NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063291

Metagenome / Metatranscriptome Family F063291

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063291
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 87 residues
Representative Sequence VLVLILFRFVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLLQLVFILRPFARSGLSPLLVMAAHRSHHVD
Number of Associated Samples 86
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.65 %
% of genes near scaffold ends (potentially truncated) 62.02 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.674 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(66.667 % of family members)
Environment Ontology (ENVO) Unclassified
(83.721 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(69.767 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 62.14%    β-sheet: 0.00%    Coil/Unstructured: 37.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF13650Asp_protease_2 4.65
PF03732Retrotrans_gag 1.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.67 %
UnclassifiedrootN/A2.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005330|Ga0070690_100372790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1042Open in IMG/M
3300005347|Ga0070668_100563857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii992Open in IMG/M
3300005842|Ga0068858_102159907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii550Open in IMG/M
3300005843|Ga0068860_102777958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii508Open in IMG/M
3300005844|Ga0068862_100365708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1341Open in IMG/M
3300005844|Ga0068862_101288789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii731Open in IMG/M
3300009101|Ga0105247_10998413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii653Open in IMG/M
3300009177|Ga0105248_11215461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii852Open in IMG/M
3300009972|Ga0105137_106260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii601Open in IMG/M
3300009975|Ga0105129_118430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii531Open in IMG/M
3300009976|Ga0105128_103668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii851Open in IMG/M
3300009976|Ga0105128_115398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii568Open in IMG/M
3300009977|Ga0105141_109031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii857Open in IMG/M
3300009980|Ga0105135_106266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii815Open in IMG/M
3300009980|Ga0105135_107456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii778Open in IMG/M
3300009980|Ga0105135_109811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii720Open in IMG/M
3300009981|Ga0105133_101903All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1089Open in IMG/M
3300009989|Ga0105131_109713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii812Open in IMG/M
3300009990|Ga0105132_106133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii899Open in IMG/M
3300009992|Ga0105120_1036792All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii595Open in IMG/M
3300009992|Ga0105120_1045006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii551Open in IMG/M
3300009995|Ga0105139_1055388All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii707Open in IMG/M
3300010371|Ga0134125_10571235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1251Open in IMG/M
3300010371|Ga0134125_11702922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii686Open in IMG/M
3300010396|Ga0134126_11646995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii705Open in IMG/M
3300010396|Ga0134126_12713500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii537Open in IMG/M
3300010399|Ga0134127_13257295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii531Open in IMG/M
3300010401|Ga0134121_11183820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii763Open in IMG/M
3300010403|Ga0134123_13103354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii533Open in IMG/M
3300013306|Ga0163162_11155513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii878Open in IMG/M
