Metagenome Family F063727

Basic Information
Family ID	F063727
Family Type	Metagenome
Number of Sequences	129
Average Sequence Length	45 residues
Representative Sequence	MKFHDLNTDHVSFVYDLYEVLNVDIKNFVKELLRKRTLITAKAIP
Number of Associated Samples	67
Number of Associated Scaffolds	129

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	64.06 %
% of genes near scaffold ends (potentially truncated)	28.68 %
% of genes from short scaffolds (< 2000 bps)	99.22 %
Associated GOLD sequencing projects	66
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (84.496 % of family members)
Environment Ontology (ENVO)	Unclassified (86.047 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (86.047 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_101748237	Not Available	555	Open in IMG/M
3300005338\|Ga0068868_101304116	Not Available	674	Open in IMG/M
3300005338\|Ga0068868_102215726	Not Available	523	Open in IMG/M
3300005459\|Ga0068867_101417975	Not Available	645	Open in IMG/M
3300005459\|Ga0068867_101776082	Not Available	579	Open in IMG/M
3300005614\|Ga0068856_100972177	Not Available	867	Open in IMG/M
3300005718\|Ga0068866_11421935	Not Available	507	Open in IMG/M
3300006358\|Ga0068871_102320937	Not Available	512	Open in IMG/M
3300006881\|Ga0068865_101840343	Not Available	547	Open in IMG/M
3300009148\|Ga0105243_11610722	Not Available	676	Open in IMG/M
3300013297\|Ga0157378_11789606	Not Available	662	Open in IMG/M
3300013308\|Ga0157375_12175186	Not Available	661	Open in IMG/M
3300014745\|Ga0157377_10787909	Not Available	699	Open in IMG/M
3300014745\|Ga0157377_11694143	Not Available	510	Open in IMG/M
3300015267\|Ga0182122_1001633	Not Available	1410	Open in IMG/M
3300015267\|Ga0182122_1019671	Not Available	718	Open in IMG/M
3300015267\|Ga0182122_1023634	Not Available	685	Open in IMG/M
3300015267\|Ga0182122_1066404	Not Available	515	Open in IMG/M
3300015269\|Ga0182113_1083130	Not Available	528	Open in IMG/M
3300015274\|Ga0182188_1023924	Not Available	646	Open in IMG/M
3300015274\|Ga0182188_1027997	Not Available	620	Open in IMG/M
3300015274\|Ga0182188_1043525	Not Available	554	Open in IMG/M
3300015275\|Ga0182172_1045956	Not Available	585	Open in IMG/M
3300015275\|Ga0182172_1064044	Not Available	531	Open in IMG/M
3300015276\|Ga0182170_1045582	Not Available	588	Open in IMG/M
3300015276\|Ga0182170_1063124	Not Available	535	Open in IMG/M
3300015277\|Ga0182128_1045519	Not Available	592	Open in IMG/M
3300015279\|Ga0182174_1039576	Not Available	632	Open in IMG/M
3300015279\|Ga0182174_1079859	Not Available	514	Open in IMG/M
3300015279\|Ga0182174_1080064	Not Available	514	Open in IMG/M
3300015281\|Ga0182160_1034987	Not Available	646	Open in IMG/M
3300015281\|Ga0182160_1081600	Not Available	507	Open in IMG/M
3300015282\|Ga0182124_1055780	Not Available	565	Open in IMG/M
3300015282\|Ga0182124_1080140	Not Available	507	Open in IMG/M
