NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063865

Metagenome / Metatranscriptome Family F063865

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063865
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 104 residues
Representative Sequence MESVFKGIEKLGSAGLVLEAILVSLLGILLLVGFIVLRRWYRARYFYKRNHRTVALRSQWDDILSGKIPAEDWRFKPLDCDIVESILLDSIEMSAADKLPPLLDCL
Number of Associated Samples 103
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.19 %
% of genes near scaffold ends (potentially truncated) 96.12 %
% of genes from short scaffolds (< 2000 bps) 88.37 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.124 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.504 % of family members)
Environment Ontology (ENVO) Unclassified
(32.558 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(69.767 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 68.66%    β-sheet: 0.00%    Coil/Unstructured: 31.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF14559TPR_19 17.83
PF13432TPR_16 4.65
PF13414TPR_11 2.33
PF07719TPR_2 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.12 %
UnclassifiedrootN/A3.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10862383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300001632|JGI20235J16296_1008401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300002245|JGIcombinedJ26739_100220957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1787Open in IMG/M
3300004631|Ga0058899_11710181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300004635|Ga0062388_101090865All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300005602|Ga0070762_10980430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300005610|Ga0070763_10812653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300005712|Ga0070764_10062021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1936Open in IMG/M
3300005712|Ga0070764_10945559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300005921|Ga0070766_10020990All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3471Open in IMG/M
3300005950|Ga0066787_10067779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300006176|Ga0070765_101400883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300006176|Ga0070765_101480787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300006176|Ga0070765_102288748All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300006640|Ga0075527_10232793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300009629|Ga0116119_1034478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1349Open in IMG/M
3300009630|Ga0116114_1166544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300009759|Ga0116101_1023382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1226Open in IMG/M
3300009759|Ga0116101_1044606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium941Open in IMG/M
3300009824|Ga0116219_10832816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300010379|Ga0136449_100962619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1380Open in IMG/M
3300010379|Ga0136449_103415044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300011120|Ga0150983_13503726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300011271|Ga0137393_11766576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300012930|Ga0137407_12263241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300012944|Ga0137410_10251320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1385Open in IMG/M
3300014162|Ga0181538_10440484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300014162|Ga0181538_10653290All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300014165|Ga0181523_10111901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1632Open in IMG/M
3300014492|Ga0182013_10046506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3363Open in IMG/M
3300014502|Ga0182021_10603508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1313Open in IMG/M
3300014657|Ga0181522_10128493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1475Open in IMG/M
