NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F063325

Metatranscriptome Family F063325

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063325
Family Type Metatranscriptome
Number of Sequences 129
Average Sequence Length 81 residues
Representative Sequence VSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHY
Number of Associated Samples 120
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 99.22 %
% of genes near scaffold ends (potentially truncated) 98.45 %
% of genes from short scaffolds (< 2000 bps) 99.22 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.225 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(39.535 % of family members)
Environment Ontology (ENVO) Unclassified
(58.915 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.271 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.04%    β-sheet: 5.49%    Coil/Unstructured: 38.46%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00237Ribosomal_L22 2.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0091Ribosomal protein L22Translation, ribosomal structure and biogenesis [J] 2.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.22 %
UnclassifiedrootN/A0.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003701|Ga0005233J53080_1036503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae787Open in IMG/M
3300008550|Ga0103924_14476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae518Open in IMG/M
3300008832|Ga0103951_10422995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae712Open in IMG/M
3300009216|Ga0103842_1015315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae727Open in IMG/M
3300009269|Ga0103876_1028526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae713Open in IMG/M
3300009356|Ga0103835_1012863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae601Open in IMG/M
3300009677|Ga0115104_10042528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae569Open in IMG/M
3300009677|Ga0115104_11145945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae512Open in IMG/M
3300009679|Ga0115105_11139718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae671Open in IMG/M
3300010129|Ga0123376_1132285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae548Open in IMG/M
3300010987|Ga0138324_10288276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae783Open in IMG/M
3300018597|Ga0193035_1009953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae735Open in IMG/M
3300018616|Ga0193064_1014091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae709Open in IMG/M
3300018647|Ga0192913_1028299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300018711|Ga0193069_1025848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae674Open in IMG/M
3300018742|Ga0193138_1027381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae745Open in IMG/M
3300018743|Ga0193425_1030022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae740Open in IMG/M
3300018743|Ga0193425_1031733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae723Open in IMG/M
3300018746|Ga0193468_1031694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae783Open in IMG/M
3300018761|Ga0193063_1062096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae592Open in IMG/M
3300018766|Ga0193181_1028712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae796Open in IMG/M
3300018779|Ga0193149_1027157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae803Open in IMG/M
3300018779|Ga0193149_1028355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae786Open in IMG/M
3300018787|Ga0193124_1045369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae651Open in IMG/M
3300018796|Ga0193117_1049359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae708Open in IMG/M
3300018811|Ga0193183_1056009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae705Open in IMG/M
3300018812|Ga0192829_1077387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae627Open in IMG/M
3300018817|Ga0193187_1050791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae732Open in IMG/M
3300018825|Ga0193048_1035962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae748Open in IMG/M
3300018825|Ga0193048_1039918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae710Open in IMG/M
3300018830|Ga0193191_1040708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae771Open in IMG/M
3300018831|Ga0192949_1060364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae762Open in IMG/M
3300018842|Ga0193219_1035549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae761Open in IMG/M
3300018842|Ga0193219_1036827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae748Open in IMG/M
3300018855|Ga0193475_1037699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae773Open in IMG/M
3300018860|Ga0193192_1024543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae738Open in IMG/M
3300018870|Ga0193533_1080387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae702Open in IMG/M
3300018888|Ga0193304_1094358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae572Open in IMG/M
3300018913|Ga0192868_10035850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae724Open in IMG/M