3300015285\|Ga0182186_1042181	Not Available	614	Open in IMG/M
3300015286\|Ga0182176_1042087	Not Available	630	Open in IMG/M
3300015286\|Ga0182176_1060651	Not Available	561	Open in IMG/M
3300015287\|Ga0182171_1074810	Not Available	529	Open in IMG/M
3300015289\|Ga0182138_1006569	Not Available	1041	Open in IMG/M
3300015289\|Ga0182138_1054595	Not Available	582	Open in IMG/M
3300015294\|Ga0182126_1022358	Not Available	767	Open in IMG/M
3300015294\|Ga0182126_1050539	Not Available	609	Open in IMG/M
3300015294\|Ga0182126_1063546	Not Available	570	Open in IMG/M
3300015294\|Ga0182126_1083332	Not Available	525	Open in IMG/M
3300015295\|Ga0182175_1087714	Not Available	521	Open in IMG/M
3300015296\|Ga0182157_1050272	Not Available	626	Open in IMG/M
3300015298\|Ga0182106_1052122	Not Available	619	Open in IMG/M
3300015298\|Ga0182106_1084891	Not Available	534	Open in IMG/M
3300015298\|Ga0182106_1092230	Not Available	520	Open in IMG/M
3300015299\|Ga0182107_1067590	Not Available	576	Open in IMG/M
3300015300\|Ga0182108_1052904	Not Available	624	Open in IMG/M
3300015300\|Ga0182108_1090963	Not Available	529	Open in IMG/M
3300015304\|Ga0182112_1100444	Not Available	511	Open in IMG/M
3300015305\|Ga0182158_1056163	Not Available	607	Open in IMG/M
3300015305\|Ga0182158_1080664	Not Available	545	Open in IMG/M
3300015305\|Ga0182158_1081170	Not Available	544	Open in IMG/M
3300015321\|Ga0182127_1125143	Not Available	501	Open in IMG/M
3300015322\|Ga0182110_1068104	Not Available	608	Open in IMG/M
3300015341\|Ga0182187_1070380	Not Available	729	Open in IMG/M
3300015341\|Ga0182187_1142054	Not Available	571	Open in IMG/M
3300015342\|Ga0182109_1193517	Not Available	531	Open in IMG/M
3300015342\|Ga0182109_1195440	Not Available	529	Open in IMG/M
3300015343\|Ga0182155_1131731	Not Available	613	Open in IMG/M
3300015343\|Ga0182155_1208563	Not Available	517	Open in IMG/M
3300015343\|Ga0182155_1211478	Not Available	514	Open in IMG/M
3300015344\|Ga0182189_1045488	Not Available	901	Open in IMG/M
3300015344\|Ga0182189_1161083	Not Available	576	Open in IMG/M
3300015344\|Ga0182189_1164909	Not Available	570	Open in IMG/M
3300015345\|Ga0182111_1179366	Not Available	568	Open in IMG/M
3300015345\|Ga0182111_1205085	Not Available	539	Open in IMG/M
3300015346\|Ga0182139_1148994	Not Available	611	Open in IMG/M
3300015346\|Ga0182139_1152651	Not Available	605	Open in IMG/M
3300015346\|Ga0182139_1220605	Not Available	524	Open in IMG/M
3300015347\|Ga0182177_1107101	Not Available	694	Open in IMG/M
3300015347\|Ga0182177_1147562	Not Available	615	Open in IMG/M
3300015347\|Ga0182177_1155703	Not Available	603	Open in IMG/M
3300015355\|Ga0182159_1137451	Not Available	753	Open in IMG/M
3300015355\|Ga0182159_1273150	Not Available	561	Open in IMG/M
3300015355\|Ga0182159_1313715	Not Available	528	Open in IMG/M
