Basic Information | |
---|---|
Family ID | F063469 |
Family Type | Metagenome |
Number of Sequences | 129 |
Average Sequence Length | 43 residues |
Representative Sequence | DSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 1.83 % |
% of genes near scaffold ends (potentially truncated) | 82.17 % |
% of genes from short scaffolds (< 2000 bps) | 72.87 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (41.860 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (25.581 % of family members) |
Environment Ontology (ENVO) | Unclassified (83.721 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (85.271 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.35% β-sheet: 23.94% Coil/Unstructured: 50.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF00535 | Glycos_transf_2 | 20.93 |
PF01844 | HNH | 0.78 |
PF03237 | Terminase_6N | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.79 % |
Unclassified | root | N/A | 37.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000553|TBL_comb47_HYPODRAFT_10104028 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
3300002098|JGI24219J26650_1029231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300003277|JGI25908J49247_10004976 | All Organisms → Viruses → Predicted Viral | 4249 | Open in IMG/M |
3300003277|JGI25908J49247_10146440 | Not Available | 552 | Open in IMG/M |
3300003375|JGI26470J50227_1074682 | Not Available | 534 | Open in IMG/M |
3300003393|JGI25909J50240_1085805 | Not Available | 629 | Open in IMG/M |
3300003394|JGI25907J50239_1090458 | Not Available | 599 | Open in IMG/M |
3300003797|Ga0007846_1004428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1671 | Open in IMG/M |
3300003812|Ga0007861_1001338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2787 | Open in IMG/M |
3300003813|Ga0007879_1002112 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
3300003852|Ga0031655_10095819 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
3300003852|Ga0031655_10231630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300004802|Ga0007801_10022451 | All Organisms → Viruses → Predicted Viral | 1920 | Open in IMG/M |
3300004807|Ga0007809_10123486 | Not Available | 776 | Open in IMG/M |
3300005581|Ga0049081_10091634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1137 | Open in IMG/M |
3300006100|Ga0007806_1009594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2301 | Open in IMG/M |
3300006100|Ga0007806_1062695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300006101|Ga0007810_1092095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300006105|Ga0007819_1108063 | Not Available | 547 | Open in IMG/M |
3300006106|Ga0007833_1073780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300006113|Ga0007858_1007309 | All Organisms → Viruses → Predicted Viral | 2764 | Open in IMG/M |
3300006126|Ga0007855_1008731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2487 | Open in IMG/M |
3300006129|Ga0007834_1061454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300006805|Ga0075464_10143813 | All Organisms → Viruses → Predicted Viral | 1397 | Open in IMG/M |
3300006805|Ga0075464_10638896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300006805|Ga0075464_10918292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300009068|Ga0114973_10650327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300009068|Ga0114973_10736169 | Not Available | 500 | Open in IMG/M |
3300009151|Ga0114962_10164322 | All Organisms → Viruses → Predicted Viral | 1323 | Open in IMG/M |
3300009151|Ga0114962_10716991 | Not Available | 510 | Open in IMG/M |