3300014325|Ga0163163_12562068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii568Open in IMG/M
3300014326|Ga0157380_11546815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii717Open in IMG/M
3300015270|Ga0182183_1054134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii604Open in IMG/M
3300015273|Ga0182102_1002882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1016Open in IMG/M
3300015284|Ga0182101_1023785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii802Open in IMG/M
3300015284|Ga0182101_1034971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii714Open in IMG/M
3300015290|Ga0182105_1025800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii809Open in IMG/M
3300015290|Ga0182105_1063451All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii608Open in IMG/M
3300015293|Ga0182103_1029031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300015297|Ga0182104_1016282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii968Open in IMG/M
3300015297|Ga0182104_1031951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii790Open in IMG/M
3300015297|Ga0182104_1036526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii758Open in IMG/M
3300015297|Ga0182104_1097848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii543Open in IMG/M
3300015310|Ga0182162_1016941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii998Open in IMG/M
3300015310|Ga0182162_1040798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii760Open in IMG/M
3300015310|Ga0182162_1048123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii720Open in IMG/M
3300015310|Ga0182162_1084445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii591Open in IMG/M
3300015311|Ga0182182_1049299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii694Open in IMG/M
3300015312|Ga0182168_1028671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii881Open in IMG/M
3300015312|Ga0182168_1081445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii617Open in IMG/M
3300015312|Ga0182168_1106892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii555Open in IMG/M
3300015313|Ga0182164_1056058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii704Open in IMG/M
3300015313|Ga0182164_1075350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii634Open in IMG/M
3300015315|Ga0182120_1085098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii610Open in IMG/M
3300015315|Ga0182120_1093418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii589Open in IMG/M
3300015316|Ga0182121_1098058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii593Open in IMG/M
3300015316|Ga0182121_1100606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii587Open in IMG/M
3300015317|Ga0182136_1054555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii718Open in IMG/M
3300015320|Ga0182165_1078638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii644Open in IMG/M
3300015325|Ga0182148_1072341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii656Open in IMG/M
3300015325|Ga0182148_1132400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii523Open in IMG/M
3300015327|Ga0182114_1106897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii599Open in IMG/M
3300015330|Ga0182152_1072460Not Available677Open in IMG/M
3300015330|Ga0182152_1148117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii512Open in IMG/M
3300015331|Ga0182131_1059141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii731Open in IMG/M
3300015332|Ga0182117_1156044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii522Open in IMG/M
3300015335|Ga0182116_1065806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii763Open in IMG/M
3300015335|Ga0182116_1120125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii600Open in IMG/M
3300015335|Ga0182116_1133263All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii574Open in IMG/M
3300015336|Ga0182150_1060623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii744Open in IMG/M
3300015336|Ga0182150_1127414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii562Open in IMG/M
3300015339|Ga0182149_1090785All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii659Open in IMG/M
