NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063780

Metagenome / Metatranscriptome Family F063780

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063780
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 45 residues
Representative Sequence MAELAALELEHKAAAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIW
Number of Associated Samples 119
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 19.38 %
% of genes near scaffold ends (potentially truncated) 98.45 %
% of genes from short scaffolds (< 2000 bps) 92.25 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.264 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.008 % of family members)
Environment Ontology (ENVO) Unclassified
(30.233 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.209 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.21%    β-sheet: 7.89%    Coil/Unstructured: 57.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF03466LysR_substrate 51.94
PF00126HTH_1 38.76
PF06073DUF934 2.33
PF01077NIR_SIR 1.55
PF03328HpcH_HpaI 0.78
PF13241NAD_binding_7 0.78
PF01507PAPS_reduct 0.78
PF07394DUF1501 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG3749Uncharacterized conserved protein, DUF934 familyFunction unknown [S] 2.33
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.78
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.78
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.26 %
UnclassifiedrootN/A45.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001179|JGI12660J13575_103576All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300001545|JGI12630J15595_10035906Not Available1013Open in IMG/M
3300002245|JGIcombinedJ26739_100161277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2120Open in IMG/M
3300002245|JGIcombinedJ26739_100857532Not Available790Open in IMG/M
3300002916|JGI25389J43894_1016319All Organisms → cellular organisms → Bacteria → Proteobacteria1279Open in IMG/M
3300003152|Ga0052254_1056601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria591Open in IMG/M
3300003911|JGI25405J52794_10103077All Organisms → cellular organisms → Bacteria → Proteobacteria637Open in IMG/M
3300005171|Ga0066677_10132830All Organisms → cellular organisms → Bacteria → Proteobacteria1349Open in IMG/M
3300005329|Ga0070683_101006405All Organisms → cellular organisms → Bacteria → Proteobacteria800Open in IMG/M
3300005335|Ga0070666_10769632All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria708Open in IMG/M
3300005336|Ga0070680_100062944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3039Open in IMG/M
3300005341|Ga0070691_10095740Not Available1469Open in IMG/M
3300005345|Ga0070692_10759307All Organisms → cellular organisms → Bacteria → Proteobacteria658Open in IMG/M
3300005435|Ga0070714_102510369All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300005536|Ga0070697_101452195Not Available613Open in IMG/M
3300005548|Ga0070665_100331497All Organisms → cellular organisms → Bacteria → Proteobacteria1526Open in IMG/M
3300005549|Ga0070704_100543400All Organisms → cellular organisms → Bacteria → Proteobacteria1014Open in IMG/M
3300005578|Ga0068854_101065586All Organisms → cellular organisms → Bacteria → Proteobacteria719Open in IMG/M
3300005578|Ga0068854_101918789All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria545Open in IMG/M
3300005591|Ga0070761_10829815All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300005616|Ga0068852_102207645All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria572Open in IMG/M