3300014657|Ga0181522_10488103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300014838|Ga0182030_10280747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1861Open in IMG/M
3300016404|Ga0182037_10886050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium773Open in IMG/M
3300017935|Ga0187848_10149483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300017935|Ga0187848_10311523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300017940|Ga0187853_10067318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1807Open in IMG/M
3300017946|Ga0187879_10053642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2370Open in IMG/M
3300017972|Ga0187781_10213386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1363Open in IMG/M
3300017974|Ga0187777_10504567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300018017|Ga0187872_10447051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300018034|Ga0187863_10063569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2092Open in IMG/M
3300018042|Ga0187871_10067612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2106Open in IMG/M
3300018047|Ga0187859_10679701All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300018047|Ga0187859_10818597All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300018085|Ga0187772_10223450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1272Open in IMG/M
3300018090|Ga0187770_11696971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300019082|Ga0187852_1306645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300019882|Ga0193713_1154876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300020580|Ga0210403_11206341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300021170|Ga0210400_11443482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300021171|Ga0210405_11273845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300021180|Ga0210396_10871236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300021181|Ga0210388_10954027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium737Open in IMG/M
3300021401|Ga0210393_10113808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2159Open in IMG/M
3300021401|Ga0210393_10350773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1201Open in IMG/M
3300021402|Ga0210385_10234110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1345Open in IMG/M
3300021405|Ga0210387_10347228All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1311Open in IMG/M
3300021405|Ga0210387_10633632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium949Open in IMG/M
3300021405|Ga0210387_11178674All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300021406|Ga0210386_11406136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300021407|Ga0210383_10129926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2133Open in IMG/M
3300021420|Ga0210394_10583825All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium982Open in IMG/M
3300021420|Ga0210394_10964249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300021474|Ga0210390_10368449All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1215Open in IMG/M
3300021478|Ga0210402_11583364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300022733|Ga0224562_1001396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1691Open in IMG/M
3300024176|Ga0224565_1020329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300024225|Ga0224572_1008855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1869Open in IMG/M
3300026502|Ga0255350_1048456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1019Open in IMG/M
3300027110|Ga0208488_1060742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300027505|Ga0209218_1060734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300027537|Ga0209419_1123424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300027619|Ga0209330_1144028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300027629|Ga0209422_1143252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300027634|Ga0209905_1037551All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300027667|Ga0209009_1054593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1000Open in IMG/M