3300018927|Ga0193083_10022346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae826Open in IMG/M
3300018928|Ga0193260_10066664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae780Open in IMG/M
3300018942|Ga0193426_10073565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae752Open in IMG/M
3300018942|Ga0193426_10079142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae726Open in IMG/M
3300018964|Ga0193087_10162644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae722Open in IMG/M
3300018966|Ga0193293_10049112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae716Open in IMG/M
3300018967|Ga0193178_10027023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae769Open in IMG/M
3300018977|Ga0193353_10139140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae729Open in IMG/M
3300018985|Ga0193136_10135975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae725Open in IMG/M
3300019009|Ga0192880_10099253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae742Open in IMG/M
3300019024|Ga0193535_10154423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae744Open in IMG/M
3300019025|Ga0193545_10135245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae525Open in IMG/M
3300019032|Ga0192869_10256686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae757Open in IMG/M
3300019032|Ga0192869_10260824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae751Open in IMG/M
3300019033|Ga0193037_10201411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae677Open in IMG/M
3300019099|Ga0193102_1013186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae747Open in IMG/M
3300019112|Ga0193106_1021975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae689Open in IMG/M
3300019125|Ga0193104_1032244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae725Open in IMG/M
3300019153|Ga0192975_10181815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae750Open in IMG/M
3300021345|Ga0206688_10932101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae582Open in IMG/M
3300021348|Ga0206695_1135946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae784Open in IMG/M
3300021871|Ga0063129_100104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae762Open in IMG/M
3300021873|Ga0063128_100041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae584Open in IMG/M
3300021876|Ga0063124_111757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae737Open in IMG/M
3300021877|Ga0063123_1002834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae689Open in IMG/M
3300021881|Ga0063117_1003575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae514Open in IMG/M
3300021883|Ga0063126_1000173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae722Open in IMG/M
3300021885|Ga0063125_1000646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae725Open in IMG/M
3300021885|Ga0063125_1006001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae757Open in IMG/M
3300021886|Ga0063114_1001311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae741Open in IMG/M
3300021894|Ga0063099_1057942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae630Open in IMG/M
3300021897|Ga0063873_1029600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae583Open in IMG/M
3300021899|Ga0063144_1059466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae647Open in IMG/M
3300021901|Ga0063119_1003425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae744Open in IMG/M
3300021902|Ga0063086_1005145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae793Open in IMG/M
3300021904|Ga0063131_1029793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae604Open in IMG/M
3300021905|Ga0063088_1033964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae718Open in IMG/M
3300021906|Ga0063087_1064571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae542Open in IMG/M
3300021912|Ga0063133_1004109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae749Open in IMG/M
3300021925|Ga0063096_1012185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae794Open in IMG/M
3300021928|Ga0063134_1014799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae621Open in IMG/M
3300021928|Ga0063134_1049279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae568Open in IMG/M
3300021934|Ga0063139_1033665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae748Open in IMG/M
3300021954|Ga0063755_1058722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae655Open in IMG/M
3300023555|Ga0232120_107653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae559Open in IMG/M
3300023565|Ga0228688_109901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae755Open in IMG/M
3300023694|Ga0228683_1017856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae754Open in IMG/M
3300026398|Ga0247606_1015741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae770Open in IMG/M
3300026420|Ga0247581_1037195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae765Open in IMG/M
3300026423|Ga0247580_1109074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae504Open in IMG/M
3300026427|Ga0247556_1116103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae501Open in IMG/M