3300005617|Ga0068859_103075884All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300005842|Ga0068858_101801385All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300006237|Ga0097621_102135550All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria536Open in IMG/M
3300006579|Ga0074054_11506772All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300006794|Ga0066658_10859025All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300006804|Ga0079221_10483788Not Available797Open in IMG/M
3300006852|Ga0075433_10442201All Organisms → cellular organisms → Bacteria → Proteobacteria1146Open in IMG/M
3300006854|Ga0075425_102515082All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300007265|Ga0099794_10409355Not Available709Open in IMG/M
3300007788|Ga0099795_10351636All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria659Open in IMG/M
3300009093|Ga0105240_11246309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria786Open in IMG/M
3300009098|Ga0105245_11754821Not Available673Open in IMG/M
3300009551|Ga0105238_10228541Not Available1837Open in IMG/M
3300009551|Ga0105238_11183052Not Available789Open in IMG/M
3300009650|Ga0105857_1260385All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria522Open in IMG/M
3300010040|Ga0126308_11188857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria539Open in IMG/M
3300010361|Ga0126378_13055806Not Available533Open in IMG/M
3300010371|Ga0134125_11194906Not Available831Open in IMG/M
3300010376|Ga0126381_100274621All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_302296Open in IMG/M
3300010376|Ga0126381_101247915Not Available1074Open in IMG/M
3300010396|Ga0134126_11667429Not Available700Open in IMG/M
3300010396|Ga0134126_12978972All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria512Open in IMG/M
3300010397|Ga0134124_12665778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria543Open in IMG/M
3300012285|Ga0137370_10170503All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1266Open in IMG/M
3300012582|Ga0137358_10781181All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria636Open in IMG/M
3300012924|Ga0137413_10594005Not Available827Open in IMG/M
3300014150|Ga0134081_10332099All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria553Open in IMG/M
3300014326|Ga0157380_13263370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria518Open in IMG/M
3300014501|Ga0182024_10457084All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1635Open in IMG/M
3300015054|Ga0137420_1226764All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria510Open in IMG/M
3300015372|Ga0132256_103837475All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria505Open in IMG/M
3300016319|Ga0182033_10958205Not Available760Open in IMG/M
3300016319|Ga0182033_11083311Not Available715Open in IMG/M
3300016422|Ga0182039_10094100All Organisms → cellular organisms → Bacteria2193Open in IMG/M
3300016445|Ga0182038_12021308All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria522Open in IMG/M
3300017948|Ga0187847_10392942Not Available762Open in IMG/M
3300017959|Ga0187779_11331871All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria509Open in IMG/M
3300017972|Ga0187781_10085321All Organisms → cellular organisms → Bacteria → Proteobacteria2184Open in IMG/M
3300017974|Ga0187777_11183918All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria558Open in IMG/M
3300017975|Ga0187782_11217685All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria589Open in IMG/M