3300027674|Ga0209118_1032187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1605Open in IMG/M
3300027692|Ga0209530_1214679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300027853|Ga0209274_10030398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2501Open in IMG/M
3300027853|Ga0209274_10068694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1709Open in IMG/M
3300027855|Ga0209693_10370877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300027884|Ga0209275_10252988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium967Open in IMG/M
3300027884|Ga0209275_10279698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300027884|Ga0209275_10398247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300027889|Ga0209380_10088920All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1777Open in IMG/M
3300027895|Ga0209624_10140236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1595Open in IMG/M
3300027895|Ga0209624_10635992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300027895|Ga0209624_10788742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300028015|Ga0265353_1027320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300028759|Ga0302224_10186470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300028789|Ga0302232_10648391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300028789|Ga0302232_10674810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300028795|Ga0302227_10083955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1353Open in IMG/M
3300028800|Ga0265338_10803260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300028808|Ga0302228_10142040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1109Open in IMG/M
3300028871|Ga0302230_10175345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300028906|Ga0308309_10564793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300028906|Ga0308309_11032212All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300028906|Ga0308309_11203744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300028906|Ga0308309_11560845All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300029993|Ga0302304_10090653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1178Open in IMG/M
3300030509|Ga0302183_10240047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300030518|Ga0302275_10042982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3471Open in IMG/M
3300030617|Ga0311356_10646530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300030862|Ga0265753_1030348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium869Open in IMG/M
3300030862|Ga0265753_1060334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300031247|Ga0265340_10291057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300031247|Ga0265340_10301843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300031708|Ga0310686_100290120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300031708|Ga0310686_102047103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300031718|Ga0307474_11471088All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031797|Ga0318550_10396306All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300031947|Ga0310909_10792129All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300031954|Ga0306926_11209221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium887Open in IMG/M
3300031954|Ga0306926_12047207All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300032059|Ga0318533_10344858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1084Open in IMG/M
3300032160|Ga0311301_10957129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1141Open in IMG/M
3300032515|Ga0348332_13538469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300032892|Ga0335081_10465303All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1603Open in IMG/M
3300033546|Ga0316213_1010238All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300033825|Ga0334843_020754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium874Open in IMG/M
