga0209438_1139624Not Available644Open in IMG/M
3300026374|Ga0257146_1002700All Organisms → cellular organisms → Bacteria2997Open in IMG/M
3300026984|Ga0208732_1008801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium822Open in IMG/M
3300027047|Ga0208730_1012610All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300027535|Ga0209734_1098494All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300027562|Ga0209735_1001392All Organisms → cellular organisms → Bacteria4186Open in IMG/M
3300027591|Ga0209733_1086923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium798Open in IMG/M
3300027727|Ga0209328_10089519All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300027842|Ga0209580_10040862All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300027855|Ga0209693_10007780All Organisms → cellular organisms → Bacteria → Acidobacteria4946Open in IMG/M
3300027855|Ga0209693_10009398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4565Open in IMG/M
3300027874|Ga0209465_10038154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2279Open in IMG/M
3300027884|Ga0209275_10009787All Organisms → cellular organisms → Bacteria4075Open in IMG/M
3300027889|Ga0209380_10074041All Organisms → cellular organisms → Bacteria1948Open in IMG/M
3300028906|Ga0308309_10202070All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300028906|Ga0308309_10506474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1044Open in IMG/M
3300029636|Ga0222749_10113807All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300031708|Ga0310686_116629567All Organisms → cellular organisms → Bacteria2100Open in IMG/M
3300031708|Ga0310686_117652562All Organisms → cellular organisms → Bacteria3444Open in IMG/M
3300031715|Ga0307476_10084263All Organisms → cellular organisms → Bacteria2223Open in IMG/M
3300031716|Ga0310813_10247893All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300031718|Ga0307474_10801078All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300031753|Ga0307477_10041832All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3147Open in IMG/M
3300031820|Ga0307473_11261634All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300032180|Ga0307471_100226480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1899Open in IMG/M
3300032770|Ga0335085_11517188All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300032782|Ga0335082_10013727All Organisms → cellular organisms → Bacteria → Acidobacteria8786Open in IMG/M
3300032893|Ga0335069_10127888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3174Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil27.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.08%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.31%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.54%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.54%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.77%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026984Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_014802102088090014SoilMSTILVFTRKWNACYRVLRYRNGFSFADSLRYSLWLARS