3300018058|Ga0187766_10143370Not Available1478Open in IMG/M
3300018433|Ga0066667_12051437All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria527Open in IMG/M
3300019888|Ga0193751_1260534All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria526Open in IMG/M
3300021168|Ga0210406_10037027All Organisms → cellular organisms → Bacteria → Proteobacteria4362Open in IMG/M
3300021178|Ga0210408_10645975Not Available836Open in IMG/M
3300021401|Ga0210393_10353206All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1197Open in IMG/M
3300021402|Ga0210385_10893741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria682Open in IMG/M
3300021420|Ga0210394_11830326All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria505Open in IMG/M
3300021474|Ga0210390_11568376Not Available519Open in IMG/M
3300021479|Ga0210410_10230787All Organisms → cellular organisms → Bacteria → Proteobacteria1659Open in IMG/M
3300021560|Ga0126371_10597515Not Available1252Open in IMG/M
3300021560|Ga0126371_13691622All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria516Open in IMG/M
3300022507|Ga0222729_1071569All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300023268|Ga0247765_1134936All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria530Open in IMG/M
3300025909|Ga0207705_10479470Not Available965Open in IMG/M
3300025913|Ga0207695_10874601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria778Open in IMG/M
3300026118|Ga0207675_101300022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria748Open in IMG/M
3300026142|Ga0207698_12476641All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria529Open in IMG/M
3300027502|Ga0209622_1090381All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria561Open in IMG/M
3300027643|Ga0209076_1114094Not Available764Open in IMG/M
3300027894|Ga0209068_10312586Not Available884Open in IMG/M
3300030503|Ga0311370_11671717Not Available655Open in IMG/M
3300030520|Ga0311372_11283100Not Available927Open in IMG/M
3300030906|Ga0302314_10839099Not Available912Open in IMG/M
3300031543|Ga0318516_10108431Not Available1574Open in IMG/M
3300031544|Ga0318534_10373077Not Available820Open in IMG/M
3300031545|Ga0318541_10426175Not Available742Open in IMG/M
3300031545|Ga0318541_10557584Not Available641Open in IMG/M
3300031616|Ga0307508_10634713Not Available672Open in IMG/M
3300031668|Ga0318542_10574974All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria587Open in IMG/M
3300031708|Ga0310686_101614343Not Available857Open in IMG/M
3300031744|Ga0306918_10482205Not Available970Open in IMG/M
3300031747|Ga0318502_10207621Not Available1134Open in IMG/M
3300031768|Ga0318509_10136428Not Available1347Open in IMG/M
3300031769|Ga0318526_10136320Not Available995Open in IMG/M
3300031777|Ga0318543_10197876Not Available892Open in IMG/M
3300031778|Ga0318498_10156978Not Available1036Open in IMG/M
3300031779|Ga0318566_10545226All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria567Open in IMG/M
3300031780|Ga0318508_1224205All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria539Open in IMG/M
3300031793|Ga0318548_10031281All Organisms → cellular organisms → Bacteria → Proteobacteria2337Open in IMG/M
3300031797|Ga0318550_10293974Not Available788Open in IMG/M
3300031821|Ga0318567_10156447Not Available1262Open in IMG/M
3300031833|Ga0310917_10177324Not Available1418Open in IMG/M
3300031860|Ga0318495_10213343Not Available868Open in IMG/M
3300031894|Ga0318522_10094733Not Available1101Open in IMG/M