3300034163|Ga0370515_0041434All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2054Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil14.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil13.18%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.43%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.10%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.10%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.10%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.33%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.33%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.33%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.55%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.78%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.78%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001632Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300022872Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25EnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300026502Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028015Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033546Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2Host-AssociatedOpen in IMG/M
3300033825Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1086238323300001593Forest SoilMGSASKGIEKLGSAGLVLEAILLSVLGILLLVGFIVLRRWYRARYFHKRNRRTVALRSQWDDILSGKIPAKDWRFKPLDCEIVESILLD
JGI20235J16296_100840123300001632Forest SoilMGSVFSAIEKSGPAGLVLRAIIASLLGIFLLIGFIVLRRWYRARYFRRRNQRTVALRSQWDDIVSGKIPPLDWRFDPLDCDIVESILLDQIEMSLPDDLPPLLNCLRLSGL
JGIcombinedJ26739_10022095723300002245Forest SoilMGSVFKGIQKLGSAGLVLEAILLSVLGILLLVGFIVLRRWYRARYFHKRNRRTVALRSQWDDILSGKIPAEDWRFKPLDCDIVESILLDSIEMSAADKLAPLLDCLRVSGLLDMRIYEARTSRGLTQRT
Ga0058899_1171018123300004631Forest SoilMESIFNRIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSRWDEILSGKISAEDWRFDPLDCNIVESILLDNI
Ga0062388_10109086523300004635Bog Forest SoilMGSAFSAIEKLGAAGMVVKAILGSLLGIFLLIGFIILRRWYRSRYFRRRSERTFALRSQWDDIVSGKIPLTTWRLDPLDCEIVES
Ga0070762_1098043013300005602SoilMGSIFKGIEKLGAAGLVLEAILISLLGIFLLVGFIVLRRWYRARYFHKRNLRTVALRSQWNDILSGKMPAEDWRFDPLDCDIVESILLDSIEM
Ga0070763_1081265313300005610SoilMASVFNGIEKLGPAGLVLQAILFSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDC
Ga0070764_1006202133300005712SoilMEFVFNGIEKLGPAGLVLQAILVSLLGIILLVGFIVLRRWYRARYFRRRNERTVVLRSQWDDILSGKISAEAWRFNPLDCDIVESILLDSIE
Ga0070764_1094555923300005712SoilMAFVFSAVEKLGPAGLVLRAIMGSVLGICLLIGFIVLRRWYRARYFRRRNERTVALRSWWDNIISGKISALDWRFDPLDCDIVESILLDNIEMSTPA
Ga0070766_1002099013300005921SoilMGSAFKGIQKLGSAGLVLEAILLSVLGILLLVGFIVLRRWYRARYFHKRNRRTVALRSQWDDILSGKIPAEDWRFKPLDCDIVESILLDSIEMSAADKLPPLLDCLRVSGLLDMRIYEARTSRGLTQ
Ga0066787_1006777913300005950SoilMGSVFKGIDKLGAAGLVLEAILVSLLGILLLVGFIALRRWYRARYFHKRNLRTVALRAQWNEILSGKIPATEWRFDSLDCDIVESILLDSIETSP
Ga0070765_10140088313300006176SoilMGSVFKGIEKLGPAGLVLEAILASLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSCKIPAKDWRFNLLDCDIVESILLDGIEMSPPDKLPPLLDCLRVSGLLDMRIY
Ga0070765_10148078713300006176SoilMGSVSKGIEKLGPTGLVLEAILASLLGILLLVGFIVVRRWYRARYFRKRNQRTVALRSQWEDILSGKIPAEDWRFNPLDCD
Ga0070765_10228874813300006176SoilMGSVFSAIEKSGPAGLVLRAIIASLLGIFLLIGFIVLRRWYRARYFRRRNQRTVALRSQWDDIVSGKIPPLDWRFDPLDCDIVESILLDQIE
Ga0075527_1023279313300006640Arctic Peat SoilMGSVFKEIAKLGAAGFVLEAILVSLLGILLLVGFIVLRRWYRARYFHRRNQRTVALRSQWDDILCGKIPAKNWRFNALDCDIVESILLDSIEMSPADQLPALLDCL
Ga0116119_103447823300009629PeatlandMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKIAAENWRFN
Ga0116114_116654413300009630PeatlandMGSVFSAIEHSGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSQWNDIVSGKIPPPDWRFDPLDCDIVESILLDNIEMSAPDGLPPLLDCLRVSGLLDMLI
Ga0116101_102338223300009759PeatlandMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQHTVALRSQWDEILSGKIAAENWRFNALDCEIVESILLDSI
Ga0116101_104460613300009759PeatlandMGSATKGIEKLGAAGLVLEAILVSLLGILLLVGFIVLRRWYRARYFHKRNLRTVALRSQWDDILSGKIPAADWRFKPLDCEIVESILLDTIEMSPADELSPLLDCLRVSGLLDMRIYEARTSRGLK