3300015355\|Ga0182159_1327103	Not Available	518	Open in IMG/M
3300015361\|Ga0182145_1107827	Not Available	613	Open in IMG/M
3300015361\|Ga0182145_1127220	Not Available	580	Open in IMG/M
3300015361\|Ga0182145_1137742	Not Available	565	Open in IMG/M
3300015361\|Ga0182145_1186443	Not Available	509	Open in IMG/M
3300017404\|Ga0182203_1040518	Not Available	785	Open in IMG/M
3300017404\|Ga0182203_1099746	Not Available	592	Open in IMG/M
3300017404\|Ga0182203_1140742	Not Available	529	Open in IMG/M
3300017404\|Ga0182203_1149886	Not Available	517	Open in IMG/M
3300017407\|Ga0182220_1059582	Not Available	596	Open in IMG/M
3300017409\|Ga0182204_1047189	Not Available	666	Open in IMG/M
3300017409\|Ga0182204_1081717	Not Available	566	Open in IMG/M
3300017409\|Ga0182204_1105043	Not Available	523	Open in IMG/M
3300017410\|Ga0182207_1156367	Not Available	524	Open in IMG/M
3300017413\|Ga0182222_1045238	Not Available	632	Open in IMG/M
3300017420\|Ga0182228_1054725	Not Available	689	Open in IMG/M
3300017420\|Ga0182228_1103193	Not Available	546	Open in IMG/M
3300017424\|Ga0182219_1095627	Not Available	567	Open in IMG/M
3300017424\|Ga0182219_1105937	Not Available	550	Open in IMG/M
3300017424\|Ga0182219_1119719	Not Available	528	Open in IMG/M
3300017424\|Ga0182219_1132843	Not Available	511	Open in IMG/M
3300017425\|Ga0182224_1087958	Not Available	617	Open in IMG/M
3300017425\|Ga0182224_1104137	Not Available	585	Open in IMG/M
3300017425\|Ga0182224_1112064	Not Available	571	Open in IMG/M
3300017425\|Ga0182224_1166548	Not Available	501	Open in IMG/M
3300017427\|Ga0182190_1046059	Not Available	774	Open in IMG/M
3300017427\|Ga0182190_1091954	Not Available	615	Open in IMG/M
3300017436\|Ga0182209_1129634	Not Available	554	Open in IMG/M
3300017442\|Ga0182221_1169909	Not Available	502	Open in IMG/M
3300017443\|Ga0182193_1081183	Not Available	681	Open in IMG/M
3300017443\|Ga0182193_1106011	Not Available	624	Open in IMG/M
3300017443\|Ga0182193_1150951	Not Available	553	Open in IMG/M
3300017443\|Ga0182193_1179947	Not Available	519	Open in IMG/M
3300017680\|Ga0182233_1079153	Not Available	595	Open in IMG/M
3300017681\|Ga0182226_1061449	Not Available	685	Open in IMG/M
3300017683\|Ga0182218_1094814	Not Available	585	Open in IMG/M
3300017683\|Ga0182218_1141231	Not Available	516	Open in IMG/M
3300017684\|Ga0182225_1062429	Not Available	652	Open in IMG/M
3300017684\|Ga0182225_1114833	Not Available	541	Open in IMG/M
3300017684\|Ga0182225_1134473	Not Available	514	Open in IMG/M
3300017685\|Ga0182227_1097443	Not Available	570	Open in IMG/M
3300017689\|Ga0182231_1113673	Not Available	527	Open in IMG/M
3300017690\|Ga0182223_1118957	Not Available	509	Open in IMG/M
3300021060\|Ga0182232_1060806	Not Available	621	Open in IMG/M
3300021060\|Ga0182232_1079275	Not Available	534	Open in IMG/M
3300025908\|Ga0207643_10716362	Not Available	647	Open in IMG/M