3300031912|Ga0306921_11348369Not Available787Open in IMG/M
3300031946|Ga0310910_11493593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria518Open in IMG/M
3300031962|Ga0307479_10949012Not Available831Open in IMG/M
3300032008|Ga0318562_10365839Not Available838Open in IMG/M
3300032010|Ga0318569_10142729Not Available1099Open in IMG/M
3300032039|Ga0318559_10575924All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria525Open in IMG/M
3300032042|Ga0318545_10072089Not Available1189Open in IMG/M
3300032042|Ga0318545_10131064Not Available887Open in IMG/M
3300032044|Ga0318558_10039753All Organisms → cellular organisms → Bacteria → Proteobacteria2034Open in IMG/M
3300032054|Ga0318570_10046396All Organisms → cellular organisms → Bacteria → Proteobacteria1789Open in IMG/M
3300032059|Ga0318533_10374881Not Available1038Open in IMG/M
3300032064|Ga0318510_10230576Not Available756Open in IMG/M
3300032089|Ga0318525_10105188Not Available1440Open in IMG/M
3300032180|Ga0307471_102646968Not Available636Open in IMG/M
3300032261|Ga0306920_100307953All Organisms → cellular organisms → Bacteria → Proteobacteria2358Open in IMG/M
3300032261|Ga0306920_103188016All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria614Open in IMG/M
3300032893|Ga0335069_10045669All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5798Open in IMG/M
3300032898|Ga0335072_11345746Not Available622Open in IMG/M
3300033134|Ga0335073_10872848Not Available952Open in IMG/M
3300033158|Ga0335077_11388711Not Available677Open in IMG/M
3300033289|Ga0310914_11001275Not Available736Open in IMG/M
3300033290|Ga0318519_10741665All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria602Open in IMG/M
3300034384|Ga0372946_0140002Not Available1152Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.20%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.10%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.10%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.88%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.55%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.78%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001179Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300003152Freshwater sediment microbial communities from Loktak Lake, IndiaEnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12660J13575_10357623300001179Forest SoilMGEVAALELEHKATAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIWSYLP
JGI12630J15595_1003590613300001545Forest SoilMGDLAALELEHKAAAVRTQLTAALGQHGRLVYSNS
JGIcombinedJ26739_10016127713300002245Forest SoilMGDLAALELEHKAAAVRTQLTAALGQHGRLVYSNSLGAEAMVLTDI
JGIcombinedJ26739_10085753213300002245Forest SoilMGELLNLELEQKAVGVRERLAAAIQEYGRVIYSSSLGAESVV
JGI25389J43894_101631923300002916Grasslands SoilMGDLAALELEHKAAAVRTLLTGALGQHGRLVYSNSLGAEAMVLTDI
Ga0052254_105660113300003152SedimentMRGLPPIVLATMGELLNLELEQKATAVRERLAAAVAEYGKIVYSSSLGAEAIVLTDIIW
JGI25405J52794_1010307713300003911Tabebuia Heterophylla RhizosphereMGDVLTLELEQKAAAVRDQLAAAVQEYGRVVYSNSLGAEAMVLTDII
Ga0066677_1013283013300005171SoilMAELTALGLERKAAAVHAQLAAALARHGRLVYSNSLGAEAMVLTDIIATQL
Ga0070683_10100640523300005329Corn RhizosphereMGELLNLDLDLEQKASAVREQLSAAVRQYGRVIYSNSLGAEAMVLTDIIWSHV
Ga0070666_1076963213300005335Switchgrass RhizosphereMGGPEPIVPPTMGELLNLELEQKAIAVRERLHSAVAEYGRVVYSSSLGAESVVLTDIIWSHVPGID
Ga0070680_10006294413300005336Corn RhizosphereMGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLGAEAMVLTDIIWSH
Ga0070691_1009574023300005341Corn, Switchgrass And Miscanthus RhizosphereMGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLARKPWC*