3300009152|Ga0114980_10290343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300009154|Ga0114963_10092421 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
3300009154|Ga0114963_10248425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1010 | Open in IMG/M |
3300009155|Ga0114968_10654826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300009155|Ga0114968_10676084 | Not Available | 542 | Open in IMG/M |
3300009158|Ga0114977_10310609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 896 | Open in IMG/M |
3300009164|Ga0114975_10702327 | Not Available | 534 | Open in IMG/M |
3300009175|Ga0073936_10225463 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
3300009183|Ga0114974_10242831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1081 | Open in IMG/M |
3300009185|Ga0114971_10091262 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
3300009185|Ga0114971_10229953 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
3300010157|Ga0114964_10500756 | Not Available | 571 | Open in IMG/M |
3300010334|Ga0136644_10348601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 848 | Open in IMG/M |
3300010885|Ga0133913_10807442 | All Organisms → Viruses → Predicted Viral | 2444 | Open in IMG/M |
3300010885|Ga0133913_12388371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1294 | Open in IMG/M |
3300013006|Ga0164294_10818598 | Not Available | 627 | Open in IMG/M |
3300013372|Ga0177922_10088792 | Not Available | 553 | Open in IMG/M |
3300014962|Ga0134315_1060758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300015050|Ga0181338_1041196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 686 | Open in IMG/M |
3300015050|Ga0181338_1059004 | Not Available | 553 | Open in IMG/M |
3300017700|Ga0181339_1017498 | Not Available | 812 | Open in IMG/M |
3300017707|Ga0181363_1036808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 908 | Open in IMG/M |
3300017707|Ga0181363_1085331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300017716|Ga0181350_1136374 | Not Available | 580 | Open in IMG/M |
3300017722|Ga0181347_1199383 | Not Available | 526 | Open in IMG/M |
3300017747|Ga0181352_1181422 | Not Available | 546 | Open in IMG/M |
3300017761|Ga0181356_1213412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300017766|Ga0181343_1159300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300017774|Ga0181358_1172017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300017774|Ga0181358_1194562 | Not Available | 667 | Open in IMG/M |
3300017774|Ga0181358_1257430 | Not Available | 546 | Open in IMG/M |
3300017774|Ga0181358_1276269 | Not Available | 519 | Open in IMG/M |
3300020686|Ga0214194_101039 | All Organisms → Viruses → Predicted Viral | 3410 | Open in IMG/M |
3300020707|Ga0214238_1018409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300020728|Ga0214202_1056527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300020733|Ga0214172_1004386 | All Organisms → Viruses → Predicted Viral | 3356 | Open in IMG/M |
3300021121|Ga0214173_112257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300021133|Ga0214175_1022064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300021142|Ga0214192_1025999 | All Organisms → Viruses → Predicted Viral | 2022 | Open in IMG/M |
3300021961|Ga0222714_10153601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1379 | Open in IMG/M |
3300022173|Ga0181337_1045392 | Not Available | 575 | Open in IMG/M |
3300022179|Ga0181353_1130675 | Not Available | 593 | Open in IMG/M |
3300022190|Ga0181354_1139999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 764 | Open in IMG/M |
