NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063670

Metagenome / Metatranscriptome Family F063670

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063670
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 52 residues
Representative Sequence VTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQ
Number of Associated Samples 115
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.22 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.57 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.403 % of family members)
Environment Ontology (ENVO) Unclassified
(31.783 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(27.907 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF08281Sigma70_r4_2 57.36
PF04545Sigma70_r4 23.26
PF06971Put_DNA-bind_N 8.53
PF05768Glrx-like 8.53
PF07733DNA_pol3_alpha 0.78
PF00033Cytochrome_B 0.78
PF00355Rieske 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0695GlutaredoxinPosttranslational modification, protein turnover, chaperones [O] 8.53
COG3118Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC familyPosttranslational modification, protein turnover, chaperones [O] 8.53
COG0587DNA polymerase III, alpha subunitReplication, recombination and repair [L] 0.78
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.78
COG2176DNA polymerase III, alpha subunit (gram-positive type)Replication, recombination and repair [L] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17342403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1316Open in IMG/M
3300000891|JGI10214J12806_13426469All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300000956|JGI10216J12902_119098612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300002407|C687J29651_10245356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300004051|Ga0055492_10071802All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300004114|Ga0062593_103091543All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300004157|Ga0062590_102626319All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300004479|Ga0062595_102236166All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300005165|Ga0066869_10045753All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005213|Ga0068998_10030001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300005218|Ga0068996_10172293All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300005331|Ga0070670_101953936All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005334|Ga0068869_101403939All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300005341|Ga0070691_10549338All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005347|Ga0070668_101739386All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005366|Ga0070659_100170812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1781Open in IMG/M
3300005406|Ga0070703_10386358All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005471|Ga0070698_100066794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3617Open in IMG/M
3300005518|Ga0070699_101222535All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300005547|Ga0070693_101135102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300005556|Ga0066707_10342359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300005562|Ga0058697_10087419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1269Open in IMG/M
3300005564|Ga0070664_100984969All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005713|Ga0066905_100834112All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006576|Ga0074047_11620619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia746Open in IMG/M
3300006577|Ga0074050_12069935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium881Open in IMG/M
3300006577|Ga0074050_12089107All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300006579|Ga0074054_11592507All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300006791|Ga0066653_10122824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1221Open in IMG/M
3300006865|Ga0073934_10678119All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006953|Ga0074063_13321608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300006953|Ga0074063_13851242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2525Open in IMG/M
3300009137|Ga0066709_102980511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300009148|Ga0105243_10010314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7097Open in IMG/M
3300009818|Ga0105072_1063077All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300009823|Ga0105078_1017892All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300010371|Ga0134125_12691046All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010401|Ga0134121_12343671All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300011003|Ga0138514_100102291All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300011003|Ga0138514_100104667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300011003|Ga0138514_100119083All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300011119|Ga0105246_10708881All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300011398|Ga0137348_1037325All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300012208|Ga0137376_11371183All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300012350|Ga0137372_11114857All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300013306|Ga0163162_10505109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1339Open in IMG/M
3300014745|Ga0157377_10124836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1564Open in IMG/M
3300015374|Ga0132255_100469996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1843Open in IMG/M
3300015374|Ga0132255_101394970All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300017947|Ga0187785_10043905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1657Open in IMG/M
3300018054|Ga0184621_10304954All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018061|Ga0184619_10326612All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300018072|Ga0184635_10016668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2647Open in IMG/M
3300018075|Ga0184632_10266210All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300018089|Ga0187774_10650315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300018429|Ga0190272_10838681All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300018465|Ga0190269_10084615All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300019269|Ga0184644_1241470All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300019377|Ga0190264_10573011All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300021445|Ga0182009_10535771All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300021951|Ga0222624_1193302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300025908|Ga0207643_10840956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300025925|Ga0207650_10327777All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300025933|Ga0207706_11650195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300025935|Ga0207709_11519454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300025937|Ga0207669_10407008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300025937|Ga0207669_11004182All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300025942|Ga0207689_11725044All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300025945|Ga0207679_10928331All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300025961|Ga0207712_11954669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300026014|Ga0208776_1013232All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300026041|Ga0207639_11616306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300026067|Ga0207678_10113036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2316Open in IMG/M
3300026118|Ga0207675_100323026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1507Open in IMG/M
3300027006|Ga0209896_1007823All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300027032|Ga0209877_1023684All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300027163|Ga0209878_1008012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1514Open in IMG/M
3300027277|Ga0209846_1058028All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300027490|Ga0209899_1003371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3651Open in IMG/M
3300027577|Ga0209874_1068335All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300027722|Ga0209819_10255948All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300027880|Ga0209481_10392862All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300027910|Ga0209583_10506618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
(restricted) 3300028043|Ga0233417_10590557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
(restricted) 3300028043|Ga0233417_10655687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300028381|Ga0268264_10080276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2785Open in IMG/M
3300028596|Ga0247821_11245346All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300028608|Ga0247819_10439403All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300028708|Ga0307295_10152571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300028718|Ga0307307_10243103All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300028720|Ga0307317_10207010All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028771|Ga0307320_10188971All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300028784|Ga0307282_10379372All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300028810|Ga0307294_10348646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300028814|Ga0307302_10092629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1438Open in IMG/M
3300028828|Ga0307312_10705277All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300028876|Ga0307286_10092437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1057Open in IMG/M
3300030606|Ga0299906_11028098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300031200|Ga0307496_10088532All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300031562|Ga0310886_10344298All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031562|Ga0310886_10517581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300031740|Ga0307468_100627997All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031740|Ga0307468_101721110All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300031858|Ga0310892_11179676All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300031892|Ga0310893_10442512All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300031908|Ga0310900_10740526All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300031965|Ga0326597_10593012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300031965|Ga0326597_11698226All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031997|Ga0315278_11353302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300032122|Ga0310895_10215367All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300032164|Ga0315283_10559595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300032164|Ga0315283_12343701All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300032173|Ga0315268_11393184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300032174|Ga0307470_10482052All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300032174|Ga0307470_10645718All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300032342|Ga0315286_10707677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300032401|Ga0315275_10603696All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300032516|Ga0315273_10414472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1814Open in IMG/M
3300032516|Ga0315273_11155477All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300032516|Ga0315273_11486766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium834Open in IMG/M
3300032770|Ga0335085_11387415All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300033004|Ga0335084_11122375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300033416|Ga0316622_102308285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300033500|Ga0326730_1106029All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300033513|Ga0316628_102201830All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300033812|Ga0364926_040182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria889Open in IMG/M
3300034148|Ga0364927_0114193All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300034659|Ga0314780_166789All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300034690|Ga0364923_0044433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1044Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.40%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.20%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand6.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.33%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.33%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.33%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.78%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026014Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027032Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027490Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_025952502088090014SoilVTEDHERIDELLAGYVLLSLSGEEAAEADRILGDHVPSCA
JGI10214J12806_1342646913300000891SoilVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQ
JGI10216J12902_11909861213300000956SoilVIDHDEIQELLAGYVLRSLSGEDAVEADRILTEHVPGCADCRAT
C687J29651_1024535623300002407SoilVTPDHDAIDELLAGYVLRSLTGGDAAEVDRLLTDHVPGCDDCRATLGAFQALTG
Ga0055492_1007180213300004051Natural And Restored WetlandsMSPDHEQIDELLAGYVLQALSGEDAAEADRLLATHVPSCLLCRTTLQELQDLTGDLALI
Ga0062593_10309154313300004114SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQ
Ga0062590_10262631913300004157SoilVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQDLSADLALD
Ga0062595_10223616613300004479SoilVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQDLSADLA
Ga0066869_1004575323300005165SoilLTESHEAIEELLAGYVLRSLSGEDAARADHLLSDHVPQCPACRDSLAVFQVV
Ga0068998_1003000133300005213Natural And Restored WetlandsLTQDHERIDELLAGYVLLSLAGSDAEEADRILIEHVPTCGRCRETLEDLQALSGDLALAARPESPPDTLLP
Ga0068996_1017229313300005218Natural And Restored WetlandsVTEDHESIEELLAGYVLRSLSGEDATLADHLLSDHVPFCPACRDSLAVFQGVTADLALDT
Ga0070670_10195393623300005331Switchgrass RhizosphereMIDHEAIDALIAGYVLQSLTGEDAEAADRLLTDHVPACTDCRA
Ga0068869_10140393913300005334Miscanthus RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCRATLSDLEAVSGDLALA
Ga0070691_1054933813300005341Corn, Switchgrass And Miscanthus RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADRVLVDHVPSCARCRATLSELQ
Ga0070668_10173938613300005347Switchgrass RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCRATLSDLEA
Ga0070659_10017081213300005366Corn RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADRILVDHVPSCATCRATLSEFQAVSGDLALAA
Ga0070703_1038635813300005406Corn, Switchgrass And Miscanthus RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTAD
Ga0070698_10006679473300005471Corn, Switchgrass And Miscanthus RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADRILVDHVPSCATCRATLSE
Ga0070699_10122253513300005518Corn, Switchgrass And Miscanthus RhizosphereVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQDLSADL
Ga0070693_10113510213300005547Corn, Switchgrass And Miscanthus RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSLDPSPVQ
Ga0066707_1034235913300005556SoilMTEHIEDHERIEELLAGHALHALSGEDAIEADRLVREHVPTCERCLATFHD
Ga0058697_1008741943300005562AgaveMQDHERIEELLAGHALGALSGEDVFEADRVLADHVPSCPLCREALGGFR
Ga0070664_10098496923300005564Corn RhizosphereMIDHEAIDELIAGYVLQSLTGEDAEAADRLLTDHVPACTDCRATLDA
Ga0066905_10083411223300005713Tropical Forest SoilVTDDHAAIDELLAGYVLGALSGPDAAEMDRLFVEHIPGCDTCRATL
Ga0074047_1162061913300006576SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSLD
Ga0074050_1206993523300006577SoilVSETHEQIEELLAGYVLRSLSGADAAEADRLLTEHVPGCSRCRSTLDAFQAVAADL
Ga0074050_1208910723300006577SoilVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCATCRATLSELQ
Ga0074054_1159250723300006579SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTA
Ga0066653_1012282443300006791SoilVIDGHGETQELLAGYVLESLSGEDAAEADRLLTEHVPGCSECRLMLDAFQAVV
Ga0073934_1067811923300006865Hot Spring SedimentLTEDHERIDELLAGYVLLSLSGEDAAEADRVLAEHVPSCGRCRG
Ga0074063_1332160813300006953SoilVNETHEQIEELLAGYVLRSLSGADAAEADRLLTEHVPGCGSCRSTLDAFQAVAADLAL
Ga0074063_1385124263300006953SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLA
Ga0066709_10298051123300009137Grasslands SoilVTDGHDTIDELLAGYVLRSLSGEDAARGDQLLAEHVPGCADCRMTLDAFGSVVADLALEAPAV
Ga0105243_10010314133300009148Miscanthus RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPHCPACRDSLAVFQGVTA
Ga0105072_106307723300009818Groundwater SandVTEQHEAIEELLAGYVLRSLSGEDAARADRVLSDHVPGCPACRDTLSVFR
Ga0105078_101789213300009823Groundwater SandVTEDHERIDELLAGYVLLSLSGEDAAEADRILVDHVPSCATCRATL
Ga0134125_1269104623300010371Terrestrial SoilVTEDHDRIDELLAGYVLLSLSGEDAAEADRVLVDHVPSCARCRAT
Ga0134121_1234367123300010401Terrestrial SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAMFQ
Ga0138514_10010229123300011003SoilLRLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPHCPAC
Ga0138514_10010466723300011003SoilMTERHERIEELLAGYVLRSLEGEDAREAEILIAEHVPSCPS
Ga0138514_10011908323300011003SoilLTETHEAIEALLAGYVLRSLSGEDAERADHLLSDHVPHCPAC
Ga0105246_1070888113300011119Miscanthus RhizosphereMIDHEAIDELLAGYVLRSLTGEDAEAADRLLTDHVPACSDCLATLDA
Ga0137348_103732523300011398SoilLTEDHERIDELLAGYVLLSLSGEDAAEADRILAEHVPSCGRCRATLNELQAVSGDL
Ga0137376_1137118323300012208Vadose Zone SoilLTETHESIEELLAGYVLRSLSGEDAARADHLLSDHVPLCPACRDSLAMF
Ga0137372_1111485723300012350Vadose Zone SoilLTETHESIEELLAGYVLRSLSGEDAARADHLLSDHVPLCPACRDSLAMFQAVTTDLALDA
Ga0163162_1050510943300013306Switchgrass RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADVS
Ga0157377_1012483613300014745Miscanthus RhizosphereVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCATCRATLSEFQAVSGDLALAA
Ga0132255_10046999613300015374Arabidopsis RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSLDPSPVQPPDT
Ga0132255_10139497013300015374Arabidopsis RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCR
Ga0187785_1004390543300017947Tropical PeatlandMTESHEAIEELLAGYVLRSLSGEDASRADQLLSDHVPTCASCRDTLAVFQGVTADLALGAGPIEPP
Ga0184621_1030495423300018054Groundwater SedimentVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCATCRATLSELQAVSG
Ga0184619_1032661213300018061Groundwater SedimentLSETHESIEELLAGYVLRSLSGEDAARADHLLSDHVPMCPACR
Ga0184635_1001666863300018072Groundwater SedimentVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCATCR
Ga0184632_1026621023300018075Groundwater SedimentLTEDHERIDELLTGYVLLSLSGEDAAEADRILAEHVPSCGTCRETLIELQAVSGDLAL
Ga0187774_1065031523300018089Tropical PeatlandMTEGHEAIEELLAGYVLRSLSGEDATRADHLLSDHVPTCASCRDSLAVFQG
Ga0190272_1083868123300018429SoilVTDDHDRGSDHGSIDELLAGYALGALEGADAAEADRL
Ga0190269_1008461543300018465SoilLTEDHERIDELLAGYVLLSLSGEDAAEADRILAEHVPSCARCRATLNELQAVSGDLALAAAPVDPP
Ga0184644_124147023300019269Groundwater SedimentVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCA
Ga0190264_1057301113300019377SoilVETDHDGIHELLAGYVLGGLSGEDARTVDRLLAEHVPSCPVCR
Ga0182009_1053577113300021445SoilVTDDHDAIDELLAGYVLEALSGADADEADRLLVDHVPGCDRCRET
Ga0222624_119330213300021951Groundwater SedimentVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCARCRATLSEFQA
Ga0207643_1084095623300025908Miscanthus RhizosphereMIDHDAIDELLAGYVLRSLTGEDAEAADRLLTDHVPACTDCLATLD
Ga0207650_1032777713300025925Switchgrass RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCRATLSDL
Ga0207706_1165019523300025933Corn RhizosphereMIDHDAIDELLAGYVLRSLTGEDAEAADRLLTDHVPACSDCLATLD
Ga0207709_1151945413300025935Miscanthus RhizosphereVIDHDATDELLAGYVLGSLSGEDAVEVDRLLAEHVPDCDRCRATLDAFQG
Ga0207669_1040700813300025937Miscanthus RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPHCP
Ga0207669_1100418213300025937Miscanthus RhizosphereVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQDLS
Ga0207689_1172504413300025942Miscanthus RhizosphereRVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDISDNTAAG
Ga0207679_1092833113300025945Corn RhizosphereVTNDHEAIDEPLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLSAFQDLSADLALDAAPLTPPDTL
Ga0207712_1195466913300025961Switchgrass RhizosphereMIDHDAIDELLAGYVLRSLTGEDAEAADRLLTDHVPACTDCLA
Ga0208776_101323213300026014Rice Paddy SoilVADTHEAIEELLAGYVLRSLSGEDAARADHLLTDHVPHCPACRDSLAMFQGVT
Ga0207639_1161630623300026041Corn RhizosphereVIDHEAADELLAGYVLGSLTGPDAVEADRLLTEHVPDCLTCRATLDAFQG
Ga0207678_1011303613300026067Corn RhizosphereVTEDHERIDELLAGYVLLSLSGEDAAEADRVLVDHVPSCARCRATLSELQAVSGDLALA
Ga0207675_10032302613300026118Switchgrass RhizosphereVTNDHEAIDELLAGYVLRSLSGEDAERADHLLSDHVPHCPACRDSLAVFPGVTADLALDASSIE
Ga0209896_100782333300027006Groundwater SandLSEDHERIDELLAGYVLLSLSGEDAAEADRILAEHVPSCGRCRATLNELQAVAGDLALVAAP
Ga0209877_102368423300027032Groundwater SandVTEDHERIDELLAGYVLLSLSGEDAAEADRILVDHVPSCATCRATLSEFQAVSGDLALAEPPVDP
Ga0209878_100801243300027163Groundwater SandVTEDHERIDELLAGYVLLSLSGEDAAEADRILVDHVPSCATCRATLSEFQGVSG
Ga0209846_105802813300027277Groundwater SandLTEDHERIDELLAGYVLLSLSGEDAAEADRVLAEHVPSCGRCRETLSELQAV
Ga0209899_100337113300027490Groundwater SandVTEDHERIDELLAGYVLLSLSGEEATEADRILVDHVPTCATCRATLSQFQAVS
Ga0209874_106833513300027577Groundwater SandVTEDHERIDELLAGYVLLSLSGEEATEADRILVDHVPSCAACRATLSEFQAVSGDL
Ga0209819_1025594813300027722Freshwater SedimentLTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCATCRATLSEFQ
Ga0209481_1039286213300027880Populus RhizosphereLTEDHERIDELLAGYVLLSLSGEDAAEADRILAEHVPSCGRCRATLNELQAVSGDLALA
Ga0209583_1050661823300027910WatershedsMIDHDAIDELLAGYVLRSLTDDDAAEADRLLIDHVPACATC
(restricted) Ga0233417_1059055713300028043SedimentMSPDHERIEELLAGYVLLALEGEDAREADLLLVEHVPSCATCRETLAGFQSVAGDLALVP
(restricted) Ga0233417_1065568723300028043SedimentLTEDHERIDELLAAYVLLALGHEDAAEADRLLADHVPSCARCRRT
Ga0268264_1008027613300028381Switchgrass RhizosphereLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSLDPSP
Ga0247821_1124534623300028596SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSLDPSPV
Ga0247819_1043940313300028608SoilVTEDHERIDELLAGYVLLSLSGEDAAEADRVLIDHVPSCARCRATLS
Ga0307295_1015257123300028708SoilMIDHEAIDELLAGYVLRSLTGEDAEAADRLLTDHVPECTDCLATLDAF
Ga0307307_1024310313300028718SoilLSETHESIEELLAGYVLRSLSGEDAARADHLLSDHVPMCPACRD
Ga0307317_1020701023300028720SoilVTNDHEAIDGLLAGYVLRSLSGEDADEADHLLSDHVPTCAACRDTLAAFQDL
Ga0307320_1018897113300028771SoilVTEDHERIDELLAGYVLLSLSGEEAAEADRILVDHVPSCATCRATLSELQAVSGDLALAA
Ga0307282_1037937213300028784SoilLSETHESIEELLAGYVLRSLSGEDAARADHLLSDHVPMCPACRDSLAMFQAVTA
Ga0307294_1034864613300028810SoilMIDHEAIDELLAGYVLRSLTGEDAEAADRILTDHVPECTDCLATL
Ga0307302_1009262913300028814SoilLTEDHERIDELLAGYVLLSLSGEDAAEADRILAEHVPSCGRCRATLSEMQAVSGDLALA
Ga0307312_1070527713300028828SoilLSETHESIEELLAGYVLRSLSGEDAARADHLLSDHVPMCPACRDSLAMFQAVTADLALEVAPVSPP
Ga0307286_1009243733300028876SoilVTNDHEAIDELLAGYVLRSLSGEDADEADHLLSDHVPTCAACRDTLAA
Ga0299906_1102809813300030606SoilVTDHERIDELLAGYVLRSLEGEDAAEADGVLTDHLPRCPRCQGSLL
Ga0307496_1008853223300031200SoilVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCRATLSDLEAVSGDLAL
Ga0310886_1034429823300031562SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAV
Ga0310886_1051758123300031562SoilVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPTCARCRATLSDP
Ga0307468_10062799723300031740Hardwood Forest SoilVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCRATLSDLEAVSG
Ga0307468_10172111013300031740Hardwood Forest SoilVTNDHEAIDELLAGYVLRSLSGEDAAEADHLLSDHVPTCAACRDTLAAFQDLSADLALDA
Ga0310892_1117967613300031858SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAMFQGVTADLALEA
Ga0310893_1044251223300031892SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSLDP
Ga0310900_1074052613300031908SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAVFQAVTADLSL
Ga0326597_1059301213300031965SoilVTQSHEAIEELLAGYVLRSLSGEDAARADHLLSDHVPSCPACRDSLAVFQGVTADLALAV
Ga0326597_1169822623300031965SoilLSEDHERIDELLAGYVLLSLSGEDAAEADRILAEHVPSCGRCRA
Ga0315278_1135330223300031997SedimentVIEDHEQIEELLAGYVLRSLSGEDATQADELLSDHVPACGRCRDTLADFQ
Ga0310895_1021536723300032122SoilVTEDHERIDELLAGYVLLSLSGEDAAEADQVLIDHVPSCARCRATLSDLEAVSGDLALAA
Ga0315283_1055959543300032164SedimentVIEDHERIEELLAGYVLRSLSGEDAVEADELLSDHVPVCGRCRDTLTDFQ
Ga0315283_1234370113300032164SedimentVTQSHEAIEELLAGYVLRSLSGEDAAQADHLLSDHVPFCPVCRDSLAVFQGVTADLALAAQPLDP
Ga0315268_1139318413300032173SedimentMIDHDAIDELLAGYVLGSLTGDDATEADRLLTEHVPGCADCLAT
Ga0307470_1048205213300032174Hardwood Forest SoilVIDHEAADELLAGYVLGSLTGPDAVEADRLLTEHVPDCLTCRATLDAFQ
Ga0307470_1064571813300032174Hardwood Forest SoilLTETHEAIEELLAGYVLRSLSGEDAERADHLLSDHVPQCPACRDSLAMFQGVTGDLALEAPPIQPPDTL
Ga0315286_1070767713300032342SedimentMIDHDAIDELLAGYVLRSLTGEDAAEADRLLTDHVPGCATCIATLDAFRGLTG
Ga0315275_1060369633300032401SedimentVTQSHEAIEELLAGYVLRSLSGEDAAQADHLLSDHVPFCPACRDSLAVFQGVTADLALAAQP
Ga0315273_1041447253300032516SedimentMIDHDAIDELLAGYVLGSLTGDDATEADRLLTGHVPGCSDCLATL
Ga0315273_1115547713300032516SedimentVTDSHEAIEELLAGYVLRSLSGEDAAQADHLLSDHVPFCPTCRDSLAVFQGVTA
Ga0315273_1148676613300032516SedimentVIEDHERIEELLAGYVLRSLSGEDAVEADELLSDHVPVCGRCRDTLTDFQALSADL
Ga0335085_1138741513300032770SoilMTEDHEAIEELLAGYVLRSLSGDDAARADQLLSDHVPGCAACR
Ga0335084_1112237513300033004SoilMTESHEAIEELLAGYVLRSLSGEDASRADQLLSDHVPTCAACRDTLAVFQ
Ga0316622_10230828513300033416SoilVTENHEVIEELLAGYVLRALSGPDADEADRLLVEHVPGCSACRTTLEAFDAAAADLGLDAPAVMPPDTLLPR
Ga0326730_110602923300033500Peat SoilMTQSHEAIEELLAGYVLRSLSGEDAARADQLLSDHVPSCAACRDTL
Ga0316628_10220183013300033513SoilVTEHHEAIDELLAGYVLRGLSGPDAEQADRLLTEHVPGCAACRATLDAFGS
Ga0364926_040182_746_8893300033812SedimentVRLTEDHERIEELLAGYVLRSLSGEDAAEADRMLTDHVPDCAGCRETL
Ga0364927_0114193_609_7583300034148SedimentLTEDHERIDELLAGYVLLSLSGEDAAEADRVLAEHVPSCGRCRESLSELQ
Ga0314780_166789_3_1523300034659SoilVTEDHERIDELLAGYVLLSLSGEDAAEADRVLIDHVPSCARCRSTLSDLE
Ga0364923_0044433_889_10443300034690SedimentLTEDHERIDEILAGYVLLSLSGEDAAEADRILAEHVPSCGRCRATLNELQAV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.