Ga0070692_1075930713300005345Corn, Switchgrass And Miscanthus RhizosphereMGDVLTLELEQKAAAVRDALQAAVRDHGRVVYSNSLGAEAMVLTDI
Ga0070714_10251036913300005435Agricultural SoilMRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTDIIW
Ga0070697_10145219523300005536Corn, Switchgrass And Miscanthus RhizosphereMAEVAALELEHKAAAVRAQLAAALGQHGRLVYSNSLGAEAMVL
Ga0070665_10033149733300005548Switchgrass RhizosphereMRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTDI
Ga0070704_10054340013300005549Corn, Switchgrass And Miscanthus RhizosphereMRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMV
Ga0068854_10106558613300005578Corn RhizosphereMGELLNLELEQKAVAVRERLAAAVAEYGRVIYSSSLGAESIVLTDI
Ga0068854_10191878923300005578Corn RhizosphereMGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLGAEAMVLT
Ga0070761_1082981523300005591SoilMGALAGVEIERKAAAVRSLLGEALERHGRLIYANSLGAEAMVLTD
Ga0068852_10220764513300005616Corn RhizosphereMRDPTSAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTD
Ga0068859_10307588413300005617Switchgrass RhizosphereMGDVLTLELEQKAAAVRDTLASGVQQYGRVVYSNSLGAEAMVLTDIICGH
Ga0068858_10180138523300005842Switchgrass RhizosphereVAIVHRIMGELLTLELEQKATAVREHLAAAVREHGRVVYSNSLGAEAMVLTDIIW
Ga0097621_10213555023300006237Miscanthus RhizosphereMGDVLTLELEQKAAAVRDTLASGVQQYGRVVYSNSLGAEA
Ga0074054_1150677223300006579SoilMRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGAE
Ga0066658_1085902513300006794SoilMAELTALGLERKAAAVHAQLAAALARHGRLVYSNSLGAEAMVLTDIIAT
Ga0079221_1048378813300006804Agricultural SoilMGNLLNLDLEQKAVSVREQLAAAVRDHGRVIYSNSLG
Ga0075433_1044220113300006852Populus RhizosphereMPELEHKAAAVRALLGRALAQHGRLAYANSLGAEAMVLTD
Ga0075425_10251508213300006854Populus RhizosphereMAELPIADLKQKAAAVRALLGRALEQHARLAYANSLGAEAMVLTDIIWT
Ga0099794_1040935513300007265Vadose Zone SoilMAEVAALELEHKAAAVRAQLVAALGLHRRLVYSNS
Ga0099795_1035163623300007788Vadose Zone SoilMGEVLTLDLEQKAVSVRDQLAAAVQAYGRVVYSNSLGAEAMVLTDIIWTH
Ga0105240_1124630913300009093Corn RhizosphereMGELLNLELEQKAVAVRERLAAAVSEYGRVVYSSSLGAESIV
Ga0105245_1175482123300009098Miscanthus RhizosphereMGDVLTLELEQKALATREALQSAVQQFGKVVYSNSLGAEAMVLTDIIWTHF
Ga0105238_1022854113300009551Corn RhizosphereMGELLNLELEQKAVAVRERLAAAVAEYGRVVYSSSLGAESIVLT
Ga0105238_1118305223300009551Corn RhizosphereMGELLNLELEQKAAAVRERLAAAVAEYGKVVYSSSLGAEAIDLTDIIWTHV
Ga0105857_126038513300009650Permafrost SoilMGEVLSLDLENKAVAVRQFLGAALREHGRVVYASSLGAEAM
Ga0126308_1118885713300010040Serpentine SoilMGEVLTLELEQKAGAARELLASAVRQYGKVVYSNSLG
Ga0126378_1305580623300010361Tropical Forest SoilMMGESPKSGLERKAADVRVFLGNALAEHGRLVYANSLGAEAMVLTDLIWSHLPE
Ga0134125_1119490623300010371Terrestrial SoilMGELLNLELEQKAAAVRERLAAAVAEYGKVIYSSSLGAEAIVL
Ga0126381_10027462163300010376Tropical Forest SoilMAELAVTDLEQMTAAVRALLSSALARHGRLVYSNSLGAEAMVLTDI
Ga0126381_10124791523300010376Tropical Forest SoilMAELAALELEQKAAAVRALLGSALAQYGRLVYSNSLG
Ga0134126_1166742913300010396Terrestrial SoilMGELLNLDLEQKAVDVREQLLAAVRDHGRVVYSNSLGAEAMVLTDII
Ga0134126_1297897213300010396Terrestrial SoilMGELLTLELEQKAISVREQLAAAVQEYGRVVYSNSL
Ga0134124_1266577813300010397Terrestrial SoilMAELPIADLEQKAAAVRALLGSALEQHARLAYANSLGAE
Ga0137370_1017050333300012285Vadose Zone SoilMGELAALELEHKAAAVRAQLAGALGPHGRLVYSNSRGAEAMVLTDIIWSYLP
Ga0137358_1078118123300012582Vadose Zone SoilMAELAALELEHKATAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIWSYLPQID
Ga0137413_1059400513300012924Vadose Zone SoilMGELLNLELEQKVAAVRERLAAAVGEYGRVVYSNSLGAEAMVLTDIIWSNVPE