E41_085888802170459005Grass SoilMIXVFTRKWNACYRVLRHSNGFSFMESVRYGLWLART
AP72_2010_repI_A01DRAFT_105715813300000579Forest SoilMSMTLTLVRNWNAWYRVLRYRNGFSFAESLRYGLWLARG*
AP72_2010_repI_A10DRAFT_102744913300000651Forest SoilMTLTLVRNWNAWYRVLRYRNGFSFAESLRYGLWLARG*
JGI12635J15846_1006896053300001593Forest SoilMSMILVFTRKWKGCYRVLRHSNRFSFVESVRYGLWVARG*
JGIcombinedJ26739_10011503323300002245Forest SoilMILVFTRKWNACYHVLRHSNRFSFVESVRYGLWVARG*
Ga0062593_10010360113300004114SoilMSMILVLIRKWNACYRVLRHNNGFSFVESVRYGLWLARS*
Ga0062590_10001206553300004157SoilMSGMLVLLQKWNACYRVLRQRNSFGFVASIRFGLWLAQG*
Ga0066395_1004515723300004633Tropical Forest SoilMSINLSLLRKWNAWYRVLRYRNGFGFAESVRYGLWLARV*
Ga0066395_1008835423300004633Tropical Forest SoilMSMILTFSRKWNACYRVLRYRHGFSFMESLRYGVWLARG*
Ga0066823_1001275533300005163SoilMSVILVFTRKWTTWYGVLRYRNGFGFVESLRHGLWLARS*
Ga0065715_1093097913300005293Miscanthus RhizosphereMSLILVFTRKWNARYRVLRHRNRFSFVESVRYGLWLARG*
Ga0066388_10200615813300005332Tropical Forest SoilGGVMSINLSLLRKWNAWYRVLRYRNGFGFAESVRYGLWLARV*
Ga0066388_10415233523300005332Tropical Forest SoilMSMILTFSRKWNACYHVLRYRHGFSFMESLRYGMWLARG*
Ga0066388_10736681623300005332Tropical Forest SoilMSINLSLLRKWNGWYDVLRHRNGFSFVESVRYGLWLARTESTVR*
Ga0070691_1085776223300005341Corn, Switchgrass And Miscanthus RhizosphereMSGMLVLLQKWNACYRVLRHRNAFGLVASIRFGLWLAQG*
Ga0070674_10038512533300005356Miscanthus RhizosphereSAGGIMSGMLVLLQKWNACYRVLRQRNSFGFVASIRFGLWLAQG*
Ga0070713_10002350793300005436Corn, Switchgrass And Miscanthus RhizosphereMSGMLVLLQKWNACYRVLRHRNSFSFVASIRFGLWLVQG*
Ga0070713_10060721813300005436Corn, Switchgrass And Miscanthus RhizosphereMSMILVFTRKWNARYRVLRHRNRFSFVESVRYGLWLARG*
Ga0070710_1065667013300005437Corn, Switchgrass And Miscanthus RhizosphereMSMILVFTRKWNACYRVLRHRNRFSLVESVHYGLWLARG*
Ga0070711_10002592663300005439Corn, Switchgrass And Miscanthus RhizosphereMSMILVFTRKWNACYRVLRHHNKFRFVESLRYGLWLARG*
Ga0070711_10120136713300005439Corn, Switchgrass And Miscanthus RhizosphereMSVILVFTRKWTTWYGVLRYRNGFGFVESVRYGLWLARS*
Ga0070708_10150265713300005445Corn, Switchgrass And Miscanthus RhizosphereMSGMFVLFQKWNACYRLLRHRNSFSFVDSIRFGLWLAQG*
Ga0070698_10001836653300005471Corn, Switchgrass And Miscanthus RhizosphereMSMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLARG*
Ga0070698_10011343543300005471Corn, Switchgrass And Miscanthus RhizosphereMSGMLVLLQKWNACYRVLRHRNSFSFVDSIRFGLWLAEG*
Ga0070732_1002793053300005542Surface SoilMSMILVFTRKWNACYRVLRHRNRFSFVESARYGLWLARG*
Ga0070732_1005963013300005542Surface SoilMSMILVFTRKWSACYRVLLHSNRFSFVESVRYGLWLARG*
Ga0070762_1001423853300005602SoilMSMILVFTRKWNACYRVLRHRTRFGVVESVRYGLWLARG*