Ga0116219_1083281623300009824Peatlands SoilMEFVFSPIEKLGPAGLVVKAILGSLLGIFLLIGFIILRRWYRARYFRRRSERTLALRTQWDDIVSGKVPLLDWRLDPLDCEIVESILLDSVETAAPEQLPGLLDCLR
Ga0136449_10096261913300010379Peatlands SoilMGYVFSAIEKLGPAGLVLKAILGSLLGIFLLIGFIILRRWYRARYFRRRSERTLALRTQWDDIVSGKVPLLDWRLDPLDCEIVESILLDSVETAAPEQLPGLLDCL
Ga0136449_10341504413300010379Peatlands SoilMGSVFSAIEKSGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSQWNDIVSGKIPPPDWRFDPLDCNIVESILLDNIEMSAPDGLPPLLD
Ga0150983_1350372613300011120Forest SoilMESIFNRIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSRWDEILSGKISAEDWRFDPLDCNIVESILLDN
Ga0137393_1176657613300011271Vadose Zone SoilMESVFSGIEKLGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRNERTAALRAQWDDIVSGKIPPQDWRFDPLACDIVESILLDNIEMSAPDDLPPLLNCLR
Ga0137407_1226324123300012930Vadose Zone SoilMVSISNGIEKLGTAGLVLQAILASLAGIFLLVGFIVLRRWYRARYFRRRNERTVALRSQWDEILSGQISAGDWRFNP
Ga0137410_1025132013300012944Vadose Zone SoilMVSISNGIEKLGTAGLVLQAILASLVGIFLLVGFIVLRRWYRARYFRRRNERTVALRSQWDEILSGQISAGDWRFNPLDCAIVESILLDNIEMSPADKLPPLLDCFRLSGLLDMRIYEARTSRGW
Ga0181538_1044048423300014162BogMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQHTVALRSQWDEILSGKIAAENWRFNALDCEIVESILLDSIEMSSADKLPPLLDCLRVSGLLDMRIYEAR
Ga0181538_1065329013300014162BogMGFISSAIEALGPAGLVLKAILLSLLGILLLVGFIISRRWYRGRYFRRRNRRTVALRAQWEDIVSGKVPPGDWRFNPLD
Ga0181523_1011190123300014165BogMGSVFSAIEHSGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSQWNDIVSGKIPPPDWRFDPLDCDIVESILL
Ga0182013_1004650633300014492BogMGFISSAIEALGPAGLVLKAILVSLLGILLLVGFIILRRWHRGRYFRRRTERTIILRAQWDDIVSGKVSPLDWRFNALDCDIVESILLDSIEMATPETLPGLLDCL
Ga0182024_1176647023300014501PermafrostMGSTFKGIEKLGPAGLVLEAILVSLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKISAEDWRFNPLDCDIVESILLDSIEMSAAEKLPPLLECLRVSGLLDMRIYEARTSHGLKQRTAL
Ga0182021_1060350823300014502FenMGFISSAIETLGPAGLVLKAILVSLLGILLLVGFIISRRWYRGRYFRHRTERTIVLRAQWDDIVSGKITPRDWRFNALDCDIVESILLDSIEMATPETLPGLLNCLRKSALLDMRVCETRGARGWRRR
Ga0181522_1012849313300014657BogMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQHTVALRSQWDEILSGKIAAENWRFNALDCEIVESILLDSIEMSSADKLPPLLDCLRVSGLLDMSIYEARTSRG
Ga0181522_1048810313300014657BogMASVFSGIEKLGPAGLVLQAILVSLLGIFLLIGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDCDIVESILLDSIEMAPADQLPPLLECLRVSGL
Ga0182030_1028074723300014838BogMGFISSAIETLGPAGLVLQAIVVSLLGILLLVGFIILRRWYRGRYFRRRNSRTVVLRAQWDDIVSGKISPLDWRFNSLDCEIVESILLD
Ga0182033_1137830513300016319SoilMGSVFRAIARSGPTGLVLGAILACLLGIFLLVGFIGFRRWYRARYFRRRNERAVALRAQWSDIVSGKVAPEDWCFQALDAEIVASILLDNIEVSAAEDLPLLLECLRKSGSLDMLIYQARTARTWKRRAALLALGRTR
Ga0182037_1088605013300016404SoilMGSVFRAIARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVILRARWNDIVSGKVAPEEWCLDSLDAEIVGSILLDNIELS
Ga0187848_1014948323300017935PeatlandMGFISSAIETLGPAEMVLKAILGSLLGILLLVGFIVLRRWYRGRYFRRKTERTIALRAQWDDIVSGKVPPRNWRFNPLDCDIVESILLDNIEMGTPETLPSL
Ga0187848_1031152323300017935PeatlandMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQHTVALRSQWDEILSGKIAAENWRFNALDCEIVESILLDSIE
Ga0187853_1006731813300017940PeatlandMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQHTVALRSQWDEILSGKIAAENWRFNALDCEIVESILLDSIEMSSADKLPPLLDCLRVSGLLDMRIYEARTSRG
Ga0187879_1005364213300017946PeatlandMESVFKGIEKLGSAGLVLEAILVSLLGILLLVGFIVLRRWYRARYFYKRNHRTVALRSQWDDILSGKIPAEDWRFKPLDCNIVESILLDSIEMAPPDKLPPLLDCLRVSGLLDMRIYEARTSRGL
Ga0187781_1021338623300017972Tropical PeatlandMGSVFSAIAKSGPAGLVLDAILASLLGIILLVGFIVFRRWYRARYFRRRNERTVALRAQWNDIVSGRIPPQDWCFHSLDSDIVQTILLDAIEVSTPKNLPVLLECLRKSGLLDMLIYQAR
Ga0187777_1050456713300017974Tropical PeatlandMGSVFRAVARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRSRYFRRRNERTVVLRARWNDIVSGKVAPEEWCFDSLDAEIVGSILLDNIEVSTPDSLPLLLECLRKSGLLDMLIYQA
Ga0187872_1044705123300018017PeatlandMGFISSAIETLGPAEMVLKAILGSLLGILLLVGFIVLRRWYRGRYFRRKTERTIALRAQWDDIVSGKVPPRNWRFNPLDCDIVESIVLDNIEMGTPETLPSLLDCLRKSGLLDMRVCETR
Ga0187863_1006356933300018034PeatlandMESVFKGIEKLGSAGLVLEAILVSLLGILLLVGFIVLRRWYRARYFYKRNHRTVALRSQWDDILSGKIPAEDWRFKPLDCDIVESILLDSIEMSAADKLPPLLDCL
Ga0187871_1006761233300018042PeatlandMGSATKGIEKLGAAGLVLEAILVSLLGILLLVGFIVLRRWYRARYFHKRNLRTVALRSQWNDILSGKIPAEDWRFKPLDCEIVESILLDTIEMS