3300015339|Ga0182149_1112590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii604Open in IMG/M
3300015340|Ga0182133_1097810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii671Open in IMG/M
3300015340|Ga0182133_1115082All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii628Open in IMG/M
3300015340|Ga0182133_1149422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii562Open in IMG/M
3300015340|Ga0182133_1171496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii528Open in IMG/M
3300015348|Ga0182115_1244536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii571Open in IMG/M
3300015349|Ga0182185_1165941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii661Open in IMG/M
3300015349|Ga0182185_1270835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii518Open in IMG/M
3300015350|Ga0182163_1263940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii539Open in IMG/M
3300015353|Ga0182179_1120914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii799Open in IMG/M
3300015353|Ga0182179_1126549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii783Open in IMG/M
3300015353|Ga0182179_1220845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii607Open in IMG/M
3300015353|Ga0182179_1222520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii605Open in IMG/M
3300015353|Ga0182179_1245175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii577Open in IMG/M
3300015353|Ga0182179_1313856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii511Open in IMG/M
3300015354|Ga0182167_1262921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii620Open in IMG/M
3300017408|Ga0182197_1103436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii583Open in IMG/M
3300017412|Ga0182199_1069576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii760Open in IMG/M
3300017412|Ga0182199_1166028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii547Open in IMG/M
3300017432|Ga0182196_1065927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii678Open in IMG/M
3300017432|Ga0182196_1138590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii525Open in IMG/M
3300017432|Ga0182196_1142775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii519Open in IMG/M
3300017435|Ga0182194_1087923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii621Open in IMG/M
3300017440|Ga0182214_1084352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii665Open in IMG/M
3300017440|Ga0182214_1089272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii649Open in IMG/M
3300017694|Ga0182211_1103339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii668Open in IMG/M
3300017694|Ga0182211_1112337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii640Open in IMG/M
3300017694|Ga0182211_1155164Not Available545Open in IMG/M
3300025925|Ga0207650_11095948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii678Open in IMG/M
3300025931|Ga0207644_11533225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii559Open in IMG/M
3300026095|Ga0207676_11681942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii633Open in IMG/M
3300028064|Ga0268340_1006501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1153Open in IMG/M
3300028064|Ga0268340_1033237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii709Open in IMG/M
3300028150|Ga0268343_1011689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii604Open in IMG/M
3300028153|Ga0268320_1016292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii607Open in IMG/M
3300028153|Ga0268320_1026426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii525Open in IMG/M
3300028154|Ga0268341_1030758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii509Open in IMG/M
3300028256|Ga0268304_1013786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii525Open in IMG/M
3300028466|Ga0268321_110463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii520Open in IMG/M
3300032464|Ga0214492_1111196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii503Open in IMG/M
3300032466|Ga0214503_1250068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii548Open in IMG/M