3300025927\|Ga0207687_11921435	Not Available	506	Open in IMG/M
3300025937\|Ga0207669_11696330	Not Available	540	Open in IMG/M
3300025938\|Ga0207704_11573137	Not Available	564	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.05%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.75%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.43%
Roots	Host-Associated → Plants → Roots	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.05%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.65%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.65%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.78%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	84.50%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	6.98%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.55%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	1.55%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1017482371	3300005334	Miscanthus Rhizosphere	MKFHDLNMDRVSFVYDFYEVFYIKNFVKELLRKRTLIIVKAIP*
Ga0068868_1013041162	3300005338	Miscanthus Rhizosphere	HDLNTDRVSFVYDLYEVLNVDIKNFVKMLLRKRTLIIAKAVP*
Ga0068868_1022157262	3300005338	Miscanthus Rhizosphere	MDHVSFIYDLYEDLNVERKNLVRELLRKRTLILAKALP*IPEPAFL
Ga0068867_1014179751	3300005459	Miscanthus Rhizosphere	MKFHDLITDHVSFVYDLFEDKNVDIKNLVRELLRKRTLIIAKAIP*
Ga0068867_1017760821	3300005459	Miscanthus Rhizosphere	MKFHDLNAGHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIP*
Ga0068856_1009721771	3300005614	Corn Rhizosphere	MKFHDINEDHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIP*
Ga0068866_114219352	3300005718	Miscanthus Rhizosphere	VLDTKFHDLNTDRVSFVYDLYEVLNVDIKNFVKMLLRKRTLIIAKAIP*
Ga0068871_1023209371	3300006358	Miscanthus Rhizosphere	MDHGRFIYDLDEDLNVERKNLVRKLLCKRTLILAKALP*
Ga0068865_1018403432	3300006881	Miscanthus Rhizosphere	VLVTKFHDLNTDRVSFVYDLYEVLNVDIKNFVKMLLRKKNLDYC*
Ga0105243_116107221	3300009148	Miscanthus Rhizosphere	MKFHDLNAGHVSFVYDLYEVLNVDIKNFVKELLRKRTL
Ga0157378_117896061	3300013297	Miscanthus Rhizosphere	MKFHDLNMDHVSFIYDLYEELNVERKNLFKELLRKRTLFIAKALS*
Ga0157375_121751861	3300013308	Miscanthus Rhizosphere	MKVLDMKFHDLITDHVSFVYDLFKDKNVDIKNFVKELLRKRTLIIAKAIP*
Ga0157377_107879092	3300014745	Miscanthus Rhizosphere	GWFEKVLVTKFHDLNTDRVSFVYDLYEVLNVDIKNFVKKMLLRKRTLIIAKAKP*
Ga0157377_116941431	3300014745	Miscanthus Rhizosphere	FEKVLDMKFHDFITDHVSFVYDLFEDKNVNIKNLVSELLRKRTFIIAKAIP*
Ga0182122_10016331	3300015267	Miscanthus Phyllosphere	MKFHDLNMDHVSFIYDLYEDINVKIKNLVRELLRKRTLILAKALP*
Ga0182122_10196711	3300015267	Miscanthus Phyllosphere	MKFHDLNADHVSFVYDRYEVLNVDIKNFIKVLLRKRTLIIAKAIS*
Ga0182122_10236341	3300015267	Miscanthus Phyllosphere	KVLDMKFHDLNTDHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIP*
Ga0182122_10664041	3300015267	Miscanthus Phyllosphere	MDHVSFVYDIFEDKNVDIKNLVRELLRKRTLIIAKAIP*
Ga0182113_10831302	3300015269	Miscanthus Phyllosphere	MKFHDLNADHVSIVYDLYEVLNVDIKNFVKKLVRKRTLIIDKAIP*