Ga0187859_1067970113300018047PeatlandMGFISSAIEALGPAGLVLQAIVISLLGILLLVGFIILRRWYRGRYFRRRNGRTVVLRAQWDDIVSGKISPLEWRFNPLDCEIVESILLDNIEMGTPETLPGLLDCLRKSGLLDMRVRETRGAR
Ga0187859_1081859713300018047PeatlandMGFISSAIETLGPAGLVLQAIVVSLLGILLLVGFIILRRWYRGRYFRRRNGRTVILRAQWDDIVSGKISPLDWRFNSLDCEIVESILLDNIEMGTPETLPALLDCLRKSGLLDMR
Ga0187772_1022345023300018085Tropical PeatlandMGSVFSTVQQSGPAALVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRAQWGDIVSGKIPAAAWRFDPLDCDIVESILLDNIEMASAESLPPLL
Ga0187770_1169697113300018090Tropical PeatlandMGSVFSAIAKFEPAGLVLDAILVSILGIFLLIGFIGFRRWYRAHYFRRRNRRTVALRAQWNDIVSGRVPPQDWCFDPLDSEIVASILLDSIEVSTPEDLPVLLECLRT
Ga0187852_130664523300019082PeatlandMGSVFKGIGKLGSAGLVLEAILVSVLGILLLVGFIVLRRWYRARYFHKRNQHTVALRSQWDDILSGKIAAENWRFNALDCEIVESILLDSIEMSSADKLPPLLDCLRVSGLLDMRIYE
Ga0193713_115487613300019882SoilMVSIFNGIDKLGTAGLVLQAILASLVGIFLLVGFIVLRRWYRARYFRRRNERTVALRSQWDEILSGQISAGDWRFNPLDCAIVESILLDNIEMSPADKLPPLLDCF
Ga0210403_1120634113300020580SoilMGSVFKGIEKLGAAGLVLEAILVSLLGILLLIGFIVLRRWYRARYFHKRNRRTVALRSQWDDILSGKIPAEDWRFKPLDCDIV
Ga0210400_1144348213300021170SoilMAFVFSAVEKLGPAGLVLRAIMGSVLGICLLIGFIVLRRWYRARYFRRRNERTVALRSWWDNIISGKISALDWRFDPLDCDI
Ga0210405_1127384513300021171SoilMGSVFKGIEKLGPAGLVLEAILASLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSCKIPAKDWRFNLLDCDIVES
Ga0210396_1087123623300021180SoilVLEAILVSLLGIVLLVGFIVLRRWYRARYFHKRNRRTVALRSQWHDILSGRLPASAWRFNVLDCDIVESILLDSIEMSSANELSPLLDCLRV
Ga0210388_1095402723300021181SoilMGSVSKGIEKLGAAGLVLEAILVSLLGIVLLVGFIVLRRWYRARYFHKRNRRTVALRSQWHDILSGRLPASAWRFNVLDCDIVESILLDSIEMSSANE
Ga0210393_1011380813300021401SoilMAFVFSAVEKLGPAGLVLRAIMGSVLGICLLIGFIVLRRWYRARYFRRRNERTVALRSWWDNIISGKISALDWRFDPLDCDIVESILLDNIEMSTPANLPPLLDCLRVS
Ga0210393_1035077323300021401SoilMGSVFKGIEKLGAAGLVLEAILVSLLAILLLVGFIALRRWYRARYFRRRNQRTVALRSQWYDILSGKIPAENWRFNPID
Ga0210385_1023411023300021402SoilMGSVSKGIEKLGAAGLVLEAILVSLLGIVLLVGFIVLRRWYRARYFHKRNRRTVALRSQWHDILSGRLPASAWRFNVLDCDIVESILLDSIEMSSANELSPLLDCLRVS
Ga0210387_1034722823300021405SoilMGSVFKGIEKLGPARLVLEAILASLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKIPAEVWRFNLLDCDIV
Ga0210387_1063363213300021405SoilMESFSSVIQRLGPAGLVAKAILGSLLGILLLIGFIILRRWYRARYFRRRSEHTVALRSQWDDIISGKVPPQKWRLDPLDCEIVESILLDGIDTATPDELPELLDC
Ga0210387_1117867423300021405SoilMESIFNRIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSRWDEILSGKISAEDWRFDPLD
Ga0210386_1140613613300021406SoilMGSISNTIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRIRNDRTVALRSQWDEILSGKVSAEDWRFDSLDCD
Ga0210383_1012992613300021407SoilMGSVFKGVQKLGSAGLVLEAILLSVLGILLLVGFIVLRRWYRARYFHKRNRRTVALRSQWDDILSGKIPAEDWRFKPLDCDIVESILLDSIEMSAADKLPPLLDCLRVSGLLDMRIYEARTSRGLAQ
Ga0210394_1058382513300021420SoilMESIFNRIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSRWDEILSGKISAEDWRFDPLDCNIVESILLDNIEMSSADKLPPLLNCLRVSGLLDMRIYQARSSRG
Ga0210394_1096424913300021420SoilMGSVFKGIEKLGPARLVLEAILASLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKIPAEVWRFNLLDCDIVESVLLDGIEMSPAD
Ga0210390_1036844923300021474SoilMESVFSAIEKLGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRSERTVALRACWDEIVSGKIPPLDWRFDSLDCDIVESILLDNIE
Ga0210402_1158336423300021478SoilMESISNGIEKLGPAGLVLQAILVSLLGIFLLVGFIALRRWYRARYFRIRNERTVALRSQWDEILSGKISADDWRFNSLDCDIVESILLDSIEMSPADKLAPLLDCLRVSGLLDMRI
Ga0224562_100139613300022733SoilMEFVFRGIEKLGPAGLVLQAILVSLLGIVLLVGFIVLRRWYRARYFRRRNERTVVLRSRWDDILSGKISAEAWRFNPLDCDIVESLLLDSIEMSSAAN
Ga0224526_109641913300022872SoilMGFISSAIETLGPAEMVLKAILGSLLGILLLVGFIVLRRWYRGRYFRRKTERTIALRAQWDDIVSGKVPPRNWRFNPLDCDIVESILLDNIEMGTPETLPSLLDCLRKSGLLDMRVCETRAARGWRRRTALIA
Ga0224565_102032913300024176Plant LitterMESVFRAIEKLGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRSERTVALRARWNEIVSGTIPPLDWRFDPLDCDIVESILLDNIEMSAPDGLPPLLNCLRVSGLLDMLIYEARTA
Ga0224572_100885523300024225RhizosphereMEFVFRGIEKLGPAGLVLQAILVSLLGIVLLVGFIVLRRWYRARYFRRRNERTVVLRSRWDDILSGKISAEAWRFNPLDCDIVESLLLDSIEMSSAANLPPLLECLRV
Ga0255350_104845613300026502SoilMGFISSAIETLGPAEMVLKAILGSLLGILLLVGFIVLRRWYRGRYFRRKTERTIALRAQWDDIVSGKVPPRNWRFNPLDCDIVESILLDNIEMGTPE
Ga0208488_106074213300027110Forest SoilMASVFNGIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDCDIVESILLDSIEMSSADQLPPLLECLRVSGLLDMRIYEARTTHGW
Ga0209218_106073423300027505Forest SoilMASVFNGIEKLGPAGLVLQAILFSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDCNIVESILLDSIEMSSPDQLPPLLECLRVSGLLDMRIYEARTTH
Ga0209419_112342423300027537Forest SoilMAFVFSAVEKLGPAGLVLRAIMGSVLGICLLIGFIVLRRWYRARYFRRRNERTVALRSWWDNIISGKISALDWRFDPLDCDIVESI
Ga0209008_102193013300027545Forest SoilMGSVFKGIQKLGSAGLVLEAILLSVLGILLLIGFIVLRRWYRARYFHNRNRRTVALRSQWDDILSGKIPAEDWRFKPLDCDIVESILLDSIEMSAADKLPPLLDCLRVSGLLDMRIYEARTSRGLTQRTAL
Ga0209330_114402823300027619Forest SoilMEFVSSSIPQVGPAGLLLRAILGSLLGICFLVGFIVLRRWYRARYFRRRNERTVALRSWWDNIVSGKISALDWRFDPLDCDIVES
Ga0209422_114325213300027629Forest SoilMAFVFSAVEKLGPAGLVLRAIVGSVLGICLLIGFIVLRRWYRARYFRRRNERTVALRSWWDNIISGKISALDWRFDPLDCDIVESILLDNIEMSTPANLPPLLDCLR
Ga0209905_103755113300027634Thawing PermafrostMGFISSAIEALGPAGLVLKAILVSLLGILLLVGFIILRRWHRGRYFRRRTERTIILRAQWDDIVSGKVSPLDWRFNALDCDIVESILLDSIEMATPETLPGLLDC
Ga0209009_105459323300027667Forest SoilMGSVFKGIQKLGSAGLVLEAILLSVLGILLLIGFIVLRRWYRARYFHKRNRRTVALRSQWDDILSGKIPAEDWRFKPLDC
Ga0209118_103218723300027674Forest SoilMGFIFNGIEKLGPTGLVLEAILVSLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKISAEDWRFNPLDCDIVESILLDSIEMSAADKLPPLLDCLRVSGLLDMRIYEARTSRGLRQ
Ga0209530_121467923300027692Forest SoilMASVFNGIEKLGPAGLVLQAILLSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDCNIVESILLDSI
Ga0209274_1003039833300027853SoilMGSVFKGIEKLGPAGLVLEAILASLLGILLLVGFIVLRRRYRARYFQRRNQRTVALRSQWDDILYGKIPAEDWRFNPLDCDIVESILLDSIEMSTADKLPPLLDCLRVSGLLD
Ga0209274_1006869413300027853SoilMGSVSKGIEKLGAAGLVLEAILVSLLGIFLLIGFIVLRRWYRGRYFQKRNQRTVALRSQWNDILSGKILAEDWRFDALD
Ga0209693_1037087713300027855SoilMESIFNGIGKFGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRGRYFRRRNERTVALRAQWDEILSGKISAEDWRFNPLDCDIV
Ga0209275_1025298813300027884SoilMEFVFNGIEKLGPAGLVLQAILVSLLGIVLLVGFIVLRRWYRARYFRRRNERTVVLRSRWDDILSGKISAEAWRFNPLDCDIVESIL
Ga0209275_1027969813300027884SoilMGSVSKGIEKLGPTGLVLEAILASLLGILLLVGFIVVRRWYRARYFRKRNQRTVALRSQWDDILSGKIPAEDWRFNPLDCDIVESILLDSIEMSSAEKLPPLLDCLRDSGLLDMRIYEARTSR
Ga0209275_1039824723300027884SoilMGSVFKGIEKLGPARLVLEAILASLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKIPAEVWRFNLLDCDIVESVLLDGIEMSPADKLPPLLDCLRVSGLLD
Ga0209380_1008892013300027889SoilMGSIFKGIEKLGAAGLVLEAILVSLLGIFLLVGFIVLRRWYRARYFHKRNLHTVALRSQWNDILSGKMPAEDWRFNPLD
Ga0209624_1014023613300027895Forest SoilMGSVSKGIEKLGAAGLVLEAILVSLLGIVLLVGFIVLRRWYRARYFHKRNRRTVALRSQWHDILSGRLPASAWRFNVLDCDIVESILLDSIEM
Ga0209624_1063599223300027895Forest SoilMEFVSSSIPQVGPAGLLLRAILGSLLGICFLVGFIVLRRWYRARYFRRRNERTVALRSWWDNIVSGKISALDWRFDPLDCDIVESILLDNIEMSTHEKLPPLLDCFRISGLLDMRIYEARNS
Ga0209624_1078874213300027895Forest SoilMGSVFKGIQKLGSAGLVLEAILLSVLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKIPAEDWRFNPLDCDIVESILLDSIEMSAADKLPPLLDCLRVSGLLDMRI
Ga0265353_102732013300028015SoilMEFVFNGIEKLGPAGLVLQAILVSLLGIVLLVGFIVLRRWYRARYFRRRNERTVVLRSRWDDILSGKISAEAWRFNPLDCDIVES
Ga0302224_1018647023300028759PalsaMASAFNGIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIISGKISAETWRFDPLDCDIVESILLDSIEMSSADNLPPLLECLRVSGLLDMRIYE
Ga0302232_1064839123300028789PalsaMESVFSAIEKLGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRSERTVALRARWDEIVSGKIPPTDWRFDPLDCDIVESILLDNIEMSAPDGLPPLLNCLRVSGLLDML
Ga0302232_1067481023300028789PalsaMGSVSKGIEKLGAAGLVLEAILASLLGIFLLIGFIVLRRWYRGRYFQKRNERTVALRSQWDDILSGKIPAEDWRFKALDCDIVQSIL
Ga0302227_1008395523300028795PalsaMESVFSAIEKLGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRSERTVALRARWDEIVSGKIPPTDWRFDPLDCDIVESILLDNIEMSAPDGLPPLLNCLRVSGLLDMLIYEARTAHS
Ga0265338_1080326013300028800RhizosphereMGSVFKEIAKLGAAGFVLEAILVSLLGILLLVGFIVLRRWYRARYFHRRNQRTVALRSQWDDILCGKIPAKDWRFNALDCDIVESILLDSIEMSSADQLPPL
Ga0302228_1014204013300028808PalsaMASAFNGIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIISGKISAETWRFDPL
Ga0302230_1017534513300028871PalsaMASAFNGIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIISGKISAETWRFDPLDCDIVES
Ga0308309_1056479313300028906SoilMGSIFKGIEKLGAAGLVLEAILISLLGIFLLVGFIVLRRWYRARYFHKRNLRTVALRSQWNDILSGKMPAEDWRFDPLDCDIVESILLDSIEMSSADELVPLLDCLRVSGLLDMRIYE
Ga0308309_1103221223300028906SoilMGSVSKGIEKLGPTGLVLEAILASLLGILLLVGFIVVRRWYRARYFRKRNQRTVALRSQWEDILSGKIPAEDWRFNPLDCDIVESILLDSIEMSSAEKLPPLLDCL
Ga0308309_1120374413300028906SoilMEFVFNRIEKLGPAGLVLQAILISLLGIVLLVGFIVLRRWYRARYFRRRNERTVVLRSRWDDILSGKISAEAWRLNPLDCDIVESILLDSIEMSSAADLPPLLECLRVSGLLDTRIYEARTTQG
Ga0308309_1156084513300028906SoilMGSTFSAVEKLGAAGMVVKAILGSMLGIFLLIGFIILRRWYRSRYFRRRSERTFALRSQWDDIVSGKIPLTTWRLDPLDCEIVES
Ga0302304_1009065313300029993PalsaMGSVSKGIEKLGAAGLVLEAILASLLGIFLLIGFIVLRRWYRGRYFQKRNERTVALRSQWNDILSGKIPAEDWRFKALDCDIVQSILLDSIETSPADELPPLLDCLRVSGL
Ga0302183_1024004723300030509PalsaMESVFSAIEKLGPAGLVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRRSERTVALRARWDEIVSGKIPPTDWRFDPLDCDIVESILLDN
Ga0302275_1004298213300030518BogMGFISSAIETLGPAEMVLKAILGSLLGILLLVGFIVLRRWYRGRYFRRKTERTIALRAQWDDIVSGKVPPRNWRFNPLDCDIVESILLDN
Ga0311356_1064653023300030617PalsaMASAFNGIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIISGKISAETWRFDPLDCDIVESILLDSIEMSSADNLPPLLECLRVSGL
Ga0265753_103034823300030862SoilMAFVFSAVEKLGPAGLVLRAIMGSVLGICLLIGFIVLRRWYRARYFRRRNERTVALRSWWDNIISGKISALDWRFDPLDCDIVESILLDNIEMS
Ga0265753_106033423300030862SoilMGFIFNGIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDDILSGTISAEAWRFDPLDCDIVESILLDSIEMSSADNLPPLLECLRVSGLLDMR
Ga0265340_1029105723300031247RhizosphereMGSVFKEIAKLGAAGFVLEAILVSLLGILLLVGFIVLRRWYRARYFHRRNQRTVALRSQWDDILCGKIPAKDWRFNALDCDIVESILLDSIEMSSADQ
Ga0265340_1030184323300031247RhizosphereMGFISSAIEALGPAGLVLKAILVSLLGILLLVGFIILRRWYRGRYFRRRNGRTVALRAQWEDIVSGKVPPGDWRFNPLDCDIVESILLDNI
Ga0310686_10029012013300031708SoilMGSVFRGIEKLGPAGLVLEAILASLLGILLLVGFIVLRRWYRARYFHKRNQRTVALRSQWDDILSGKIPAEDWRFNPLDCDIVESILLDSIEMSQPDKLPVLLECLRVSGLL
Ga0310686_10204710323300031708SoilMASVFNGIEKLGPAGLVLQAILLSLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDCDIVESILLDSIEMSSADQLPPLLECLRVSGLLDMRIYQARTTHGW
Ga0307474_1147108813300031718Hardwood Forest SoilMESIFNRIEKLGPAGLVLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNERTVALRSRWDEILSGKISAEDWRFDPLDCNIVESILLDNIEMSS
Ga0318550_1039630623300031797SoilMGSVFRAIARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVILRARWSDIVSGKVAPEEWCLDSLDAEIVGSILLDNIELSTAESLPLLL
Ga0310909_1079212923300031947SoilMGSVFRAIARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVILRARWNDIVSGKVAPEEWCLDSLDAEIVGSILLDNIELSTAESLPLLLECLRKSGLLDMLIYQARTACSWRQRAALLA
Ga0306926_1120922113300031954SoilMGSVFRAIARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVILRARWNDIVSGKVAPEEWCLDSLDAEIVGSILLDNIELSTAESLPLLLECLR
Ga0306926_1204720723300031954SoilMGSVFRAIARSGPTGLVLGAILACLLGIFLLVGFIGFRRWYRARYFRRRNERAVALRAQWSDIVSGKVAPEDWCFQALDAEIVASILLDNIEVSAAEDLPLLLECLRKSGSLDMLIYQARTARTWKRRAALLA
Ga0318533_1034485833300032059SoilMGSVFRAIARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVILRARWSDIVSGKVAPEEWCLDSLDAEIVGSILLDNIELSTAESLPLLLECLRKSGLLDMLIYQAR
Ga0306924_1020367853300032076SoilMGSVFRAIARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVILRARWSDIVSGKVAPEEWCLDSLDAEIVGSILLDNIELSTAESLPLLLECLRKSGLLDMLIYQARTACSWRQRAALLALGRTRAKE
Ga0311301_1095712923300032160Peatlands SoilMGYVFSAIEKLGPAGLVLKAILGSLLGIFLLIGFIILRRWYRARYFRRRSERTLALRTQWDDIVSGKVPLLDWRLDPLDCEIVESILLDSVETAAPEQLPGLLDCLRSSGLVDL
Ga0348332_1353846913300032515Plant LitterMGSVFRAIEQSGTAGFVLRAILGSLLGIFLLVGFIVLRRWYRARYFRRMNERTVALRSQWNDIVSGKIPPKDWRFNSLDCEIVESILLDNIEM
Ga0335081_1046530313300032892SoilMGSVFKAVARSGPTGLVLGAILVSLLGIFLLVGFIVFRRWYRARYFRRRNERTVVLRARWNDIVSGKVAPEEWCFDSLDAEIVGSILLDNIEVS
Ga0316213_101023823300033546RootsMKFIFNGIEKLGPAGLVLQAILISLLGIFLLVGFIVLRRWYRARYFRRRNDRTVALRSQWDEIVSGKISAETWRFDALDCDIVESILLDSIEMSSADNLPPLLECLRISGLLDLRIYEARTTRGWKQRT
Ga0334843_020754_596_8743300033825SoilMESIFNGIDKFGPAGLLLQAILVSLLGIFLLVGFIVLRRWYRARYFRRRNQRTAALRSQWEEILSGTIAAKDWRFNTLDCDIVESILLDSIEM
Ga0370515_0041434_1767_20543300034163Untreated Peat SoilMGSASKGIEKLGPAGLVLEAILVSLLGIFLLVGFIALRRWYRARYFHRRNQRTIAIRSQWDDILCGNIPAEDWRFNPLDCDIVESILLDSIEMSPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.