3300032467|Ga0214488_1090256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii670Open in IMG/M
3300032469|Ga0214491_1068209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii859Open in IMG/M
3300032551|Ga0321339_1012882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1617Open in IMG/M
3300032593|Ga0321338_1203232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii712Open in IMG/M
3300032625|Ga0214501_1241275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii573Open in IMG/M
3300032697|Ga0214499_1249808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii547Open in IMG/M
3300032781|Ga0314742_1049062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii744Open in IMG/M
3300032791|Ga0314748_1088177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii656Open in IMG/M
3300032792|Ga0314744_1089264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii587Open in IMG/M
3300032917|Ga0314721_116696All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii782Open in IMG/M
3300032976|Ga0314752_1081382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii623Open in IMG/M
3300033531|Ga0314756_1063582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii646Open in IMG/M
3300033534|Ga0314757_1151405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii558Open in IMG/M
3300033536|Ga0314763_1023911Not Available928Open in IMG/M
3300033538|Ga0314755_1018297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1607Open in IMG/M
3300033542|Ga0314769_1307507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii532Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere66.67%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated10.85%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere6.20%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028150Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028256Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028466Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032917Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032976Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033534Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033536Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070690_10037279023300005330Switchgrass RhizosphereMVAYSLAPSQCPSRAVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARSGLSLLLVMAAH
Ga0070668_10056385723300005347Switchgrass RhizosphereMPVVAYSLAPSQCPSCAVLVLVFFRFASAAQVVLVLIFFQEPIRSWKLIADVTYLLFSHMLLFQLVFILRPLARSGLSPLLVMAAHRSHHVDLEC*
Ga0068858_10215990723300005842Switchgrass RhizosphereLVFLRFVSAAQLVLVLVLFQKPIRSWKLIADVTHLLFSHMPLFQLAFILRPFARSGLSPLLVMAAHGSHHVDLECQILALGSEV*
Ga0068860_10277795813300005843Switchgrass RhizosphereMPVVSYSLASPQRPPCAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVTAAHGSRH
Ga0068862_10036570833300005844Switchgrass RhizosphereMPMVAYSLAPSQRPSRAVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYFLFSHMLLLQLAFILRPFARSGLSLLLVMAAHRSHHVDLEC*
Ga0068862_10128878913300005844Switchgrass RhizosphereMLVLIFFRFISASQLVLVLVFFQKPIRSWKLIADVTHLLFGHMLLFQFAFILRPFARSGLSPLLVMAAHGS
Ga0105247_1099841313300009101Switchgrass RhizosphereMPVVACSLASPQCPSCAVLILILFRFVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMSLFQLVFILRPFARSGLSSLL
Ga0105248_1121546113300009177Switchgrass RhizosphereVLVLVFFRFASAAQVVLVLIFFQKPIRSWKLIADVTYLLFSHMLLFQLVFILRPLARSGLSPLLVMAAHRSHHVDVECQVLALEPEV*
Ga0105137_10626013300009972Switchgrass AssociatedVLVLIFFRFVSAAQLVLVLVLFQKPIRSWKLIADVTHLLFSHMLLFQLVFILRPLARSGLSPLLVMAAHGFHHVDLECQILALGPEV*
Ga0105129_11843013300009975Switchgrass AssociatedVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRLLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV
Ga0105128_10366813300009976Switchgrass AssociatedVLILVFFRFISAPQLVLVLVLFQKPIRSWKLITDVTHLFFSDMLLPWLVFILRPLARSGISILLVMAAHGSHHVDLERQILALGSEI*
Ga0105128_11539813300009976Switchgrass AssociatedMPVVAYSLSPPQRPPCAVLILLFFQFISAAQLVLILVFFQKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARSGLFPLLVAAAHGSRHV
Ga0105141_10903123300009977Switchgrass AssociatedMPVVVYSLTSPQHPPCAVLVLILFRFVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLFQLVSIMRPFARSGLSPLLV
Ga0105135_10626623300009980Switchgrass AssociatedMPVVAYSLAPPQHPPCTVLILLLFRFISVAQLVLILVFFKKPIGSWELIADVTHLLFSHMLLLQLVFIMRPFARNGLLPLLDTA
Ga0105135_10745613300009980Switchgrass AssociatedVLILIFFRFVSAAQLVLVLVLFQKPIRSCKLVADVTHLLFSHMPLFQLTFILRPFARSGLSPLFVMVAHGSHHVDLKCQILALGSEI*
Ga0105135_10981113300009980Switchgrass AssociatedVLVLVLFRFVSTAQLVLVLVFFQKPIRSWKLITDVTHLLFGHMLLFQFASILRPFARSGLSPLLVMAAHGSHHVDLECQILALGSES*
Ga0105133_10190313300009981Switchgrass AssociatedMLVLVLLRFVSATQLVLVLVLFQKPIRSWKLIADVTHLFFSNMLLLRLVFIMGPFARSGLYPLLVTAAHGPC
Ga0105131_10971323300009989Switchgrass AssociatedMVTYSLAPPQRPSCAVLVLVFFRFASAAQLVLVLVFFQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARNGLSLLLVMAAHMSHHVDLEC*
Ga0105132_10613313300009990Switchgrass AssociatedMVTYSLAPPQRPSCAVLVLVFFRFASAAQLVLVLVFFQEPIRSWELVADMTYLLFSHMLLFQLTFILRPFARSGLSLLLVMAAHRSRHVDLECQILALGSEI*
Ga0105120_103679213300009992Switchgrass AssociatedMPVVAYSLAPPQRPPYAVLILLFRFISAAHFVLILVFFQKLIGSWELIADVTHLFFSNMLLLRLVFILGPFARNGLLPLLYTAAGWVLPC*
Ga0105120_104500613300009992Switchgrass AssociatedVLVLVLFRFVSAAQLVLVLVLFQKPIRNWKLIADVTHLLFSHMPLFQLAFILRPFARSGLSPLLVMVAHRSHHVDLECQILALGSEV*
Ga0105139_105538813300009995Switchgrass AssociatedMPVVSYSLASPQRTPCAVLVLIFFRFIPATQLVLILVLFQKPIRSWELIADVTHLLLSHMLLFQLVFILGPFARSGLFPLLVTAAHGSR
Ga0134125_1057123523300010371Terrestrial SoilVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALG
Ga0134125_1170292213300010371Terrestrial SoilVLVLILFRFVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLLQLVFILRPFARSGLSPLLVMAAHRSHHVD
Ga0134126_1164699513300010396Terrestrial SoilMPVIAYSLAPPQRPPYAVLVLLLFRFISAAQLVLVLVFFQKPIGSRELVVDVTHLFFSNMLLLWLVFILGLFARSSLSPLLVT
Ga0134126_1271350013300010396Terrestrial SoilVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARSGLSLLLVMAAH
Ga0134127_1325729523300010399Terrestrial SoilVLVLLLFRFISAAQLVLILVFFKKPIGSWELIADVTHLFFSNMLLLRLVFILGSFARSSLSPLLVTAAHGSCHVNLEC*
Ga0134121_1118382013300010401Terrestrial SoilVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYLLFSHMLLLQLTFILRPFARSGLSLLLVMAAHRSHHVDLEC*
Ga0134123_1310335413300010403Terrestrial SoilMVTYSLAPPQRPSCAVLELVFFQFTSAAQLVLVLVFFQEPIRSWKLVADVTHLLFSHMLLFQLVFILRPFARSGLSPLLVMAVH
Ga0163162_1115551313300013306Switchgrass RhizosphereVLILVLLRFVSAAQLVLVLVLFQKQIRGWEVIADMTHLFFSNMLLLQLVFILRPFARSGLSPLLVMAAHRSHHVDLECQILALGPEV*
Ga0163163_1256206813300014325Switchgrass RhizosphereVLVLIFFRFASTAQVVLILVFLQKPIRSWKLIADVTYLLFSHMLLFQLVFILRPLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV*
Ga0157380_1154681513300014326Switchgrass RhizosphereMVTYSLAPPQRPSCAVLVLVFFRFASAAQLVLVLVFFQEPIRSWELVADMTYLLFSHMLLLQLAFNLRPFARSGLSLLLVMAAHRSHHVDLEC*
Ga0182183_105413413300015270Switchgrass PhyllosphereMLVLVLLRFVSATQLVLVLVLFQKPIRSWKLIADVTHLLFSHMLLFQLAFILRPFARSGLSPLLVMAAHGSHHVDLECQILALGSEV*
Ga0182102_100288223300015273Switchgrass PhyllosphereVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV*
Ga0182101_102378513300015284Switchgrass PhyllosphereVLVLVFFRFASAAQVVLVLIFFQEPIRSWELVADMTYLLFSHMLLFQLTFILRPFARSGLSLLLVMAAHRSRHVDLEC*
Ga0182101_103497113300015284Switchgrass PhyllosphereMLILLLFRFISAAQLVLILVFLQKPIGSWELIADVTHLFFGNMLLLQLVFILGPFARSGLFPLLNTAAHGSRHVDLER
Ga0182105_102580023300015290Switchgrass PhyllosphereMPVVAYSLAFPQRPPCAVLILLLFRFISAVQLVLILVFFQKPIGSWELIADVTHLLFSHMLLLWLVFILRPFARNGLFPLLDTAADGSCHVDLK
Ga0182105_106345113300015290Switchgrass PhyllosphereMPVVAHSLAPPQRSPRAVLVLLLFRFIPATQLVLILVFFKKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARIGLSKPMLVTAAYGSRHVNL
Ga0182103_102903133300015293Switchgrass PhyllospherePCAVLVLILFRFVSAAQLVLVLVLFQKPIRSWELIADVTHLLFSDMLSFQLVFILGPFARSGLSPLLVTAAHGSRHVDLEFQILALESEI*
Ga0182104_101628213300015297Switchgrass PhyllosphereVLVLIFFGFASAAQVVLILVFLQKPIRSRKLIADVTHLLFGHMLLFQLVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV*
Ga0182104_103195113300015297Switchgrass PhyllosphereMPVVVYTLAPPQRPPCAVLILLLFRFISAAQLVLILVFFQKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARIGLFPLFVTAAYGSHHVNPE
Ga0182104_103652613300015297Switchgrass PhyllosphereVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARSGLSLLLVMAAHRSHHVDLEC*
Ga0182104_109784813300015297Switchgrass PhyllosphereMLVLILFRFVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLFQLVFILRPFARSGLSPLLVMAAHGSHHVDL