3300023184|Ga0214919_10312593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1075 | Open in IMG/M |
3300024509|Ga0255175_1029220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1083 | Open in IMG/M |
3300025379|Ga0208738_1005092 | All Organisms → Viruses → Predicted Viral | 2463 | Open in IMG/M |
3300025381|Ga0208871_1057799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300025383|Ga0208250_1059682 | Not Available | 539 | Open in IMG/M |
3300025387|Ga0207959_1001218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5987 | Open in IMG/M |
3300025399|Ga0208107_1024822 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
3300025400|Ga0208387_1006304 | All Organisms → Viruses → Predicted Viral | 2502 | Open in IMG/M |
3300025401|Ga0207955_1020942 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300025407|Ga0208378_1019308 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
3300025417|Ga0208616_1037422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300025426|Ga0208739_1013513 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
3300025532|Ga0208249_1057956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 950 | Open in IMG/M |
3300025591|Ga0208496_1018403 | All Organisms → Viruses → Predicted Viral | 1894 | Open in IMG/M |
3300025598|Ga0208379_1058118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300025788|Ga0208873_1051487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300025838|Ga0208872_1281262 | Not Available | 521 | Open in IMG/M |
3300027659|Ga0208975_1107288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 806 | Open in IMG/M |
3300027741|Ga0209085_1043810 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
3300027749|Ga0209084_1344626 | Not Available | 548 | Open in IMG/M |
3300027759|Ga0209296_1212874 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300027798|Ga0209353_10306869 | Not Available | 671 | Open in IMG/M |
3300027805|Ga0209229_10327881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300027896|Ga0209777_10677793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300029442|Ga0239579_1016672 | All Organisms → Viruses → Predicted Viral | 1332 | Open in IMG/M |
3300032562|Ga0316226_1260389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300032605|Ga0316232_1192007 | Not Available | 827 | Open in IMG/M |
3300032665|Ga0316221_1281129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300032668|Ga0316230_1079114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1352 | Open in IMG/M |
3300032753|Ga0316224_1024459 | All Organisms → Viruses → Predicted Viral | 2898 | Open in IMG/M |
3300032783|Ga0335079_11573949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300032828|Ga0335080_11545388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300032892|Ga0335081_11256035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
3300032897|Ga0335071_11866427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300033978|Ga0334977_0198327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1012 | Open in IMG/M |
3300034122|Ga0335060_0361078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 778 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 25.58% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.48% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.83% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 6.20% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.10% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 2.33% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.33% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.33% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 1.55% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.78% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.78% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300004802 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006106 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