Ga0182188_10239242	3300015274	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLDEELNVQIKNLVRKLLRKRTLFIAKAIP*
Ga0182188_10279971	3300015274	Miscanthus Phyllosphere	LVMKFHDLNTDHVSFLYDLYKVLNVDIKNFVKELLRKRTLIIAKAIT*
Ga0182188_10435251	3300015274	Miscanthus Phyllosphere	VLVTKFHDLNTDRVGFVHDLYEVLNVDIKNFVKMLLRKRTLIIAKAIP*
Ga0182172_10459561	3300015275	Miscanthus Phyllosphere	MKFHDLNTDRVSFVYDLYEVLNVDIKNFVKMLLRKRTLIIAKAIP*
Ga0182172_10640441	3300015275	Miscanthus Phyllosphere	MEVHDLNMDHVSFIYDPYEDLNVERKNLVRELLRKRTLILAKALP*
Ga0182170_10455821	3300015276	Miscanthus Phyllosphere	MDYVSFIYDLDKGLNVERKNLFKALLRKRTLLLAKALP*
Ga0182170_10631242	3300015276	Miscanthus Phyllosphere	MEFHDLNMDHVSFIYDLYEVVYVEIKNLVREILRKRTLFIAKAIP*
Ga0182128_10455191	3300015277	Miscanthus Phyllosphere	MMFHDLSADHVSLIYDCYGDTNVERQNLVRKLLRKRTLFIAKAIP*
Ga0182174_10395761	3300015279	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLFEDKNVEIKNLVRELLRKRTLIIAKAIP*
Ga0182174_10798591	3300015279	Miscanthus Phyllosphere	LNTDHGRFIYDLDEDLNVERKHLVRKLLRKRTLILDKTLP*
Ga0182174_10800641	3300015279	Miscanthus Phyllosphere	VKVLDTKFHDLDSDRVSFVYDLYEVLNVDIKIFVKELLRKRTLVIAKAIP*
Ga0182160_10349871	3300015281	Miscanthus Phyllosphere	MKFYDLITDHVSFVYDLFEDKNVDIKNLVRELLRKRTLIIAKAIP*
Ga0182160_10816001	3300015281	Miscanthus Phyllosphere	LNADHVSFVYDLYEVLNVDIKNFVKELLRERTLIIAKVIP*
Ga0182124_10557801	3300015282	Miscanthus Phyllosphere	MDHVSFIYDPYEDLNVERKNLVRELLRKRTLILAKALPEFPSLHS
Ga0182124_10801401	3300015282	Miscanthus Phyllosphere	FVKVLVMKFHDLNMDHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKALP*
Ga0182186_10421811	3300015285	Miscanthus Phyllosphere	MLDMKFHDLNTDRVSFVYDFYEVFYIKNFVKELLRKRTLIIAKAIP*
Ga0182176_10420871	3300015286	Miscanthus Phyllosphere	MDHVSFIYDLYDDLNVERKNLVRELLRKRTLILAKALP*
Ga0182176_10606512	3300015286	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLDEELNVEIKNLVRKLLRKRTLFIAKAIP*
Ga0182171_10748101	3300015287	Miscanthus Phyllosphere	MKFHDLITDRVSFVYDLFEDKNVDIKNFVKGLLRKRTLIIAKALP*
Ga0182138_10065691	3300015289	Miscanthus Phyllosphere	MKFHDLNMDHVSFIYDSYEDLNVERKNLVRELLCKRTLILAKALP*
Ga0182138_10235001	3300015289	Miscanthus Phyllosphere	VLDTKFHDLNADRVSFVYDLMKFLNVDIKNFVKELLRKNNFDHC*
Ga0182138_10545951	3300015289	Miscanthus Phyllosphere	MDYGRFIYDLDKGLNVERKDLVRELLGKRILFIAKALP*
Ga0182126_10223581	3300015294	Miscanthus Phyllosphere	MKFHDLSADRVSFVYNSREVFYIKNVVKELLRKRTLIIVKAIP*
Ga0182126_10505391	3300015294	Miscanthus Phyllosphere	MKFHNLNADHVSFVYDLFKVLNVDIKNFGKKLLRKRTLIIVKAIP*
Ga0182126_10635461	3300015294	Miscanthus Phyllosphere	MKFHDLIMDHVSFVYDLFEDKNVDIKNFVKELLRKRTLTIAKAIP*
Ga0182126_10833321	3300015294	Miscanthus Phyllosphere	MDHVSFIYDPYEDLNVERKNLVRELLRKRTLILAKALP*
Ga0182175_10877141	3300015295	Miscanthus Phyllosphere	MKFHDLIMDYVSFVYDLFEDKNVDINNFVKKLLRKRTLTIAKAIP*
Ga0182157_10502721	3300015296	Miscanthus Phyllosphere	MKFHDLNAGHVSFVYDLYEVLNVDIKFFVKELLRKRTLVIAKAIP*