Ga0182162_101694123300015310Switchgrass PhyllosphereVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARSGLSLLLVMAA
Ga0182162_104079813300015310Switchgrass PhyllosphereVLVLVFLRFVSAAQLVLVLVLFQKPIRSWKLIADVTHLLFSHMPLFQLAFILRPFARSGLSPLLVMAAHGSHHVDLECQ
Ga0182162_104812313300015310Switchgrass PhyllosphereVLVLIFFRFVSAAHLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLFHLVFILRPFARSGLSPLLVMAAHGSHHVDLECQILALG
Ga0182162_108444513300015310Switchgrass PhyllosphereMPVVAYSLAPPQRPPCAVLILLLFRFVSAAQLILILVFFHKPIGSWELIVDVTHLFFSNMLLLRLVFILGPFARSGLFPLLVTAAHGSRHV
Ga0182182_104929923300015311Switchgrass PhyllospherePPLRSPRAVLVLVLFRFTPATQLVLILVFFKKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARIGLSKPLLVTVAYGSRHVNLERKILALRSKI*
Ga0182168_102867113300015312Switchgrass PhyllosphereVLVLVFFRFASAAQVVLVLIFFLEPIRSRELVADMMYLLFSHMLLFQLSFILRPFARSGLSLLLVMAAHRSRHVDL
Ga0182168_108144513300015312Switchgrass PhyllosphereMPVVAHSLAPPQRSPRAVLVLLLFRFIPATQLVLILVFFKKPIGSWELIADVTHLFFSNMLLLRLIFILGPFARIGLFPLLVTAAYRSHHVNPER*
Ga0182168_110689213300015312Switchgrass PhyllosphereMPVVSYSLASPQRPPCAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGL
Ga0182164_105605813300015313Switchgrass PhyllosphereMVTYSLAPPQRPSCAVLVLVFFRFASAAQLVLVLVFFQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARSGLSLLLVMAAHRSHHVDLEC*
Ga0182164_107535013300015313Switchgrass PhyllosphereMPVVAYSLASPQCPSCAVLVLIFFRFVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLFQLAFILQPFARSGLSPLLIMAAHGSHHVDLECQILALGSEI*
Ga0182120_108509823300015315Switchgrass PhyllosphereEERAMPVVAYSLAPPQRPSCAVLVLIFFRLVSATQLVLALVLFQKLIRSWKLVADVMHLLFSHMLLFQFVFILWPFARNGLSPLLITAVHGSSHVDLECQILALGSEI*
Ga0182120_109341813300015315Switchgrass PhyllosphereMPVVAYSLAPPQRPPCAVLILLLFRFISAAQLVLILVFFQKPIGSWELIADVTHLFFSNMLLLRLVFTLGPFARSSLSPLLVTAVHGSCPVNLEC*
Ga0182121_109805813300015316Switchgrass PhyllosphereMPVVAYSLASPQCPSCAVLVLILFRLVSAAQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLLFQLVFILRPFARSGLSPLLVMVAHGSHHVDLECQILALGSEV*
Ga0182121_110060613300015316Switchgrass PhyllosphereMVAYSLAPSQRPSRAVLVLVFFRFASAAQLVLVLVFFQEPIRSWKLVADMTHLFFSHMLLLQLAFILRPFARSSLSLLLVMAAHRSHHVDLEC*
Ga0182136_105455513300015317Switchgrass PhyllosphereSATQLVLALVLFQKLIRSWKLVADVMHLLFSHMLLFQFVFILWPFARNGLSPLLITAVHGSRHVDLECQILALGSEI*
Ga0182165_107863813300015320Switchgrass PhyllosphereMLVLIFFRFISASQLVLVLVFFQKPIRSWKLIADVAHLLFSHVPLLQLTFILRPFARSGLSLLLVMAAHRSHHVDLEC*
Ga0182148_107234113300015325Switchgrass PhyllosphereMPVVAYSLAPPQRPSCAVLVLIFFRLVSATQLVLALVLFQKLIRSWKLVADVMHLLFSHMLLFQFVFILWPFARNGLSPLLITAVHGSSHVDLECQILALGSEI*
Ga0182148_113240023300015325Switchgrass PhyllosphereVLVLLFRFISAAQLVLVLVIFKKPIGSWELVADMTHLFFSDMLLLWLVFILGQFARSGLSPLLVTAAHGS
Ga0182114_110689713300015327Switchgrass PhyllosphereMLVVAYSLAPPQHPSCAVLVLIFFRLVSATQLVLALVLFQKLIRSWKLVADVMHLLFSHMLLFQFVFILWPFARNGLSPLLITAVHGSRHVDLECQILALGSEI*
Ga0182152_107246023300015330Switchgrass PhyllosphereLFRFVSAAQLVLVLVLFQKPIRSWELIADVMYLFFSNVLAFGLVFILGPFAGSGLFPLLDMAADGSRHVDLE*
Ga0182152_114811713300015330Switchgrass PhyllosphereVLVLVFFRFASAAQVVLVLIFFQEPIRSWKLIADVTYLLFSHMLLFQLVFILRPLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV*
Ga0182131_105914113300015331Switchgrass PhyllosphereVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRPLARSGLSPLLVMAAHRSHHVDLEC*
Ga0182117_115604413300015332Switchgrass PhyllosphereHARIPTVPEERAMPVVAYSLAPPQRSPRSVLVLLLFRFISAAQLVLILVFFQKPIGSWELIADVTHLFFSNMSLLRLVFILGPFARSGLFPLLVMAAHGSRHVDL*
Ga0182116_106580613300015335Switchgrass PhyllosphereQLVLVLFQKPIRSWKLIADVTYLLFSHMLLFQLVFILRPFARSGLSPLLVMAAHGSHHVDLECQVLALGSES*
Ga0182116_112012513300015335Switchgrass PhyllosphereMPVVAYSLAPSQLPPYAVLILLFRFISAAQLVLILVLFQKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARSGL
Ga0182116_113326313300015335Switchgrass PhyllosphereMPVVVYSLAPPQHSPRAVLVLLLFRFIPATQLVLILVFFKKPIRSWELIADVTHLFFSNMLLLRLVFILGPFARIGLSPLLATAAYGSRHVNLECKIL
Ga0182150_106062313300015336Switchgrass PhyllosphereMLVLVLLRFVSATQLVLVLVLSQKPIRSWKLIADVTHMIFSHMLLFQLAFILRPFARSGLSPLLVMAAHGSHHVDLECQILALGSEV*
Ga0182150_112741413300015336Switchgrass PhyllosphereVLILLLFRFISAAQLVLVLVLFQEPIGSWELVADVTHLFFSNMLLFWLIFILGPFARIGLSKPLLVMAAYGSRHVNLECKILALRSKI*