3300006126 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 | Environmental | Open in IMG/M |
3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012664 | Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17 | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
3300020707 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion | Environmental | Open in IMG/M |
3300020728 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021121 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025400 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025532 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes) | Environmental | Open in IMG/M |
3300025591 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes) | Environmental | Open in IMG/M |
3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025788 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TBL_comb47_HYPODRAFT_101040283 | 3300000553 | Freshwater | DSFAVPKEDRAKVLNANYRASKRLGYKFSARTVGDVVRVWRTA* |
JGI24028J26656_10234741 | 3300002091 | Lentic | ARQKVMNANYRASKRLGCKYTCRTEGELVRVWRVA* |
JGI24218J26658_10416693 | 3300002092 | Lentic | RQKVMNANYRASKRLGCKYTCRTEGELVRVWRVA* |
JGI24219J26650_10292311 | 3300002098 | Lentic | RVVYAYPYEEMNVGDSFAVPVEARQKVLNANYRASKRLGLRFTSRTEGDVVRVWRVA* |
JGI25908J49247_100049761 | 3300003277 | Freshwater Lake | VYAYPYEEMDVGDSFCVPVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRVR* |
JGI25908J49247_101464401 | 3300003277 | Freshwater Lake | TVPVEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA* |
JGI26470J50227_10746822 | 3300003375 | Freshwater | VPVTARAKVLNANYRASKRLGYKFSSKSEGELLRVWRVL* |
JGI25909J50240_10858053 | 3300003393 | Freshwater Lake | VPVEARAKVLNANYRAGKRLQRVFVARTESDLIRVWRMA* |
JGI25907J50239_10904581 | 3300003394 | Freshwater Lake | TVPVEARAKVLNANYRAGKRLQRVFVARTESDLIRVWRMA* |
Ga0007846_10044284 | 3300003797 | Freshwater | PYEEMEVGDSFTVPVQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA* |
Ga0007861_10013386 | 3300003812 | Freshwater | SYPYEEMKVGESFTVPKIHRAKVLNANYRASKRTGYVFTSKTEGDLLRVWRVA* |
Ga0007879_10021124 | 3300003813 | Freshwater | VPVTARAKVLNANYRAGKRLGFKFSSKAEGEYLRVWRVS* |
Ga0031655_100958191 | 3300003852 | Freshwater Lake Sediment | EVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA* |
Ga0031655_102316303 | 3300003852 | Freshwater Lake Sediment | MEIGDSFCVPVEYRAKVLNANYRASKRTGFQFTGKTEGNVFFVWRVF* |
Ga0007801_100224511 | 3300004802 | Freshwater | VGDSFTVPVASRARVLNANYRAGKRLQRVFIARTEGDQIRIWRTA* |
Ga0007809_101234861 | 3300004807 | Freshwater | GDSFTVPVVARAKVLNANYRASKKLGFKFSSKSEGELLRVWRIA* |
Ga0049081_100916343 | 3300005581 | Freshwater Lentic | EEMDVGDSFVVPVAARGKVLNANYRAGKRLGWRFEARTEGEQVRVWRVR* |
Ga0007876_11578231 | 3300006071 | Freshwater | RAKVLNANYRASKRLGYKFASKAEGELLRVWRVA* |
Ga0007806_10095944 | 3300006100 | Freshwater | GDSFTVPVQARAKVLNANYRASKRLGYKFASKAEGELLRVWRVA* |
Ga0007806_10626954 | 3300006100 | Freshwater | VGDSFTVPVQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA* |
Ga0007810_10920953 | 3300006101 | Freshwater | RAKVLNANYRASKKLGFKFSSKSEGDNLRVWRVA* |
Ga0007819_11080632 | 3300006105 | Freshwater | SFTVPVVARAKVLNANYRASKKLGFKFSSKSEGELLRVWRIA* |