Ga0134081_1033209913300014150Grasslands SoilMGDLAALELEHKAAAVRTLLTGALGQHGRLVYSNSLGAEAMV
Ga0157380_1326337023300014326Switchgrass RhizosphereMGEVLTLELEQKAIAVREMLADAVQQYGKVIYSNSL
Ga0182024_1045708413300014501PermafrostMAAVLSRELEQKAGAVRAGLAAALHQYGRLIYSNSLGAEAMVLTDII
Ga0137420_122676413300015054Vadose Zone SoilMAELAALELEHKATAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIWSHLVVP
Ga0132256_10383747523300015372Arabidopsis RhizosphereMRDPTIAELQDKTAAVRAQLADALARFGRLVYSNSLGA
Ga0182033_1095820523300016319SoilMPELDQKAATVRSLLGAALAQHGRLAYANSLGAEAMVLTDIIW
Ga0182033_1108331113300016319SoilMAELATADLEQKAAGVSALLGHALARYGRLVYANSL
Ga0182039_1009410043300016422SoilMAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAEAMVLTDI
Ga0182038_1202130823300016445SoilMAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAEAMVLTDIIW
Ga0187847_1039294213300017948PeatlandMAQILTLELESKAVQVRDFLTAAVQKYGRLVYANSLGAEAMVLTDIICNS
Ga0187779_1133187113300017959Tropical PeatlandMGELASVDLEHKAAAVRELLAEALAEHGRLVYSNS
Ga0187781_1008532113300017972Tropical PeatlandMAELRQLEQQADAVRALLADALAQHGRLVYANSLGAEAMV
Ga0187777_1118391813300017974Tropical PeatlandMAELTPELERQAAALRRLLTEALARYGRLVYSNSLGAEAMV
Ga0187782_1121768513300017975Tropical PeatlandMAELTKQQLEYRAAAVRSELAAALTQHGRLVYANSL
Ga0187766_1014337013300018058Tropical PeatlandMAELPTADLEQKVADVRAVLGRALAQHRRLVYANSLGAEAM
Ga0066667_1205143713300018433Grasslands SoilMGELLTLELEQKAIAVREQLAAAVQEYGRVVYSNSLGAEAM
Ga0193751_126053413300019888SoilMPIVRGTMADLPSAELETKAAAVRGLLAEALARHGRLVYANSLGAEAVVLTDIIWSHL
Ga0210406_1003702763300021168SoilMPEVEHKAAVARELLGRALAQHGELVYANSLGAEAMV
Ga0210408_1064597513300021178SoilMREPTTTGLELLASATRERLSAALARHGRLVYSNSLGAEAIVLTDIIWSH
Ga0210393_1035320623300021401SoilMAQILTLELESKAAQVREFLSAAVQRFGRVVYANSLGAEAMVLTDII
Ga0210385_1089374123300021402SoilMGEVLNLELEQKVVAVRERLAAAVQEYGRVIYSSSLGAESVVLTDIIWTHFPTID
Ga0210394_1183032623300021420SoilMAVLLSRELKHKAEAVRAGLAAALDSYGRLIYSNSLGAEAMVLTDIIWSHLPQIEI
Ga0210390_1156837613300021474SoilMRERLNLDLEQKAAGVRERLAAAVRAHGRVTYSNSLGAEAMVL
Ga0210410_1023078713300021479SoilMTIVASIMGELTAFGWAHKAANVRARLAAALARHGRLVYSNSLGAEAMV
Ga0126371_1059751513300021560Tropical Forest SoilMAELAALELEQKAAAVRALLGSALAQYGRLVYSNSLGAEAMVLTDIIW
Ga0126371_1369162213300021560Tropical Forest SoilMLAIVGPTMAELPTPELEQKAATVRTLLEGALGRHGQLVYANSLGAEAMVLTDIIWTH
Ga0222729_107156923300022507SoilLNLELEQKAVTVRERLAAAVQEYGRVVYSSSLGAESVVLTDIIWTICRQ
Ga0247765_113493613300023268Plant LitterMAQLSALELETKAAAVRELLTASVREHGKVVYANSLGAEAMV
Ga0207705_1047947013300025909Corn RhizosphereMGELLNLDLDLEQKASAVREQLSAAVCQYGRVIYSNSLGAEAMVLTDII
Ga0207695_1087460113300025913Corn RhizosphereMGELLNLELEQKAVAVRERLAAAVSEYGRVVYSSSLGAE
Ga0207675_10130002213300026118Switchgrass RhizosphereMGEVLTLELEQKAIAVREMLADAVQQYGKVIYSNSLGAE
Ga0207698_1247664123300026142Corn RhizosphereMRDPTSAELQDKTAAVRAQLADALARFGRLVYSNSLGAEAMVLTDIIWTHFPA
Ga0209622_109038113300027502Forest SoilMAELPTPELEQKAATVRALLEGALERHGHLVYANSLG
Ga0209076_111409413300027643Vadose Zone SoilMAELAALELEHKAAAVRAQLAAALGQHGRLVYSNSLGAEAMVLTDIIW
Ga0209068_1031258623300027894WatershedsMGKLATLELEDRTAQVRAQLAAALEQHGRLIYSNSLGAES
Ga0311370_1167171723300030503PalsaMAQILTLELEAKAAQVREFLAGMVQQYGRVVYANSLGAEAMVLTDII
Ga0311372_1128310023300030520PalsaMGELLNLELEQKAIAVRERLAAAVENYGRVVYSSSLGAESVVLTDI
Ga0302314_1083909913300030906PalsaMGELLNLELEQKAIAVRERLAAAVENYGRVVYSSSLGAESV
Ga0318516_1010843113300031543SoilMAQLPIADLEQKAAAVRALLGRALEQHGRLAYANSLGAEAMVLTDIIWRDLPK
Ga0318534_1037307713300031544SoilMAQLPIADLEHKAAAVRALLGRALEQHGRLAYANSLGA