3300026434|Ga0247591_1061459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae713Open in IMG/M
3300026447|Ga0247607_1043284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae781Open in IMG/M
3300026448|Ga0247594_1073118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae596Open in IMG/M
3300026458|Ga0247578_1052494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae782Open in IMG/M
3300026462|Ga0247568_1056312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae766Open in IMG/M
3300026470|Ga0247599_1062465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae788Open in IMG/M
3300026495|Ga0247571_1064480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae836Open in IMG/M
3300026503|Ga0247605_1083798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae784Open in IMG/M
3300028092|Ga0247574_1041416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae709Open in IMG/M
3300028102|Ga0247586_1052956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae767Open in IMG/M
3300028106|Ga0247596_1070304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae785Open in IMG/M
3300028119|Ga0247561_110041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae721Open in IMG/M
3300028243|Ga0256416_105014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae692Open in IMG/M
3300028290|Ga0247572_1101103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae711Open in IMG/M
3300028330|Ga0247601_1038120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae646Open in IMG/M
3300028333|Ga0247595_1039812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae774Open in IMG/M
3300028334|Ga0247597_1020616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae852Open in IMG/M
3300028337|Ga0247579_1061648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae769Open in IMG/M
3300028575|Ga0304731_11213481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata538Open in IMG/M
3300030670|Ga0307401_10371198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae650Open in IMG/M
3300030699|Ga0307398_10589549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae615Open in IMG/M
3300030702|Ga0307399_10272121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae801Open in IMG/M
3300030709|Ga0307400_10473042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae793Open in IMG/M
3300030725|Ga0308128_1032611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae618Open in IMG/M
3300030780|Ga0073988_10009977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae694Open in IMG/M
3300030857|Ga0073981_11705892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae633Open in IMG/M
3300030870|Ga0151493_136482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae511Open in IMG/M
3300030912|Ga0073987_10006009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae705Open in IMG/M
3300031004|Ga0073984_11291549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae706Open in IMG/M
3300031037|Ga0073979_12467002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae619Open in IMG/M
3300031113|Ga0138347_11104255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae759Open in IMG/M
3300031121|Ga0138345_10621539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae754Open in IMG/M
3300031558|Ga0308147_1023914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae761Open in IMG/M
3300031709|Ga0307385_10185901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae788Open in IMG/M
3300031725|Ga0307381_10163501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae766Open in IMG/M
3300031729|Ga0307391_10375544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae785Open in IMG/M
3300031739|Ga0307383_10309738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae765Open in IMG/M
3300033572|Ga0307390_10748370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae614Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine39.53%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine35.66%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater19.38%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.55%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.55%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.78%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.78%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008550Planktonic microbial communities from coastal waters of California, USA - Canon-21EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009356Microbial communities of water from the North Atlantic ocean - ACM16EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300018597Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782201-ERR1712206)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018647Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000833 (ERX1782439-ERR1712057)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018761Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002934 (ERX1789455-ERR1719449)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018817Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000030 (ERX1789390-ERR1719248)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021871Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S2 C18 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021873Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S2 C1 B8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021876Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-18 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021877Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021883Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021901Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023565Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026398Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 58R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026423Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026427Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028092Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 28R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028119Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 9R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028243Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1025D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028337Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030870Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S8_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0005233J53080_103650313300003701MarineVLDRLFWESTIVMLKLFANGMSSWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSALADLVGSDGYLEYLTITNL
Ga0103924_1447623300008550Coastal WaterMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSA
Ga0103951_1042299513300008832MarineVFDRLFWESTVVMSELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRL
Ga0103707_1009357813300009025Ocean WaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSL
Ga0103842_101531513300009216River WaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVKSAKC
Ga0103876_102852613300009269Surface Ocean WaterMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIIDSAFG
Ga0103835_101286313300009356River WaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIIDSAFGRFGWLCWLS
Ga0115104_1004252813300009677MarineVFDRLFWESTVVVTELFANGMSSWAASESSEWNNCSMCKDVIHVIDCFLQIHSLACSSSLITSLEMASQIINSAFSRFSWLCWLSGILD
Ga0115104_1114594513300009677MarineMSELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQI
Ga0115105_1113971823300009679MarineMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQTQAFASASSLICRLEMSSQI
Ga0123376_113228523300010129MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQAFASASSLICRLEMSSQMST
Ga0138324_1028827623300010987MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVLDHY
Ga0193035_100995313300018597MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSA
Ga0193064_101409113300018616MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICCLE
Ga0192913_102829923300018647MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCFLQIQTFASASSLICRLEMSSQIV
Ga0193069_102584813300018711MarineVFDRLFWESTVVMSELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSS
Ga0193138_102738113300018742MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0193425_103002223300018743MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQTQTFASASSLICRLEMSSQI
Ga0193425_103173323300018743MarineVFDRLFWESTVVMFELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQ
Ga0193468_103169423300018746MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVFDHYK
Ga0193063_106209623300018761MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVLD
Ga0193181_102871223300018766MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLD
Ga0193149_102715723300018779MarineVFDRLFWESTVVMSELFANGMSSWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHY
Ga0193149_102835513300018779MarineVSDRLFWESTVVMLELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHY
Ga0193124_104536913300018787MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIINSAFSRFG
Ga0193117_104935913300018796MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSEDVVHVIDCSLQWHAFASASSLVCRLEMSSQIVDSALSRFGWLC
Ga0193183_105600913300018811MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMS
Ga0192829_107738713300018812MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIVDSAFSRFGWLCWLSRVLDHY
Ga0193187_105079113300018817MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQTQAFASASSLICRLEMSSQIIDSAFGRFGWLCWLSRVL
Ga0193048_103596223300018825MarineVSDRLFWESTVVMSELLANGMSSWTTGESSEWDNCSMSKDVIHVIDCFLHIQTFASASSLICRLEMSSQIVDSAFCRFGWLCWLSRVLDHYK
Ga0193048_103991823300018825MarineMSELLANGMSSWTTGESSEWDNCSMSKDVIHVIDCFLHIQTFASASSLICRLEMSSQIVDSAFCRFGWLCWLSRVLDHYK
Ga0193191_104070813300018830MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVF
Ga0192949_106036423300018831MarineMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSRQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLD
Ga0193219_103554913300018842MarineMPDSLADGVVPRTAGESSERNDAPVSEDIVHVSDCLLEWHAFASASSLVCCLEMCSQIVDSALSRFGWLCWLSRVLDHYK
Ga0193219_103682713300018842MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVFDHYKS
Ga0193475_103769913300018855MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMS
Ga0193192_102454323300018860MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMSSQIVDSAFG
Ga0193533_108038713300018870MarineVSDRLFWESTVVMSELLANSMSSWTASESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLD
Ga0193304_109435813300018888MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIINSAFGRFGWLCWLSRVLDHY
Ga0192868_1003585013300018913MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQTQTFASASSLICRL
Ga0193083_1002234613300018927MarineVFDRLFWESTVVMFELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVLDHYKSLTY
Ga0193260_1006666423300018928MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDFIHVCDCSLHIQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVLDHYKS
Ga0193426_1007356513300018942MarineVFDRLFWESTVVMSELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQ
Ga0193426_1007914213300018942MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQI
Ga0193087_1016264423300018964MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQ
Ga0193293_1004911223300018966MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLVHVIDCSLHIQTFASASSLICRLEMSS
Ga0193178_1002702323300018967MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCW
Ga0193353_1013914023300018977MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQTQTFASASSLICRLEMSSQI
Ga0193136_1013597513300018985MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFTSASSLICRLEMSSQIV
Ga0192880_1009925323300019009MarineVFDRLFWESTVVMLELLADSVSSWTTGESSEWNDCSMSKDVVHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFS
Ga0193535_1015442313300019024MarineVFDRLFWESTVVMLELFANGVSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFG
Ga0193545_1013524513300019025MarineMSELFANGMSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIIDSAFGRF
Ga0192869_1025668613300019032MarineVFDRLFWESTVVMPELFANGVSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQI
Ga0192869_1026082423300019032MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSRQTLTFASASSLICRLEMSSQI
Ga0193037_1020141113300019033MarineMELFANGMSSWTSGKSSEWNDSSVCKDIIHVIDCFLDIQTLAGSGSLIXSLEMSSQII
Ga0193102_101318623300019099MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMSS
Ga0193106_102197533300019112MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMSSQI
Ga0193104_103224423300019125MarineVFDRLFWESTVVMLELFANGVSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQ
Ga0192975_1018181513300019153MarineMLELFANGMSTWTTGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILDHYKS
Ga0206688_1093210123300021345SeawaterVFDRLFWESTVVMSELFANGMMSWTASESSEWNNCFMCKDVIHVRDCFLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0206695_113594613300021348SeawaterMSELFANGMSSWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLSRILDHY
Ga0063129_10010413300021871MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYKSL
Ga0063128_10004113300021873MarineVSDRLFWESTVVMSELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCFLHIQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVLDHYKS
Ga0063124_11175713300021876MarineVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLD
Ga0063123_100283413300021877MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHY
Ga0063117_100357513300021881MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHY
Ga0063126_100017313300021883MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0063125_100064613300021885MarineVFDRLFWESTVVMSELFANGMSSWTAGESSEWNXCSMSKDVIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLSRILDHYK
Ga0063125_100600113300021885MarineMADLFANGMSSYGTGKSSEWDNGFMYKNIIHVIDCFCQIHTLASAGSLVTCLEMSSQIINSAFSRFGCFLWLSRILDHY
Ga0063114_100131113300021886MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQIQTFASASSLICRLEMSSQIVNSAFGRFGW
Ga0063099_105794213300021894MarineVFDRLFWESTVVMFELFANGMSSWTASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICCLEMSSQIV
Ga0063873_102960013300021897MarineVLDRLFWESTVVMLELFANGMSSWAAGESSEWNNCSMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSALSRFGWLCWLSRILDHY
Ga0063144_105946613300021899MarineMVELFANGMMSWAASESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLSRILDHY
Ga0063119_100342513300021901MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVLDHYK
Ga0063086_100514513300021902MarineVFDRLFWESTVVMLELLADSVSSWTTGESSEWNDCSMSEDVVHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLSRVLDHY
Ga0063131_102979313300021904MarineVFDRLFWESTVVMLELFANGMSSWTASESSEWNNCSMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFS
Ga0063088_103396413300021905MarineVFDRLFWESTVVMLELLADSVSSWTTGESSEWNDCSMSEDVVHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLSRVLDHYK
Ga0063087_106457113300021906MarineVFDRLFWESTVVMLELLADSVSSWTTGESSEWNDCSMSEDVVHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLS
Ga0063133_100410913300021912MarineVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLDHY
Ga0063096_101218513300021925MarineMFELFANGMSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILDHYK
Ga0063134_101479913300021928MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVDSAFGRFGWLCWLSRVL
Ga0063134_104927913300021928MarineVFDRLFWESTVVMLELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCFLQIQTFASASSLICRLEMS
Ga0063139_103366513300021934MarineMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCRLSRVLDHY
Ga0063755_105872213300021954MarineMFELFANGMSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIVNSAFSRFGWLCWLSRILDHY
Ga0232120_10765323300023555SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLDHYK
Ga0228688_10990123300023565SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDLIHVIDCFLQIQALASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVFDHYK
Ga0228683_101785613300023694SeawaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLDHYK
Ga0247606_101574113300026398SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLD
Ga0247581_103719523300026420SeawaterVSDRLFWESTVVMLELLADSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRV
Ga0247580_110907413300026423SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0247556_111610313300026427SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHY
Ga0247591_106145923300026434SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIV
Ga0247607_104328413300026447SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLDHYKS
Ga0247594_107311823300026448SeawaterVFDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILDHYK
Ga0247578_105249413300026458SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYKS
Ga0247568_105631223300026462SeawaterVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWL
Ga0247599_106246513300026470SeawaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYKS
Ga0247571_106448023300026495SeawaterMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLDHY
Ga0247605_108379813300026503SeawaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0247574_104141613300028092SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIVDSAFSRFGWLCWLSRVLDHYKSL
Ga0247586_105295623300028102SeawaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLD
Ga0247596_107030413300028106SeawaterMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIIDSAFGRFGWLCWLSRVLDHYK
Ga0247561_11004123300028119SeawaterVMSELLANSMSSWTTGESSEWNNCSMSKDVIHVTDCSLQTQAFASESSLICRLEMSSQIVNSEFGRFGWLCWLSRVL
Ga0256416_10501413300028243SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLVCRLEMSSQIV
Ga0247572_110110313300028290SeawaterVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYKSLT
Ga0247601_103812023300028330SeawaterVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLC
Ga0247595_103981223300028333SeawaterMSELLANSMSSWTAGESSEWNNCSMSKDVIHVTDCSLQTQAFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0247597_102061613300028334SeawaterVSDRLFWESTVVMPELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYK
Ga0247579_106164813300028337SeawaterVSDRLFWESTVVMSELLANSMSSWTTGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVL
Ga0304731_1121348113300028575MarineVSDRLFWESTVVMLELLADSMSSWTAGESSEWNNCSMSKDVVHVIDCSLQWQPFASASSLICRLEMSSQIVDSAFSRFGWLCWLSRVLD
Ga0307401_1037119813300030670MarineVFDRLFWESTVVMLELFANGMSSWATGESSEWNNSSMCKDVIHVIDCFLQIQTFASASSLICRLKMCSQIVNSAFSRFGWLCWLSRILDHYK
Ga0307398_1058954913300030699MarineVFDRLFWESTVVMLELFANCMSSWATSESSEWNNCFMCKDVIHVIDCFLHVQTFASASCFICGLEMSSQIVNSAFSRFGWL
Ga0307399_1027212113300030702MarineVFDRLFWESTVVMLELFANGMSSWATGESSEWNNSSMCKDVIHVIDCFLQIQTFASASSLICRLKMCSQIVNSAFSRFGWLCWLSRILDHYKSLTY
Ga0307400_1047304213300030709MarineMLELFANGMSTWTTGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILDHYKSL
Ga0308128_103261113300030725MarineVMFELFANGMSTWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILD
Ga0073988_1000997723300030780MarineVSDRLFWESTVVMLELLADSMSSWTAGESSEWNNCSMSKDVVHVIDCSLQWHPFASASSLICRLEMSSQIVDSAFSRFGWLCWLSRVLDHYKS
Ga0073981_1170589223300030857MarineVFDRLFWESTVVMLELFANGMSSWTASESSEWNNCSMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIV
Ga0151493_13648223300030870MarineMSELLANCMSSWTAGESSEWNNCSMSKDFIHVCDCSLHIQTFASASSLICRLEMSSQIVNSAFGRFGWLCRLSRVLDHYK
Ga0073987_1000600923300030912MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYKSL
Ga0073984_1129154913300031004MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQIQTFASASSLICRLEMSSQIIDSAFGRFGWLCW
Ga0073979_1246700223300031037MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLHIQTFASASSLICRLEMSSQIV
Ga0138347_1110425513300031113MarineVSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDVIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCWLSRVLDHYKS
Ga0138345_1062153913300031121MarineMSELLANSMSSWTAGESSEWNNCSMSKDFIHVIDCSLQTQTFASASSLICRLEMSSQIVNSAFGRFGWLCRLSRVLDHYKS
Ga0308147_102391413300031558MarineVFDRLFWESTVVMLELFANGMSSWATGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILDHY
Ga0307385_1018590113300031709MarineVSDGLFWESTVVMSELLANGMSSWTTGESSEWDNCSMSKDVIHVIDCFLHIQTFASASSLVCRLEMSSQIVDSAFCRFGWLCWLSRVLDHYK
Ga0307381_1016350113300031725MarineMFELFANGMSTWAAGESSEWNNCFMCKDVIHVSDCFLQIQTFASASSLICRLEMSSQIVDSAFSRFGWLCWLSRILDHYK
Ga0307391_1037554413300031729MarineMLELFANGMSTWTTGESSEWNNCFMCKDVIHVIDCFLQIQTFASASSLICRLEMSSQIINSAFSRFGWLCWLSRILDHYK
Ga0307383_1030973823300031739MarineMADLFANGMSSYGTGKSSEWDNGFMYKNIIHVIDCFCQIHTLASAGSLVTCLEMSSQIINSAFSRFGCFLWLSRILDHYK
Ga0307390_1074837013300033572MarineVFDRLFWESTVVMLELFANGMSSWATGESSEWNNSSMCKDVIHVIDCFLQIQTFASASSLICRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.