Ga0182106_10521221	3300015298	Miscanthus Phyllosphere	MSVHDLIMDHGRFIYDLDKDLNVERKNLVRELLRKRTLFIAKA
Ga0182106_10848911	3300015298	Miscanthus Phyllosphere	SFIYDLYEDLNVERKNLVRELLCKRTLILAKALP*
Ga0182106_10922301	3300015298	Miscanthus Phyllosphere	MKFHDHNTDHVSFVYDLFDDKNVDIKNLVRELLRKRTLIIAKAIP*
Ga0182107_10675901	3300015299	Miscanthus Phyllosphere	VLDIKFHDLNTDRVSFVYDFYEVFYIKNFVKELLRKRTLIIIIAIP*
Ga0182108_10529041	3300015300	Miscanthus Phyllosphere	GTCGWFEKVLDMKFLDLNTDHVSFVYDLYEVLNVDIKNLVRELLCKRTLIIAKAIP*
Ga0182108_10909631	3300015300	Miscanthus Phyllosphere	MKFHDLNAGHVSFVYDLYEVLNVDIKIFVKELLRKRTLVIAKAIP*
Ga0182112_11004441	3300015304	Miscanthus Phyllosphere	MKFHDLIMDHVSFVYDLFEDKNVDIKKFVKELLRKRTLTIAKAIP*
Ga0182158_10561631	3300015305	Miscanthus Phyllosphere	MKFHDLNMDHVSFIYDLYEVLNVEIKNLVRKLLCKRTFILAKALP*
Ga0182158_10806641	3300015305	Miscanthus Phyllosphere	MVFHDLNTDRVSFVYDLMKFLNVDIKNFVKELLHKRTLIIAKAIP*
Ga0182158_10811701	3300015305	Miscanthus Phyllosphere	VLDTKFHDLNTGHVSFVYDLYEVLNVDIENFVKVLLRKRTLIIAKAIP*
Ga0182127_11251431	3300015321	Miscanthus Phyllosphere	MDHVSFIYDRYEDLNVERKNLVGELLRKRTLILAKALP*
Ga0182110_10681041	3300015322	Miscanthus Phyllosphere	MKFHDLITDRVSFVYDLFEDKNVDIKDFVKELLCKRTLIIAKAIP*
Ga0182187_10703801	3300015341	Miscanthus Phyllosphere	MKFHDLNAGHVSFVYDLYEVLNVDIKNFVKVLLRKRILIIAKAIP*
Ga0182187_11420541	3300015341	Miscanthus Phyllosphere	VGYEVHDLITDRVSFVCDLFEDKNVDIKNFVKKLLRKTTLTIAKALP*
Ga0182109_11935171	3300015342	Miscanthus Phyllosphere	SFIYDPYEDLNVERKNLVRELLRKRTLILAKALP*
Ga0182109_11954402	3300015342	Miscanthus Phyllosphere	MKFHDLNADHVSFVYDLYEVLYVEVKNFVKELLRKRTLIIAKAIP*
Ga0182155_11317311	3300015343	Miscanthus Phyllosphere	MKFHDLNMGHVSFIYDLYEVLYIEIKNLVRELLRKRTLILAKALP*
Ga0182155_12085631	3300015343	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLDEELNIEIKNLVRKLLCKRTLFIAKAIP*
Ga0182155_12114781	3300015343	Miscanthus Phyllosphere	LVMKFHDINEDHVSFVYDLYEVLNVDIKIFVKELLRKRTLVIAKAIP*
Ga0182189_10454881	3300015344	Miscanthus Phyllosphere	MKFHDLITGHVSFIYDLFEDINVEIKNLVRELLHKRTLTIVKAIP
Ga0182189_11610831	3300015344	Miscanthus Phyllosphere	MKFHDLNVDHVSFVYDLYEVSNVYIKNFVKVLLRKRTLIIAKAIP*
Ga0182189_11649091	3300015344	Miscanthus Phyllosphere	KEFDMKFHDLNMDHVSFIYDLYEVLNVEIKNFVRELSRKRTLILAKTLP*
Ga0182111_11793661	3300015345	Miscanthus Phyllosphere	EKVLGMKFHDLNADHVSFVYDLYEVLNVDIKNFVKVLLCKRTLIIAKAIP*
Ga0182111_12050851	3300015345	Miscanthus Phyllosphere	RFEKEFDMKFHDLNMDHVSFIYDLYKVLNVEIKNLVREILRKRTLSLVNALP*
Ga0182139_11489941	3300015346	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLYEVLNVERKNLISELLRKRTLFLAKALP*
Ga0182139_11526511	3300015346	Miscanthus Phyllosphere	MEFHDLTMDHVSFIYDLDEVLYVEIKNLVRELLRKRTLFIAKALP*
Ga0182139_12206051	3300015346	Miscanthus Phyllosphere	MKFHDLDMDHVSFIYDLYGVLFVEIKNFVTELLRKRTLILAKALP*