Ga0182149_109078513300015339Switchgrass PhyllosphereMPVVAHSLAPPQRSPRAVLVLLLFRFIPATQPVLILIFFKKPIGSWELIADVMHLFFSNMLLLRLIFILGPFARIGLSKPLLVTAAYGSRHVNPER*
Ga0182149_111259013300015339Switchgrass PhyllosphereAVQLVLVLVLFQKPIRSWKLVADVTHLLFSHMLMFQLVFILRPFARSGLSPLLVMAAHGSHHVDLECQTLALESEV*
Ga0182133_109781013300015340Switchgrass PhyllosphereMPVVAYSLASPQRSPCAVLILLLFRFISAAQLVLILVFFQKPIRSWELIADVAHIFFSNMLLLRLILILGPFARNGLSSLLVTTAYRPRH
Ga0182133_111508213300015340Switchgrass PhyllosphereVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALGP
Ga0182133_114942223300015340Switchgrass PhyllosphereMPVVTYSLAPPQRPPCAVLIFLLFRFISAAQLVLILVFFQKPIGSWELIADVMHLFFSNMLLLRLVFILGPFARSG
Ga0182133_117149613300015340Switchgrass PhyllosphereMITYGLPSPQRPPHAVLILLLFRFISAAQLVLILVFFQKPIGSWELIADVTHLFFSNRLLLRLMFILGLFARSGLFPLL
Ga0182115_124453613300015348Switchgrass PhyllosphereVLVLVFFRFVSAVQLILVLVLFQESIRSWKPVADVTHLLFSHMLLVQLAFILRPFARSGLSLLLVMAA
Ga0182185_116594113300015349Switchgrass PhyllosphereMPVVAYSLASLQCPSCAVLILIFFRLVLAAQLVLILVLFQKPIRSWKLVADVTHLLFSHMSLFQLVFILRPFARSGLSPLLVMAAHGSHQVDLECQILDLGSEV*
Ga0182185_127083513300015349Switchgrass PhyllosphereVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRPLARSGLSPLLVMAAHRSHH
Ga0182163_126394023300015350Switchgrass PhyllosphereMPVVAYSLAPPQRSPRAVLVLLLFRFIPATQLVLILVFFKKPIGSWELIADVTHLLFRNMLLLRLVFILVPFSRIGLFP
Ga0182179_112091413300015353Switchgrass PhyllosphereMPVVAYSLVPPQRPSCAVLVLIFFRLVSATQLVLALVLFQKLIRSWKLVGDVMHLLFSHMLLFQFVFILWPFARNGLSPLLITAVHGSSHVDLECQILALGSEI*
Ga0182179_112654923300015353Switchgrass PhyllosphereVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLMFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALG
Ga0182179_122084513300015353Switchgrass PhyllosphereMLVVAYSLASPQRPPCAVLILILFRFVSATQLVLVLVLFQKPIRGWELIADVTHLLLNHMLLFQLMFILGPFARSSLFPLLVTAAH
Ga0182179_122252013300015353Switchgrass PhyllosphereAVLVLLLFRFIPAMQLVLILVFFKKPIGSWELIVDVTHLFFSNMLLLRLVFILGPFARIGLFPLLVTAAYGSHHVNPECKILDLRSKI*
Ga0182179_124517523300015353Switchgrass PhyllosphereMPVVAYSLAPPQRSPRAVLILRLFRLIPATQLVPILVFFKKPIRSWELIADVTHLFFSNMLLLRLIFILGPFARIGLFPLLVTAAYRSHHVNPER*
Ga0182179_131385613300015353Switchgrass PhyllosphereFRFVSAAQLVLVLLLFQKPIRSWKLIADVTHLLFSHILLFQFVFILRPFARSGLSPLFVTAAHRPRHVDLE*
Ga0182167_126292113300015354Switchgrass PhyllosphereMFVLIFFRFISASQLVLVLIFFQKPIRSWKLIADVAHLLFSHVPLLQLTFILRPFARSGLSLLFVMAAHRSHHVDLEY*
Ga0182197_110343613300017408Switchgrass PhyllosphereMPVVAYSLASPQRSPCAMLILFLFRFISAAQLVLILVFFQKPIGSWQLIVDVTHLFFSNMLLLRLVFILGPFARSGLFPL
Ga0182199_106957613300017412Switchgrass PhyllosphereVEAPSYTQDRVRHLSATQHVLVLVLFQKPIGSWKLVADVTHLLFSHVLLFQFVFILWPFARNGLSPLLITAVHGSSHVDLECQILALGSEI
Ga0182199_116602813300017412Switchgrass PhyllosphereMPVVAHSLAPPQRSPRAVLVLLFRFIPATQLVLILVFFKKPIGSWELIADVTHLFFSNMLLLLLVFILGPFARIGLFPPLI
Ga0182196_106592713300017432Switchgrass PhyllosphereMPVIAYSLASPQRPPCAVLVLIFFRFVSAAQLVLILVFFQKPIGSWELVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVMATHGSRHVDLECQ
Ga0182196_113859013300017432Switchgrass PhyllosphereMPVVSYSLASPQRPPCAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVTA
Ga0182196_114277513300017432Switchgrass PhyllosphereMPVVAYSLAPPQRSPRAVLVLRLFRLILATQLVPILVFFKKPIRSWELIADVTHLFFSNMLLLRLIFILGPFARIGLFP
Ga0182194_108792313300017435Switchgrass PhyllosphereMPVVAYSLAPPQRSPRAVLVLLLFRFILPTQLVLILVFFKKPIGSWELIADVMHLFFSNMLLLRLVYILGPFAKIGLSKPLLVTAAYGSRHVNLECKIL
Ga0182214_108435213300017440Switchgrass PhyllosphereMPVVSYSLASPQRSSCAVLILVFLRFVSAVQLVLVLVFFQKPIRSWKLIADVTHLLFSHMLLFQFAFILRPFARSGLSPLLVMAAHRSHHVDVEC
Ga0182214_108927213300017440Switchgrass PhyllosphereVLVLVFFRFASVAQLVLVLVFLQESIRSWELVVDMTYLLFSHMLLLQLAFIMRPFARSGLSLLLVMAAYRSHHVDLEC
Ga0182211_110333923300017694Switchgrass PhyllosphereMPVVSYSLASPQRPPCAVLILIFFQFIPAMQLVLILVFFQKPIRSQKLVADVTHLFFSDMLLLWLVFILGPFARSGISSLLVTAAHGSCHVNLEC
Ga0182211_111233713300017694Switchgrass PhyllosphereVVVFSLASPQCPSCAVLVLILFRFVSAAQLVLVLVFFQKPIGTWKLIADVTHLFFSDVLLFRVVFILRPFARNGLSPLLVMAAHRSHHVDLEC
Ga0182211_115516413300017694Switchgrass PhyllosphereMPVVSYSLASPQRPPCAVLVLIFFQFVSAARLVLILVFFQKPIRSWELIADVTHLLLSHMLLFQLVFILGPFARSGLFPLLDTVAHGSRHVDLECQVLALGSEI