Ga0070763_1006989943300005610SoilMSMILVFTRKWNACYRVLRHRNRFRFVESVRYGLWLARG*
Ga0068866_1007923523300005718Miscanthus RhizosphereMILVFTRKWNARYRVLRHRNRFSFVESVRYGLWLARG*
Ga0066903_10046424323300005764Tropical Forest SoilMSMILVFTRKWNACFRVLRYGNGFSFVESVRYGLWLARG*
Ga0066903_10362399313300005764Tropical Forest SoilMSVEFYREDVMSMILTFSLKWNACYRVLRYRHGFSFMESLRYGVWLARG*
Ga0066903_10703098323300005764Tropical Forest SoilMSVEFYREDVMSMILTFSRKWNACYRVLRYRHGFSFMESLRYGVWLARG*
Ga0068862_10185892323300005844Switchgrass RhizosphereSMILVFTRKWNARYRVLRHRNRFSFVESVRYGLWLARG*
Ga0068862_10274852713300005844Switchgrass RhizosphereMILVFTRKWNARYRVLRHRNRFSFVESVRYGLWLA
Ga0070766_1016143323300005921SoilMILVFTRKWNACYRVLRHRNRFRFVESVRYGLWLARG*
Ga0075023_10030702113300006041WatershedsMILVFTRKWNACYRVLRHSNRFSFVESVRYGLWVARG*
Ga0075028_10004556523300006050WatershedsMSMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLARG*
Ga0070715_1012981613300006163Corn, Switchgrass And Miscanthus RhizosphereMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLARG*
Ga0070715_1018973923300006163Corn, Switchgrass And Miscanthus RhizosphereVMSMILVFTRKWNAGYRVLRHRNRFSFVESVRYGLWLARG*
Ga0070715_1049847423300006163Corn, Switchgrass And Miscanthus RhizosphereMSGMLDLLQKWNACYRVLRHRNSFSFADSIRFALWLAQG*
Ga0075018_1032686223300006172WatershedsMSMILVFTRKWNAGYRVLRHRNRFSFVESVRYGLWLARG*
Ga0075014_10011046223300006174WatershedsMILVFTRKWNACYRVLRHRNRFSFVDSVRYGLWLARG*
Ga0070712_10108820923300006175Corn, Switchgrass And Miscanthus RhizosphereMSMILLFTCKRNARYRVLRHRNRFSFVESVRYGLWLARG*
Ga0070765_10053525923300006176SoilMSMILVFTRKWNACYRVLRHSNRFSFVESVRYGLWMARG*
Ga0070765_10167490323300006176SoilSMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLARG*
Ga0079220_1124627323300006806Agricultural SoilKNLGLLRKWNGWYRVLRYRNGFSFVESVRYGLWLARTESAVR*
Ga0075425_10095676223300006854Populus RhizosphereMSKNLNLVRKWNGWYRVLRYRNGFSFVESVRYGLWLAR
Ga0075434_10115122023300006871Populus RhizosphereMSKNLNLVRKWNGWYRVLRYRNGFSFVESVRYGLWLARTESAVR*
Ga0073928_1079481413300006893Iron-Sulfur Acid SpringMSRILVFTRKWNACYRVLRRGNKFSFVKSVRYGLWLARG*
Ga0075435_10042073123300007076Populus RhizosphereMSKNLGLLRKWNGWYRVLRYRNGFSFVESVRYGLWLARTESAVR*
Ga0126380_1001028953300010043Tropical Forest SoilMSINLSLLRKWNAWYRVLRYRNGFGFAESVRYGLWLARA*
Ga0126373_10007838123300010048Tropical Forest SoilMTLNLLRKWNAWYRVLRYRNGFSFVESMRYGLWLARG*
Ga0126373_1024903923300010048Tropical Forest SoilMSTNLRLLRKWNEWYRVLRYRNGFGFVESVRYGLWLARADSAL*
Ga0126376_1003530733300010359Tropical Forest SoilMSSILVLMRKWNAFYRVLRHRKGFSFVDSLRHGLWLARS*
Ga0126378_1126618713300010361Tropical Forest SoilMSINLSLLRKWNAWYRVLRYRNGFGFAESVRYGLWLAR
Ga0126379_1149423713300010366Tropical Forest SoilFYREDVMSMILTFSRKWNACYRVLRYRHGFSFMESLRYGVWLARG*
Ga0126383_1058784823300010398Tropical Forest SoilMSINLSLLRKWNGWYDVLRHRNGFSFIESVRYGLWLARTESTVR*
Ga0164299_1047767413300012958SoilMILVFTRKWNARSRVLRHRNRFSFVESVRYGLWLARG*
Ga0164309_1032103213300012984SoilMILVFTRKWNACYHVLRHRNRFRFVESVRYGLWLARG*
Ga0164309_1127696923300012984SoilMSMILVFTRKWNAGYRVLRHRNRFSFVESVRYSLWLARG*
Ga0187802_1000229363300017822Freshwater SedimentMSEVLVLVRRWNACYRALRHSNGFSFTDSVSFGLWLARG
Ga0187816_1000603813300017995Freshwater SedimentMSEVLILVRKWNACYRVLRHSNGFSFTDSVSFGLWLARG
Ga0210407_1023995433300020579SoilMSMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLARG
Ga0210407_1057308813300020579SoilMSMILVFSRKWNACYRALRHRNRFSFVESVRYGLWLARG
Ga0210403_1003344753300020580SoilMSMILVFTRKWNACYRVLRHRNRFRFVESVRYGLWLARG
Ga0210403_1015221623300020580SoilMSMILVFTRKWNACYRVLRHRNRFSFVEFVRYGPWVARG
Ga0210399_1013642533300020581SoilMSMILVFTRKWNACYRVLRHCNRFSFVESVRYGLWLARG
Ga0210399_1117536823300020581SoilMSMILVFTRKWNVCYRVLRHRNRFSFVESMRYGLWLARG
Ga0210401_1003907623300020583SoilMSMILVFTREWNACYRVLRHHNKFSFVESVRYGLWLARG
Ga0210401_1006094423300020583SoilMSLILVFTRKWNACYRVLRHRNRFSFVESVRYGVWLARG
Ga0210401_1013824863300020583SoilGVMLMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLARS
Ga0210401_1116745723300020583SoilMSMILVFTRKWNACYRVLRHSNRFSFVESVRYGPWVARG
Ga0210401_1155667623300020583SoilMSRILVFTRMWNACYRVLRRGNKFSFVESVRYGLWLARG
Ga0215015_1084401923300021046SoilMSMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLAHS
Ga0210404_10003050103300021088SoilMSGILVFVRKWNACDRVLRYRNGFSFVDSVHCGLWLAHA
Ga0210404_1033187323300021088SoilMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLARG
Ga0210406_1009055253300021168SoilMSMILVFTRKWNACYRVLRHRNRLSFVESVRYGLWLARS
Ga0210406_1013720823300021168SoilMSMILVFSRKWNACYRVLRHRNRFSFVESVRYGLWLARG
Ga0210406_1103305723300021168SoilMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWVARG
Ga0210400_1032063623300021170SoilMSMILVFTRKWNACYRVLRHHYKFSFVESLRYGLWLTRG
Ga0210400_1075847313300021170SoilVMSMILVFTRKWNACYHVLRHRNRFSFVQSVRYGLWLARG
Ga0210405_1000733193300021171SoilMSMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLARS
Ga0210397_1011295663300021403SoilMSMILVFTRKWTACYRVLRHRNRLSFVESVRYGLWLARG
Ga0210387_1013695133300021405SoilMLMLLVFTRKWNACYRALRHHNKFSFVESLRYGLWLARG
Ga0210387_1186341713300021405SoilMILVFTRKWNACYRVLRHSNRFSFVESVRYGLWLARG
Ga0210386_1056703813300021406SoilMSMILVFTRKWNACYHVLRHRNRFSFVESVRYGLWLARG
Ga0210383_1041693923300021407SoilMSMILVFTRKWNACYRVLRHRNRFRFVESMRYGLWLARG
Ga0210394_1006065413300021420SoilMSMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLS
Ga0210384_1004154843300021432SoilMSMILVFTRKWNACYRVLRYRNRFSFVESVRYGLWLARG
Ga0210384_1010660123300021432SoilMSMILVFTRKWNACDRVLRHRNRLSFVEAVRYGLWLARG
Ga0210384_1013537143300021432SoilMILVFTRKWNACYRVLRHRNRFNFVESVRYGLWLARG
Ga0210384_1015128023300021432SoilMILVFTRKWNACYRVLRHSNRFSFVESVRYGPWVARG
Ga0210384_1026127423300021432SoilMILVFTRKWTACYRVLRHRNRLSFVESVRYGLWLARG
Ga0210390_1090246513300021474SoilMSMILVFTRKWNTCYHVLRHRNRFSFVESVRYGLWLARV
Ga0210402_1023624023300021478SoilMSMILVFTREWNACYRVLRHHNKFSFVESLRYGLWLARG
Ga0210410_1021297523300021479SoilMLMLLVFTRKWNACYRVLRHRNRLSFVESVRYGLWLARS
Ga0210409_1154217813300021559SoilGGVMSMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLARG
Ga0247745_109444423300022898SoilMILVLIRKWNACYRVLRHNNGFSFVESVRYGLWLARS
Ga0209171_1000900693300025320Iron-Sulfur Acid SpringMSGMLVFLQKWNACYRILRHRNAFSFVNSIRFGLWLAQG
Ga0207642_1030623323300025899Miscanthus RhizosphereMILVFTRKWNARYRVLRHRNRFSFVESVRYGLWLARG
Ga0207670_1167241613300025936Switchgrass RhizosphereMSGMFVLLQKWNACYRVLRHRNSFSFADSIRFGLWLAQ
Ga0209438_113962433300026285Grasslands SoilMSGMLVLLQKWSACYRVLRHRHAFSLVDSIRFGLWLAQ
Ga0257146_100270073300026374SoilMSGMLVLLKKWNACYRVLRHRNAFSFVDSIRFGLWLAQG
Ga0208732_100880123300026984Forest SoilMSMILVFTRKWNACYRVLRHSNRFSFVESVRYGLWLARG
Ga0208730_101261023300027047Forest SoilMILVFTRKWNACYRVPRHHNKFSFVESLRYGLWLARG
Ga0209734_109849413300027535Forest SoilMILVFTRKWNACYRVLRHRNRFSFVESVRYGLWLARG
Ga0209735_100139233300027562Forest SoilMSMILVFTRKWTACYRVLRHRNRFSFVESVRYGLWLARG
Ga0209733_108692323300027591Forest SoilMSMILVFTRKWNACYRVLRHSNRFSFVESVRYGLWVARG
Ga0209328_1008951923300027727Forest SoilMSMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLARA
Ga0209580_1004086233300027842Surface SoilMILVFTRKWNACYRVLRHRNRFSFVESARYGLWLARG
Ga0209693_1000778013300027855SoilMSMILVFPRKWNACYRVLRHRNRFRFVESVRYGLWLARG
Ga0209693_1000939833300027855SoilMSMILVFTRKWNACYRVLRHRNRLSFVESVRYGLWLARG
Ga0209465_1003815423300027874Tropical Forest SoilMSMILTFSRKWNACYRVLRYRHGFSFMESLRYGVWLARG
Ga0209275_1000978723300027884SoilMSMILVFTRKWNACYRVLRHRTRFGVVESVRYGLWLARG
Ga0209380_1007404123300027889SoilMSMILVFTRKWNACYRVLRHRNRFRFVEYVRYGLWLARG
Ga0308309_1020207023300028906SoilMSMILVFTRKWNACYRVLRHSNRFSFVESVRYGLWMARG
Ga0308309_1050647423300028906SoilMILVFTRKWKVCYRVLRHRNRFSFLASVRYGLWLARG
Ga0222749_1011380713300029636SoilMILVFTRKWNACDRVLRHRNRLSFVEAVRYGLWLARG
Ga0310686_11662956733300031708SoilMSIILVFTRKWNACYRVLRHHNRFSFVESVRYGLWLARG
Ga0310686_11765256213300031708SoilMSRILVFTRKWNACYRVLRRRNKFSFVESVRYGMWLARG
Ga0307476_1008426313300031715Hardwood Forest SoilMAMILVFTRKWNACYGVLRHRNRFSFVESVRYDLWLARG
Ga0310813_1024789313300031716SoilMSMILVLIRKWNACYRMLRHNNGFSFVESVRYGLWLARS
Ga0307474_1080107823300031718Hardwood Forest SoilMSMILVFTCKWNACYRVLRHRNRFSFVESVRYGVWLARG
Ga0307477_1004183223300031753Hardwood Forest SoilMSMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLSRG
Ga0307473_1126163413300031820Hardwood Forest SoilMILVFTRKWNACYRVLRYRNRFSFVESVRYGLWLARG
Ga0307471_10022648033300032180Hardwood Forest SoilMSMILVFTRKWNACYRVLRHHNKFSFVESLRYGLWLTRG
Ga0335085_1151718823300032770SoilMSVILVFTRKWTTWYGVLRYRNGFGFVESLRYGLWLARS
Ga0335082_1001372723300032782SoilMSVILVFTRKWTTWYGVLRYRNGFGFVESLRHGLWLARS
Ga0335069_1012788813300032893SoilMSEILKFSRRWILSYRVLRHHNGFSVVGSVRYGLWLARG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.