Ga0318541_1042617513300031545SoilMAELVTPDLELQRKAADVRGLLAGALDRHGRLVYANSLGAEAIVLTDIIWTHLP
Ga0318541_1055758423300031545SoilMPDLSTPELENKAAAVGALLRRALAQYGRLVYANSLG
Ga0307508_1063471313300031616EctomycorrhizaMGELLTLELEQKAVAVREQLAAAVQEFGRVVYSNSLGAEAMVLTDIIWPHVP
Ga0318542_1057497423300031668SoilMAEVPTADLEQKAAGVTALLGLALGSYGRLVYANSLGAEAMVLTDIIWTHL
Ga0310686_10161434323300031708SoilMAAVLSRELEQKAGAVRAGLAAALHQYGRLIYSNSLGAEAMVLTDIIW
Ga0306918_1048220513300031744SoilMAELPTVELERKAAGVRSLLEDALARHGRLVYSNSLGAEAMVLTDII
Ga0318502_1020762113300031747SoilMPELEKKAAAVRSLLAAASSQHGRLVYANSLGAEAMVLTDIIW
Ga0318509_1013642823300031768SoilMAELPTVELEEKAAGVRALLGDALARHGRLVYANSL
Ga0318526_1013632013300031769SoilMGELPTPGLEQKAAAVRDLLERALARHGRLVYANSLGAEAMAL
Ga0318543_1019787613300031777SoilMPELEQKAAAVRSLLAAASSQHGRLVYANSLGAEA
Ga0318498_1015697813300031778SoilMPELEQKAAAVRSLLAAASSQHGRLVYANSLGAEAMVLTDII
Ga0318566_1054522623300031779SoilMGELPTPGLEQKAAAVRDLLERALARHGRLVYANSLGAEAMALTDII
Ga0318508_122420523300031780SoilMQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMV
Ga0318548_1003128133300031793SoilMPELEQKATAARLLLHRALGEHGRLVYSNSLGAEAMA
Ga0318550_1029397423300031797SoilMGELPTPGLEQKAAAVRDLLERALALHGRLVYANSLGAEAMAL
Ga0318567_1015644713300031821SoilMQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMVLTDIIWTDLP
Ga0310917_1017732433300031833SoilMAELPTVELEEKAAGVRALLGDALARHGRLVYANSLGAEAMVLTDL
Ga0318495_1021334313300031860SoilMPELEQKAADVRALLGRTLAEHGRLVYANSLGAEAMVLT
Ga0318522_1009473323300031894SoilMAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAEAMVLTDIDC
Ga0306921_1134836923300031912SoilMAELPTAELEEKAAGVRALLGYALARHGRLVYANSLGAEAMVLTDI
Ga0310910_1149359313300031946SoilMAVLPMPELEPKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTDII
Ga0307479_1094901223300031962Hardwood Forest SoilMGELLTLELEQKATAVREQLAAAVQEYGRVVYSNSL
Ga0318562_1036583913300032008SoilMQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMVLTDIIW
Ga0318569_1014272923300032010SoilMPELEQKAAAVRSLLAAASSQHGRLVYANSLGAEAMVLTDI
Ga0318559_1057592413300032039SoilMPELEQKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTDIIW
Ga0318545_1007208913300032042SoilMPELEPKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTDIIWT
Ga0318545_1013106423300032042SoilMAQLPIADLEHKAAAVRALLGRALEQHGRLAYANSLGAEAMVLTDINWR
Ga0318558_1003975313300032044SoilMPELDQKAATVRSLLGAALAQHGRLAYANSLGAEAM
Ga0318570_1004639613300032054SoilMQELEQKAAAVRTLLEAALAQHGRLVYANSLGAEAMVLTDII
Ga0318533_1037488123300032059SoilMPELEPKATAARLLLRRALGEHGRLVYSNSLGAEAMVLTD
Ga0318510_1023057613300032064SoilMAELPATDLEQKAAAVRALLGRALAQHGRLVYANSLGAE
Ga0318525_1010518813300032089SoilMAELPTVELERKAAGVRSLLEDALARHGRLVYSNSLGAEAMVLTD
Ga0307471_10264696813300032180Hardwood Forest SoilMGDLAALELEDKAAAVRTQLADALAHHGRLVYSNSLGAEAMVLTDIIWSHLPQ
Ga0306920_10030795343300032261SoilMAVLPMPELEQKATAARLLLRRALGEHGRLVYSNSLGAEAMVL
Ga0306920_10318801613300032261SoilMAELAALGLEQRAAAVRELLGSALARFGRLVYSNSLGAEAMVLTDII
Ga0335069_1004566993300032893SoilMGAVLTLELEQRAAAVREQLKAALREHGRVVYSNSLGAEAMVLTDIIWTG
Ga0335072_1134574613300032898SoilMGDLLNLDLEQKAHGVRERLAAAVREHGRVTYSNSLGAEAMV
Ga0335073_1087284823300033134SoilVGQVLTLDLESKAAAARELLMAAAREYGRVVYANSLGLEAMVLTDIIGSHL
Ga0335077_1138871113300033158SoilMGELASAELEQKAASVRELLAEALAEYGRLVYSNSLGAEAM
Ga0310914_1100127513300033289SoilMAELVTPDLELQRKAADVRGLLAGALDRHGRLVYANSLGAEAIVLTDIIWTHLPQI
Ga0318519_1074166523300033290SoilMAELATPDLELQRKAADVRELLAGALGRHGRLVYANSLGAEAIVLTDII
Ga0372946_0140002_1039_11523300034384SoilMGELLTLELEQKAVAVREQLAAAVQEYGRVVYSNSLGA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.