Ga0207650_1109594813300025925Switchgrass RhizosphereMLVVAYSLAPPQHSPRAVLVLLLFRFIPATQLVLILVFFKKPIGSWELIADVTHLFFSNMLLLRLIFILGPFARIGLSKPLLVTAAYGSR
Ga0207644_1153322523300025931Switchgrass RhizosphereLASPQRPPYAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVTAAHGSRHVDLKRQILALRSKI
Ga0207676_1168194213300026095Switchgrass RhizosphereMPVVSYSLASPQRPPYAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVTAAH
Ga0268340_100650123300028064PhyllosphereVVSYSLASPQRPPCAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVMAVHGSR
Ga0268340_103323713300028064PhyllosphereVLVLVLFQKPIRSWKLVADVTHLLFSHMLLFQFVFILWPFARNGLSPLLITAVHGSRHVDLECQILALGSEI
Ga0268343_101168913300028150PhyllosphereMVTYSLAPPQRPSCAVLVLVFFRFVSAAQLVLVLVFFQEPIRSWELVADMTYLLFRHMLLLQLAFILRPFARSGLSLLLLMAA
Ga0268320_101629223300028153PhyllosphereVVAYSLASSQCPPCAVLILVFLRFVSAAQLVLVLVLFQKPIRSWKLITDVTHLLFSHMPLFQLAFILRPFARSGLSPLLVMAAHGSHHVDLECQILALGSEV
Ga0268320_102642623300028153PhyllosphereVLVLIFFRFVSAAHLVLVLVLFQKPIRSWKLVVDVMHLLFSHMLLFQLVFILWPFARSGLSPLLVMAV
Ga0268341_103075813300028154PhyllosphereMPVVSYSLASPQHPPCAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVTAAHGSRH
Ga0268304_101378613300028256PhyllosphereYAVLILIFFQFIPATQLVLILVFFQKPIRSRKLVADVTHLFFSDMLLLWLVFILGPFARSGLSPLLVTAAHGSRHVDLKSQILALRSKIR
Ga0268321_11046313300028466PhyllosphereMPVVAHSLAPPQHSPRAVLVLLLFRFVPATQLVLILIFFKKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARIGLSKPLLV
Ga0214492_111119613300032464Switchgrass PhyllospherePSHAVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGYMLLFQIVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV
Ga0214503_125006823300032466Switchgrass PhyllosphereFRFASAAQLVLVLVFFQEPIRSWELVADMTYLLFSHMLLLQLAFILRPFARNGLSPLLVMAAHRSHHVDLEC
Ga0214488_109025623300032467Switchgrass PhyllosphereMPVVAYSLASPQCPSCVVLVLILFRFVSAAQLVLVLVLFQKPIRSWKLIADVTHLLFSHMLLFQLVFILRPFARSGLSPLLVMAAHGSHHVDLECQILALGSEV
Ga0214491_106820923300032469Switchgrass PhyllosphereVVSYSLAPSQRPSHAVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGYMLLFQIVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALGPEV
Ga0321339_101288223300032551Switchgrass PhyllosphereVVSYSLAPSQRPSHAVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGYMLLFQIVFLLRPLARSGLSPLLVMAAHRSHHVDVECQVLALGHEV
Ga0321338_120323223300032593Switchgrass PhyllosphereMPVVAYSLAPPQRLPCTVLILLLFRVMSAEQLVLILVFFQKPIGSWELIADVTNLFFSNMLLLRLVFILGPFARSG
Ga0214501_124127513300032625Switchgrass PhyllosphereMVAYSLAPSQRPSRAALVLVFFRFASAAQPVLVLVFFQEPIRSWELVADMTYLLFSHMLLFQLSFILRPFARSGLSLLLVMAA
Ga0214499_124980813300032697Switchgrass PhyllosphereMPVVAYSLAPPQRPPYAVLILLFRFISEAQLVLILVFFQKPIGSWELIADVMHLFFSNMLLLRLLFILGPFARSGLSPLLVTAAHG
Ga0314742_104906213300032781Switchgrass PhyllosphereVVAYSLAPSQRPSRAVLVLVFFRFALAAQVVLVLVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFFLRPLARSGLSPLLAMAAHRSHHVDVECQVLAVGPEV
Ga0314748_108817723300032791Switchgrass PhyllosphereMVAYSLAPSQRPSRAVLVLVFFRFASAAQLVLVLVFLQEPIRSWELVADMTYLLFSHMLLFQLAFILGPLARSGRSPLLVMAAHRSHYVDVECQVL
Ga0314744_108926413300032792Switchgrass PhyllosphereMPVVAYSLAPSQRPSRAVLVLAFFRFASAAQVVLVLIFFQEPIRSWKLIADMTYLLFSHMLLFQLAFILGPLARSGRSPLLVMAAHRSHHVDVECQVLALGPEV
Ga0314721_11669613300032917Switchgrass PhyllosphereMSVVAYSLAPPQRSPRAVLVLLFRFIPATQVVLILVFFKKPIGSWELIADMAHLFFSNMLLLRLVFILGPFARIGLFPLLVTAA
Ga0314752_108138223300032976Switchgrass PhyllosphereAPSQRPSRAVLVLVFFRFASAAQVVLILVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRTLARSGLSPLLVMAAHRSHHVDVERQVLALGPEV
Ga0314756_106358223300033531Switchgrass PhyllosphereMSVVAYSLAPPQRSPRAVLVLLFRFIPATQLVLILIFFKKPIGSWELIADVTHLFFSNMLLLRLVFILGPFARIGLSKPLLVTAAYGSH
Ga0314757_115140513300033534Switchgrass PhyllosphereMPVVSYSLASPQRPPCAVLVLILFRFVSVAQLVLILVFFQKPIRSWELIADVTHLLFSHMLLLRLVFILGPFARSGLFPLFVTAAHGSRHVN
Ga0314763_102391123300033536Switchgrass PhyllosphereVFLQKPIRSWKLIADVTHLLFGHMLLFQLVFLLRTLARSGLSPLLVMAAHRSHHVDVECEVLALRPEV
Ga0314755_101829713300033538Switchgrass PhyllosphereSVSQLVLVLVLLQKPIRSWKLVADVTHLLFSHMLLLQLVFILRPFARNGLSPLLVMAAHGSHHVDLEYQILAHGSEV
Ga0314769_130750723300033542Switchgrass PhyllosphereVVAYSLAPPQRPPCAVLILLLFRFISAAQLVLILVFFQKPIGSWELVADVTHLFFSDMLLLWLVFILRPFAKSGLFPLLDTAADGSC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.