Ga0182177_11071011	3300015347	Miscanthus Phyllosphere	MRFHDLITDHVSFVYDLFEDKNVDIKNLVRELLRKRTLIIAKALP*
Ga0182177_11475621	3300015347	Miscanthus Phyllosphere	WEKVRYEVHGLNTDHGRFIYNLDEGFNVEIKNLVRELLRKRTLIIAKAVP*
Ga0182177_11557031	3300015347	Miscanthus Phyllosphere	FIYDLDEVLMVERKNFVRKLLRKRTLILAKALPWIPEPAFLSLLSCYFG*
Ga0182159_11374511	3300015355	Miscanthus Phyllosphere	MKFHDLNMDHISFIYDLFEDINVEIKNLVRQLLCKRTLFIAKAIP*
Ga0182159_12731501	3300015355	Miscanthus Phyllosphere	VLDTKFHDLNMDRVSSVYNLYEVLNVDIKNFVKMLLRKRTLIIAKAIP*
Ga0182159_13137151	3300015355	Miscanthus Phyllosphere	MEFHDLITDHASFIYDLFEDINVIIKNLVRKLLRKRTWFIAKAIP*
Ga0182159_13271031	3300015355	Miscanthus Phyllosphere	MKFHDLNTDHVSFVYDLYEVLNVDIKNFVKELLRKRTLITAKAIP*
Ga0182145_11078271	3300015361	Miscanthus Phyllosphere	MKFHDLNTDRVSFVYDFMKFLNIDIKNFVKELLCKRTLIIA*
Ga0182145_11272201	3300015361	Miscanthus Phyllosphere	NVDHVSFVYDLYEVLNVDIKNFVKVLLRKRTLIIVIAIP*
Ga0182145_11377422	3300015361	Miscanthus Phyllosphere	MDHVSFIYDLYDDLNVERKNLVRELLLKRTLVLAKALP*
Ga0182145_11864431	3300015361	Miscanthus Phyllosphere	VHDLNMDHVSFIYDLYEDLNVERKNLVRELLRKRTLILAKALP*
Ga0182203_10405181	3300017404	Miscanthus Phyllosphere	VLDMKFHDLNAGHVSFVYDLYEVLNVDITNFVKELLRKRTLIIAKALP
Ga0182203_10997461	3300017404	Miscanthus Phyllosphere	MKFHDLNTDHVSFVYDLYKVLNVDIKNFIKELLRKRTLIIAKAIP
Ga0182203_11407421	3300017404	Miscanthus Phyllosphere	MKFHDLNTDHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIS
Ga0182203_11498861	3300017404	Miscanthus Phyllosphere	VLDMKFHDLNAGHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIP
Ga0182220_10595821	3300017407	Miscanthus Phyllosphere	FHDLNTDHVSFIYDLFEDINVEIKNLVRELLRKRTLILAKALP
Ga0182204_10471891	3300017409	Miscanthus Phyllosphere	VSFIYDLYEYLNVERKNLVIELLHKRTLILAKALP
Ga0182204_10817172	3300017409	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLDEELNVEIKNLVRKLLRKRTLFIAKAIP
Ga0182204_11050431	3300017409	Miscanthus Phyllosphere	VLDTKFDDFNMDHVSFVYDLFDDKNVDIKNFVKELLYKRTLTIAKAIP
Ga0182207_11563671	3300017410	Miscanthus Phyllosphere	VLDMKFHDLIMDHVSFVYDLFEDKNVDIKNFVKELLCKRTLTIAKAIP
Ga0182222_10452382	3300017413	Miscanthus Phyllosphere	VLDMKFHDLITDHVSFVYDLFKDKNVDIKNFVKELLHKRTLIIAKAIP
Ga0182228_10547251	3300017420	Miscanthus Phyllosphere	VLDMKFHDLITDHVSFVYDLFEDKNVDIKNFVKKVLRKRTLIIAKAIP
Ga0182228_11031932	3300017420	Miscanthus Phyllosphere	VLDMKFHDLIMDRVSFVCELFEDKHVVIQNFVKELLRKRTLIIAKALP
Ga0182219_10956271	3300017424	Miscanthus Phyllosphere	VKVLDMKFHDLNMGHVSFVYDLYEVLNVDIKNFVKELLHKRTLIIAKAIP
Ga0182219_11059371	3300017424	Miscanthus Phyllosphere	VLDMKFHDLNIDHVSFVYDRYEVSNVEIKHFVKKLLRKRTLIIAKAIP
Ga0182219_11197192	3300017424	Miscanthus Phyllosphere	MDHVSFIYGLYEDLNVERKNLVRELLRKRTLILAKALP
Ga0182219_11328431	3300017424	Miscanthus Phyllosphere	VKVLVMKFHDLNAGHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIP
Ga0182224_10879581	3300017425	Miscanthus Phyllosphere	MDHGRFIYDLDECFNVERKNLVRELLRKRTLIIAKAIP