Ga0007833_10737801 | 3300006106 | Freshwater | VGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA* |
Ga0007862_10232655 | 3300006108 | Freshwater | RQKVANANYRASKRLGYKFVSKTEGEMLRVWRVS* |
Ga0007858_10073095 | 3300006113 | Freshwater | DSFTVPVSARAKVLNANYRASKRLGYKFSSKSEGDSLRVWRVA* |
Ga0007824_10359081 | 3300006121 | Freshwater | ARAKVLNANYRASKRLGFKFSSKSEGELLRVWRVS* |
Ga0007855_10087311 | 3300006126 | Freshwater | VPVVARAKVLNANYRASKKLGFKFSSKSEGDNLRVWRVA* |
Ga0007834_10614543 | 3300006129 | Freshwater | VVYVYPYDSMEVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA* |
Ga0075464_101438135 | 3300006805 | Aqueous | SFCVPLDARAKVLNANYRAGKRLGRVFTAKTEGDQVRVWRTA* |
Ga0075464_106388961 | 3300006805 | Aqueous | EMEVGDSFIVPVAARAKVLNANYRAGKRLGRVFIARTEGETIRIWRQA* |
Ga0075464_109182921 | 3300006805 | Aqueous | PYEDMEIGDSFTVPVEARAKVLNANYRAGKRLQRVFVARTEGDLIRFWRMA* |
Ga0114973_102320523 | 3300009068 | Freshwater Lake | GDSFVVPVEARQKVLNANYRASRRLGWRFSTRTEKEQVRVWRIY* |
Ga0114973_106503271 | 3300009068 | Freshwater Lake | MDVGDSFCVPVSARQKVLNANYRASKRLGWRFTAKTDGEVIRVWRMS* |
Ga0114973_107361691 | 3300009068 | Freshwater Lake | DSFTVPVEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA* |
Ga0114962_101643221 | 3300009151 | Freshwater Lake | ARAKVLNANYRAGKRLGWVFTAKTEGEQVRVWRTA* |
Ga0114962_107169911 | 3300009151 | Freshwater Lake | GDSFTVPVEARAKVLNANYRAGKRLQRVFVARTEGDQIRVWRMA* |
Ga0114980_102903434 | 3300009152 | Freshwater Lake | VVYAYPYEDMGIGDSFVVPLEARQKVLNANYRATKRLGLRFTSRTEGDVVRVWRVS* |
Ga0114963_100924211 | 3300009154 | Freshwater Lake | KAARAKVLNANYRAGKRLSMTFVARTDGDLVRVWRMT* |
Ga0114963_102484255 | 3300009154 | Freshwater Lake | ARAKVLNANYRAGKRLGRYFAARTEGEVVRVWRMS* |
Ga0114968_106548262 | 3300009155 | Freshwater Lake | SEEMDVGDSFCVPVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRVR* |
Ga0114968_106760841 | 3300009155 | Freshwater Lake | TVPLSARAKVLNANYRAGKRLGWVFTAKTEGEQVRVWRTA* |
Ga0114977_103106093 | 3300009158 | Freshwater Lake | FVVPLEARAKVLNANYRAGKRLGRVFTAKTDGERVRVWRTR* |
Ga0114978_105241673 | 3300009159 | Freshwater Lake | ARQKVLNANYRATKRLGLRFTSRTEGDVVRVWRVS* |
Ga0114978_108013853 | 3300009159 | Freshwater Lake | FCVPVSARQKVLNANYRASKRLGWRFTAKTEGEVIRIWRVA* |
Ga0114970_101053263 | 3300009163 | Freshwater Lake | ARQKVLNANYRASRRLGWRFSTRTEKEQVRVWRIY* |
Ga0114975_107023271 | 3300009164 | Freshwater Lake | PVEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA* |
Ga0073936_102254634 | 3300009175 | Freshwater Lake Hypolimnion | EMDVGDSFTVPVAARQKVLNANYRASKRLGLKFMAKTEGDIVRIWRTA* |
Ga0114979_100965693 | 3300009180 | Freshwater Lake | CVPVGARQKVLNANYRASRRLGIGLTAKTEGLVVRVWRTR* |
Ga0114974_102428311 | 3300009183 | Freshwater Lake | PLEARAKVLNANYRAGKRLGRVFTAKTDGEQVRVWRTA* |
Ga0114971_100912626 | 3300009185 | Freshwater Lake | VEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA* |
Ga0114971_102299534 | 3300009185 | Freshwater Lake | VYAYPYEDMGVGDSFVVPLEARQKVLNANYRATKRLGLRFTSRTEGDVVRVWRVS* |
Ga0114964_105007561 | 3300010157 | Freshwater Lake | GDSFTVPVEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA* |
Ga0114967_103420951 | 3300010160 | Freshwater Lake | SFCVPVGATQKVLNANYRESRRLGIGLTAKTEGVVVRVWRVR* |
Ga0136644_103486015 | 3300010334 | Freshwater Lake | TVPKAARAKVLNANYRAGKRLSMTFVARTDGDLVRVWRMT* |
Ga0133913_108074424 | 3300010885 | Freshwater Lake | PVSHKANVMNANHRAGKRLARRFMARTEGEYVRVWRIR* |
Ga0133913_123883711 | 3300010885 | Freshwater Lake | YEEMDVGDSFTVPVSARQKVLNANYRASKRLGWRFTAKTEDGLIRVWRVA* |
Ga0157497_10293463 | 3300012664 | Freshwater | SARQKVLNANYRASKRLGLRFMAKTEGDVIRVWRVS* |
Ga0164294_108185984 | 3300013006 | Freshwater | EARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA* |
Ga0177922_100887923 | 3300013372 | Freshwater | MEVGDSFVVPLVARAKVLNANYRAGKRLGRYFAARTEGDTVRVWRMS* |
Ga0134315_10607581 | 3300014962 | Surface Water | VGDSFTVPLEARQKVLNANYRASKRLGRKFQAKTDGGLIRVWRVE* |
Ga0181338_10411961 | 3300015050 | Freshwater Lake | RAKGFNPDYRGRKRSGRVFTSKTDCEQVRVWRTM* |
Ga0181338_10590041 | 3300015050 | Freshwater Lake | GDSFVVPLGARAKVLNANYRAGKRLGRYFAARTEGDQVRVWRMS* |
Ga0181339_10174984 | 3300017700 | Freshwater Lake | EIGDSFTVPVEARAKVLNANYRAGKRLQRVFVARTESDLIRVWRMA |
Ga0181364_10535271 | 3300017701 | Freshwater Lake | SFCVPVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRTR |
Ga0181363_10368084 | 3300017707 | Freshwater Lake | DSFVVPVEHRAKVLNANYRAGKRLGQKFVARSEGEMLRVWRVE |
Ga0181363_10853312 | 3300017707 | Freshwater Lake | EEMEVGDSFLVPVSARSKVLNANYRAGKRLGMRFIARTEGEGEMVRVWRVG |
Ga0181350_11363743 | 3300017716 | Freshwater Lake | SFTVPVEARAKVLNANYRAGKRLQRVFVARTESDLIRVWRMA |
Ga0181347_11993831 | 3300017722 | Freshwater Lake | PLVARAKVLNANYRAGKRLGRYFAARTEGDTVRVWRMS |
Ga0181352_11814223 | 3300017747 | Freshwater Lake | FVVPVEHRAKVLNANYRAGKRLGQKFVARSEGEMLRVWRVE |
Ga0181356_12134121 | 3300017761 | Freshwater Lake | MEVGDSFVVPLVARAKVLNANYRAGKRLGRYFAARTEGDTVRVWRMS |
Ga0181343_11593002 | 3300017766 | Freshwater Lake | VYAYPYEEMDVGDSFCVPVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRVR |
Ga0181358_11720172 | 3300017774 | Freshwater Lake | VARVVYAYPYEEMDVGDSFCVPVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRVR |
Ga0181358_11945624 | 3300017774 | Freshwater Lake | IGDSFTVPVEARAKVLNANYRAGKRLQRVFVARTESDLIRVWRMA |
Ga0181358_12574301 | 3300017774 | Freshwater Lake | VVPLVARAKVLNANYRAGKRLGRYFAARTEGDTVRVWRMS |
Ga0181358_12762692 | 3300017774 | Freshwater Lake | FCVPLEARAKVLNANYRAGKRLGRVFTAKTDKEVVRVWRTT |
Ga0214194_1010397 | 3300020686 | Freshwater | RVVYAYPYESMEVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0214238_10184091 | 3300020707 | Freshwater | DSFTVPVTARAKVLNANYRAGKRLGFKFSSKAEGEYLRVWRVS |
Ga0214202_10565271 | 3300020728 | Freshwater | DMEVGDSFTVPVTARAKVLNANYRAGKRLGFKFSSKAEGEYLRVWRVS |
Ga0214172_10043866 | 3300020733 | Freshwater | LVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0214173_1122574 | 3300021121 | Freshwater | YAYPYDSMEVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0214175_10220645 | 3300021133 | Freshwater | EVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0214192_10259991 | 3300021142 | Freshwater | LEARAKVLNANYRAGKRLARAFEARTEEGRVRVWRTR |
Ga0222714_101536011 | 3300021961 | Estuarine Water | CVPLEARAKVLNANYRAGKRLGRVFTAKTEGEQVRVWRTA |
Ga0181337_10453922 | 3300022173 | Freshwater Lake | ARAKVLNANYRAGKRLQRVFVARTENEQIRVWRMA |
Ga0181353_11306751 | 3300022179 | Freshwater Lake | VARAKVLNANYRAGKRLGRYFAARTEGDTVRVWRMS |
Ga0181354_11399991 | 3300022190 | Freshwater Lake | GDSFVVPVEHRAKVLNANYRAGKRLGQKFVARSEGEMLRVWRVE |
Ga0214923_104836713 | 3300023179 | Freshwater | EARQKVLNANYRASRRLGWRFSTRTEGEQVRVWRTV |
Ga0214919_103125931 | 3300023184 | Freshwater | LEARAKVLNANYRAGKRLGWVFTAKTEGDVVRVWRTK |
Ga0214919_106851201 | 3300023184 | Freshwater | PVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRTR |
Ga0255175_10292201 | 3300024509 | Freshwater | EEMDVGDSFVVPVSARAKVLNANYRAGKRLGWRFEARTEGDVVRVWRVR |
Ga0208738_10050921 | 3300025379 | Freshwater | YEEMEVGDSFTVPVQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA |
Ga0208871_10577992 | 3300025381 | Freshwater | YEEMEIGDSFTVPVQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA |
Ga0208256_10051384 | 3300025382 | Freshwater | TVPKIHRAKVLNANYRASKRTGYVFTSKTEGDLLRVWRVA |
Ga0208250_10596822 | 3300025383 | Freshwater | PVQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA |
Ga0207959_10012181 | 3300025387 | Freshwater | ESFTVPKIHRAKVLNANYRASKRTGYVFTSKTEGDLLRVWRVA |
Ga0208257_10125805 | 3300025389 | Freshwater | EARQKVANANYRASKRLGYKFVSKTEGEMLRVWRVS |
Ga0208107_10248221 | 3300025399 | Freshwater | VVPVSARAKVLNANYRAGKRLGLRFMAKTEGDVIRVWRTA |
Ga0208387_10063041 | 3300025400 | Freshwater | SFTVPVVARAKVLNANYRASKKLGFKFSSKSEGELLRVWRIA |
Ga0207955_10209424 | 3300025401 | Freshwater | MEVGDSFTVPVQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA |
Ga0208378_10193081 | 3300025407 | Freshwater | EVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGELLRVWRVS |
Ga0208616_10374224 | 3300025417 | Freshwater | SMEVGDSFTVPVVARAKVLNANYRASKKLGFKFSSKSEGDNLRVWRVA |
Ga0208739_10135131 | 3300025426 | Freshwater | VQARAKVLNANYRASKRLGYKFASKAEGDNLRVWRVA |
Ga0208249_10579565 | 3300025532 | Freshwater | PLEARAKVLNANYRAGKRLGRVFTAKTEGDTVRVWRTA |
Ga0208496_10184031 | 3300025591 | Freshwater | DVGDSFTVPVASRARVLNANYRAGKRLQRVFIARTEGDQIRIWRTA |
Ga0208248_10953611 | 3300025595 | Freshwater | PVGARQKVLNANYRASRRLGIGLTAKTEGVVVRVWRVR |
Ga0208379_10581181 | 3300025598 | Freshwater | RVVYAYPYDSMEVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0208873_10514871 | 3300025788 | Freshwater | VGDSFAVPKEARQKVANANYRASKRLGYKFVSKTEGEMLRVWRVS |
Ga0208872_12812621 | 3300025838 | Freshwater | SFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDSLRVWRVA |
Ga0208975_11072881 | 3300027659 | Freshwater Lentic | EEMDVGDSFVVPVAARGKVLNANYRAGKRLGWRFEARTEGEQVRVWRVR |
Ga0209085_10438101 | 3300027741 | Freshwater Lake | FTVPVEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA |
Ga0209189_11667574 | 3300027747 | Freshwater Lake | VEARQKVLNANYRASKRLGLRFTSRTEGDVVRVWRVA |
Ga0209084_13446261 | 3300027749 | Freshwater Lake | FVVPLSARAKVLNANYRAGKRLGRYFAARTEGEVVRVWRMS |
Ga0209296_12128741 | 3300027759 | Freshwater Lake | FTVPVEARAKVLNANYRAGKRLQRVFVARTEGDQIRVWRMA |
Ga0209353_103068691 | 3300027798 | Freshwater Lake | TVPVEARAKVLNANYRAGKRLQRVFVARTEGDLIRVWRMA |
Ga0209229_103278813 | 3300027805 | Freshwater And Sediment | ARAKVLNANYRAGRRLGWRFEARTEGDVVRVWRVL |
Ga0209777_106777931 | 3300027896 | Freshwater Lake Sediment | DSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0239579_10166721 | 3300029442 | Freshwater Lake | SFTVPVTARAKVLNANYRASKRLGFKFSSKAEGDVLRVWRVS |
Ga0316226_12603891 | 3300032562 | Freshwater | YAYPYESMEVGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0316232_11920071 | 3300032605 | Freshwater | VSARAKVLNANYRASKRLGYKFSSKSEGDSLRVWRVA |
Ga0316221_11420781 | 3300032665 | Freshwater | ARAKVLNANYRASKKLGFKFSSKSEGELLRVWRVA |
Ga0316221_12811293 | 3300032665 | Freshwater | VGDSFTVPVSARAKVLNANYRASKRLGFKFSSKSEGDNLRVWRVA |
Ga0316230_10791144 | 3300032668 | Freshwater | VVYAYPYDSMEVGDSFTVPVTARAKVLNANYRASKRLGYKFSSKSEGELLRVWRVL |
Ga0316224_10244591 | 3300032753 | Freshwater | GDSFTVPVTARAKVLNANYRASKRLGYKFSSKSEGELLRVWRVL |
Ga0335079_115739491 | 3300032783 | Soil | EMEVGDSFTVPAGARAKVLNANYRASKRLGMRFQAKTEGDVVRVWRVA |
Ga0335080_115453883 | 3300032828 | Soil | PAEARAKVLNANYRASKRLGMRFQAKTEGDVVRVWRVA |
Ga0335081_112560354 | 3300032892 | Soil | SYPYEEMEVGDSFTVPAGARAKVLNANYRASKRLGMRFQAKTEGDVVRVWRVA |
Ga0335071_118664271 | 3300032897 | Soil | EARAKVLNANYRAFKRLGKRFQAKTEGDVVRVWRVA |
Ga0334977_0198327_899_1012 | 3300033978 | Freshwater | VEHRAKVLNANYRAGKRLGQKFVARSEGEMLRVWRVE |
Ga0335060_0361078_16_159 | 3300034122 | Freshwater | MEVGDSFVVPVVARAKVLNANYRAGRRLGWRFEARTEGDVVRVWRVL |
⦗Top⦘ |