Ga0182224_11041371	3300017425	Miscanthus Phyllosphere	MKFHDLNTDHVIFIYDLFEDINVEIKNLVRELLRKRTLTIVKAIP
Ga0182224_11120641	3300017425	Miscanthus Phyllosphere	VLDMKFHDLITDHVSFVYDLCEDKNVDIKNLVRELLRKRTLIIAKAIS
Ga0182224_11665481	3300017425	Miscanthus Phyllosphere	MKFHDLNADHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIPRIS
Ga0182190_10460591	3300017427	Miscanthus Phyllosphere	VWDMKFHDLITDRVSFVCDLFEDKNVDIKNFVKELLRKRTLIIAKAIP
Ga0182190_10919541	3300017427	Miscanthus Phyllosphere	MKFHDFNMDHVSFIYDIYEVVNVERKNLARELLRKRTLILAKALP
Ga0182209_11296341	3300017436	Miscanthus Phyllosphere	MKFHDLIMDHVSFVYDLFEDKNVDIKNLVRVLLQKRTLIIAKVIP
Ga0182221_11699091	3300017442	Miscanthus Phyllosphere	FHDLITDRVSFVYDLMKFLNVNIKNFVKELLRKRTLIIAKAIP
Ga0182193_10811832	3300017443	Miscanthus Phyllosphere	DLITDCVSFVYDLFEDRKVDIKDFVKELLRKRTLITAKAIP
Ga0182193_11060111	3300017443	Miscanthus Phyllosphere	MDHVSFIYGLYEDLMVERKNLVRELLRKRTLILAKALP
Ga0182193_11509512	3300017443	Miscanthus Phyllosphere	MKFYDLNTDRVSFVYDLMKFLNDDIKNFVKELFRKRTLIIAKAIL
Ga0182193_11799471	3300017443	Miscanthus Phyllosphere	MKFHDLIMDHVSFIYDLYEDLNVERKNHDRELLCKRTLILAKALP
Ga0182233_10791532	3300017680	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLFEDKNVEIKNLVRELLRKRTLIFAKALH
Ga0182226_10614491	3300017681	Miscanthus Phyllosphere	MKFHDLNSDHVNFVYDLYEVLIVDIKNFVKELLHKRTLIIDKAIP
Ga0182218_10948142	3300017683	Miscanthus Phyllosphere	MDHVSFIYDLYEDLIVERKNLVRELLRKRTLILAKALP
Ga0182218_11412311	3300017683	Miscanthus Phyllosphere	EKEFDMKFHDLNMDHVSFIYDLCEDLNVERKNLARELLCKRTLILARALP
Ga0182225_10624291	3300017684	Miscanthus Phyllosphere	MDHVSFIYDFYEELNIERKNLVRELLRKRTLIIAKALP
Ga0182225_11148331	3300017684	Miscanthus Phyllosphere	DMKFHDLNVDHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKATP
Ga0182225_11344731	3300017684	Miscanthus Phyllosphere	MKFHDLNTDHVSFIYDLFEDKNVEIKNLVRELLRKRTLIIAKALP
Ga0182227_10974431	3300017685	Miscanthus Phyllosphere	PVSFVYDLYEVLNVDIKNFVKEVLRKRTLTIAKAIP
Ga0182231_11136731	3300017689	Miscanthus Phyllosphere	MKFLDLNTDHVSFIYDLFEDKNVEIKNLVREILRKRTLIIAKAIP
Ga0182223_11189571	3300017690	Miscanthus Phyllosphere	LNADHVSFVYDLYEVLNVDIKNFVKELLRKRTLIIAKAIP
Ga0182232_10608061	3300021060	Phyllosphere	VLDMKFHDLNAGHVSFVYDLYEVLNVDIKIFVKELLRKRTLVIAKA
Ga0182232_10792751	3300021060	Phyllosphere	VLDMKFHDLITGHVSFIYDLFEDINVEIKNLVRELLRKRTLTIVKAIP
Ga0207643_107163621	3300025908	Miscanthus Rhizosphere	MDHVSFIYDLYEVLNVERKNLVRELLRKRTLILAKALP
Ga0207687_119214351	3300025927	Miscanthus Rhizosphere	VLVTKFHDLNTDRVSFVYDLYEVLNVDIKNFVKMLLRKRTLIIAKAIP
Ga0207669_116963301	3300025937	Miscanthus Rhizosphere	VLDTKFHDLNTDRVSFVYDLYEVLNVDIKNFVKMLLRKRTLIITKAIP
Ga0207704_115731371	3300025938	Miscanthus Rhizosphere	NMDHVIFIYGLYEDLNVERKNLVRELLRKRTLILAKALP

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F063727

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign